diff --git a/README.md b/README.md index fc197e0674..793208ec82 100644 --- a/README.md +++ b/README.md @@ -293,19 +293,20 @@ For a *band* scale, you can further fine-tune padding: Align defaults to 0.5 (centered). Band scale padding defaults to 0.1 (10% of available space reserved for separating bands), while point scale padding defaults to 0.5 (the gap between the first point and the edge is half the distance of the gap between points, and likewise for the gap between the last point and the opposite edge). Note that rounding and mark insets (e.g., for bars and rects) also affect separation between adjacent marks. -Plot automatically generates axes for position scales. You can configure these axes with the following options: +Plot automatically generates [axis](#axis) and optionally [grid](#grid) marks for position scales. (For more control, declare these marks explicitly.) You can configure the implicit axes with the following scale options: -* *scale*.**axis** - the orientation: *top* or *bottom* for *x*; *left* or *right* for *y*; null to suppress -* *scale*.**ticks** - the approximate number of ticks to generate -* *scale*.**tickSize** - the size of each tick (in pixels; default 6) +* *scale*.**axis** - the orientation: *top* or *bottom* for *x* and *fx*; *left* or *right* for *y* and *fy*; null to suppress +* *scale*.**ticks** - the approximate number of ticks to generate, or interval, or array of values +* *scale*.**tickSize** - the length of each tick (in pixels; default 6 for *x* and *y*, or 0 for *fx* and *fy*) +* *scale*.**tickSpacing** - the approximate number of pixels between ticks (if *scale*.**ticks** is not specified) * *scale*.**tickPadding** - the separation between the tick and its label (in pixels; default 3) -* *scale*.**tickFormat** - to format tick values, either a function or format specifier string; see [Formats](#formats) +* *scale*.**tickFormat** - either a function or specifier string to format tick values; see [Formats](#formats) * *scale*.**tickRotate** - whether to rotate tick labels (an angle in degrees clockwise; default 0) * *scale*.**grid** - if true, draw grid lines across the plot for each tick -* *scale*.**line** - if true, draw the axis line +* *scale*.**line** - if true, draw the axis line (only for *x* and *y*) * *scale*.**label** - a string to label the axis * *scale*.**labelAnchor** - the label anchor: *top*, *right*, *bottom*, *left*, or *center* -* *scale*.**labelOffset** - the label position offset (in pixels; default 0, typically for facet axes) +* *scale*.**labelOffset** - the label position offset (in pixels; default depends on margins and orientation) * *scale*.**fontVariant** - the font-variant attribute for axis ticks; defaults to tabular-nums for quantitative axes * *scale*.**ariaLabel** - a short label representing the axis in the accessibility tree * *scale*.**ariaDescription** - a textual description for the axis @@ -585,6 +586,12 @@ When top-level faceting is used, the default *auto* setting is equivalent to *in When mark-level faceting is used, the default *auto* setting is equivalent to *include*: the mark will be faceted if either the *mark*.**fx** or *mark*.**fy** channel option (or both) is specified. The null or false option will disable faceting, while *exclude* draws the subset of the mark’s data *not* in the current facet. +The *mark*.**facetAnchor** option controls TK. It supports the following settings: + +* null - display the mark on each non-empty facet (default for all marks, with the exception of axis marks) +* *top*, *right*, *bottom*, or *left* - display the mark on facets on the specified side +* *top-empty*, *right-empty*, *bottom-empty*, or *left-empty* - display the mark on facets that have an empty space on the specified side (the empty space being either the margin, or an empty facet); this is the default for axis marks + ## Legends Plot can generate legends for *color*, *opacity*, and *symbol* [scales](#scale-options). (An opacity scale is treated as a color scale with varying transparency.) For an inline legend, use the *scale*.**legend** option: @@ -958,6 +965,50 @@ Returns a new arrow with the given *data* and *options*. +### Axis + +[Source](./src/marks/axis.js) · [Examples](https://observablehq.com/@observablehq/plot-axis) · Draws an axis. + +Plot automatically generates axes for position scales, and draws them below the other marks. Each axis is composed of up to 5 marks: a grid, and an axis mark which might contain a line, ticks, tick labels, and axis label. + +When you need more control, you can add axis and grid marks explicitly in the marks options. Note that Plot’s automatic axis for *x* is disabled when a mark’s aria-label property begins by `x-axis `—and likewise for *y*, *fx*, and *fy*. + +The optional *data* is an array of tick values—it defaults to the scale’s ticks. + +The axis options described in [position options](#position-options) are all supported, except the **grid** option which is handled by the [grid](#grid) mark. The **y** channel, if any, describes the vertical position of the tick and defaults to the axis anchor. + +The **axis** option, in this context, is called **anchor** and is one of *top* or *bottom*. + +The **color** option controls both **stroke** for the ticks, and the **fill** for labels. It defaults to currentColor. + +The (rarely used) text label’s stroke is controlled by the **textStroke**,**textStrokeOpacity**, and **textStrokeWidth** options. + +The **facetAnchor** option defaults to *bottom-empty* if anchor is bottom, and *top-empty* if anchor is top. This ensures the proper positioning of the axes with respect to empty facets. + +#### Plot.axisX(*data*, *options*) + + + +```js +Plot.axisX({anchor: "bottom"}) +``` + +Returns a new *x*-axis with the given *options*. + + + +#### Plot.axisY(*data*, *options*) + +…same… + +#### Plot.axisFx(*data*, *options*) + +…same… + +#### Plot.axisFy(*data*, *options*) + +…same… + ### Bar [a bar chart](https://observablehq.com/@observablehq/plot-bar) @@ -1358,6 +1409,52 @@ Plot.graticule() Returns a new geo mark with a [default 10° global graticule](https://github.com/d3/d3-geo/blob/main/README.md#geoGraticule10) geometry object and the given *options*. +### Grid + +[Source](./src/marks/axis.js) · [Examples](https://observablehq.com/@observablehq/plot-axis) · Draws an axis-aligned grid. + +The optional *data* is an array of tick values—it defaults to the scale’s ticks. The grid mark draws a line for each tick value, across the whole frame. + +The following options are supported: + +* **strokeDasharray** - the [stroke dasharray](https://developer.mozilla.org/en-US/docs/Web/SVG/Attribute/stroke-dasharray) for dashed lines, defaults to null + +The following options are supported as constant or data-driven channels: + +* **stroke** - the grid color, defaults to currentColor +* **strokeWidth** - the grid’s line width, defaults to 1 +* **strokeOpacity** - the stroke opacity, defaults to 0.1 +* **y1** - the start of the line, a channel of y positions. +* **y2** - the end of the line, a channel of y positions. + +All the other common options are supported when applicable (e.g., **title**). + +#### Plot.gridX(*data*, *options*) + + + +```js +Plot.gridX({strokeDasharray: "5,3"}) +``` + +Returns a new *x*-grid with the given *options*. + + + +#### Plot.gridY(*data*, *options*) + +…same… + + +#### Plot.gridFx(*data*, *options*) + +…same… + +#### Plot.gridFy(*data*, *options*) + +…same… + + ### Hexgrid The hexgrid mark can be used to support marks using the [hexbin](#hexbin) layout. @@ -1950,7 +2047,7 @@ For example, to draw bars only for letters that commonly form vowels: Plot.barY(alphabet, {filter: d => /[aeiou]/i.test(d.letter), x: "letter", y: "frequency"}) ``` -The **filter** transform is similar to filtering the data with [*array*.filter](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Array/filter), except that it will preserve [faceting](#faceting) and will not affect inferred [scale domains](#scale-options); domains are inferred from the unfiltered channel values. +The **filter** transform is similar to filtering the data with [*array*.filter](https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/Array/filter), except that it will preserve [faceting](#facet-options) and will not affect inferred [scale domains](#scale-options); domains are inferred from the unfiltered channel values. ```js Plot.barY(alphabet.filter(d => /[aeiou]/i.test(d.letter)), {x: "letter", y: "frequency"}) diff --git a/src/axes.js b/src/axes.js index 672ae94c06..8ff27f4084 100644 --- a/src/axes.js +++ b/src/axes.js @@ -1,172 +1,22 @@ -import {extent} from "d3"; -import {AxisX, AxisY} from "./axis.js"; -import {formatDefault} from "./format.js"; -import {isOrdinalScale, isTemporalScale, scaleOrder} from "./scales.js"; -import {position, registry} from "./scales/index.js"; - -export function Axes( - {x: xScale, y: yScale, fx: fxScale, fy: fyScale}, - { - x = {}, - y = {}, - fx = {}, - fy = {}, - axis = true, - grid, - line, - label, - facet: {axis: facetAxis = axis, grid: facetGrid, label: facetLabel = label} = {} - } = {} -) { - let {axis: xAxis = axis} = x; - let {axis: yAxis = axis} = y; - let {axis: fxAxis = facetAxis} = fx; - let {axis: fyAxis = facetAxis} = fy; - if (!xScale) xAxis = null; - else if (xAxis === true) xAxis = "bottom"; - if (!yScale) yAxis = null; - else if (yAxis === true) yAxis = "left"; - if (!fxScale) fxAxis = null; - else if (fxAxis === true) fxAxis = xAxis === "bottom" ? "top" : "bottom"; - if (!fyScale) fyAxis = null; - else if (fyAxis === true) fyAxis = yAxis === "left" ? "right" : "left"; - return { - ...(xAxis && {x: new AxisX(xScale, {grid, line, label, ...x, axis: xAxis})}), - ...(yAxis && {y: new AxisY(yScale, {grid, line, label, ...y, axis: yAxis})}), - ...(fxAxis && {fx: new AxisX(fxScale, {name: "fx", grid: facetGrid, label: facetLabel, ...fx, axis: fxAxis})}), - ...(fyAxis && {fy: new AxisY(fyScale, {name: "fy", grid: facetGrid, label: facetLabel, ...fy, axis: fyAxis})}) - }; -} - -// Mutates axis.ticks! -// TODO Populate tickFormat if undefined, too? -export function autoAxisTicks({x, y, fx, fy}, {x: xAxis, y: yAxis, fx: fxAxis, fy: fyAxis}) { - if (fxAxis) autoAxisTicksK(fx, fxAxis, 80); - if (fyAxis) autoAxisTicksK(fy, fyAxis, 35); - if (xAxis) autoAxisTicksK(x, xAxis, 80); - if (yAxis) autoAxisTicksK(y, yAxis, 35); -} - -function autoAxisTicksK(scale, axis, k) { - if (axis.ticks === undefined) { - const interval = scale.interval; - if (interval !== undefined) { - const [min, max] = extent(scale.scale.domain()); - axis.ticks = interval.range(interval.floor(min), interval.offset(interval.floor(max))); - } else { - const [min, max] = extent(scale.scale.range()); - axis.ticks = (max - min) / k; - } - } - // D3’s ordinal scales simply use toString by default, but if the ordinal - // scale domain (or ticks) are numbers or dates (say because we’re applying a - // time interval to the ordinal scale), we want Plot’s default formatter. - if (axis.tickFormat === undefined && isOrdinalScale(scale)) { - axis.tickFormat = formatDefault; - } -} - -// Mutates axis.{label,labelAnchor,labelOffset} and scale.label! -export function autoScaleLabels(channels, scales, {x, y, fx, fy}, dimensions, options) { - if (fx) { - autoAxisLabelsX(fx, scales.fx, channels.get("fx")); - if (fx.labelOffset === undefined) { - const {facetMarginTop, facetMarginBottom} = dimensions; - fx.labelOffset = fx.axis === "top" ? facetMarginTop : facetMarginBottom; - } - } - if (fy) { - autoAxisLabelsY(fy, fx, scales.fy, channels.get("fy")); - if (fy.labelOffset === undefined) { - const {facetMarginLeft, facetMarginRight} = dimensions; - fy.labelOffset = fy.axis === "left" ? facetMarginLeft : facetMarginRight; - } - } - if (x) { - autoAxisLabelsX(x, scales.x, channels.get("x")); - if (x.labelOffset === undefined) { - const {marginTop, marginBottom, facetMarginTop, facetMarginBottom} = dimensions; - x.labelOffset = x.axis === "top" ? marginTop - facetMarginTop : marginBottom - facetMarginBottom; - } - } - if (y) { - autoAxisLabelsY(y, x, scales.y, channels.get("y")); - if (y.labelOffset === undefined) { - const {marginRight, marginLeft, facetMarginLeft, facetMarginRight} = dimensions; - y.labelOffset = y.axis === "left" ? marginLeft - facetMarginLeft : marginRight - facetMarginRight; - } - } - for (const [key, type] of registry) { - if (type !== position && scales[key]) { - // not already handled above - autoScaleLabel(key, scales[key], channels.get(key), options[key]); - } - } -} - -// Mutates axis.labelAnchor, axis.label, scale.label! -function autoAxisLabelsX(axis, scale, channels) { - if (axis.labelAnchor === undefined) { - axis.labelAnchor = isOrdinalScale(scale) ? "center" : scaleOrder(scale) < 0 ? "left" : "right"; - } - if (axis.label === undefined) { - axis.label = inferLabel(channels, scale, axis, "x"); - } - scale.label = axis.label; -} - -// Mutates axis.labelAnchor, axis.label, scale.label! -function autoAxisLabelsY(axis, opposite, scale, channels) { - if (axis.labelAnchor === undefined) { - axis.labelAnchor = isOrdinalScale(scale) - ? "center" - : opposite && opposite.axis === "top" - ? "bottom" // TODO scaleOrder? - : "top"; - } - if (axis.label === undefined) { - axis.label = inferLabel(channels, scale, axis, "y"); - } - scale.label = axis.label; -} - -// Mutates scale.label! -function autoScaleLabel(key, scale, channels, options) { - if (options) { - scale.label = options.label; - } - if (scale.label === undefined) { - scale.label = inferLabel(channels, scale, null, key); - } -} - -// Channels can have labels; if all the channels for a given scale are -// consistently labeled (i.e., have the same value if not undefined), and the -// corresponding axis doesn’t already have an explicit label, then the channels’ -// label is promoted to the corresponding axis. -function inferLabel(channels = [], scale, axis, key) { - let candidate; - for (const {label} of channels) { - if (label === undefined) continue; - if (candidate === undefined) candidate = label; - else if (candidate !== label) return; - } - if (candidate !== undefined) { - // Ignore the implicit label for temporal scales if it’s simply “date”. - if (isTemporalScale(scale) && /^(date|time|year)$/i.test(candidate)) return; - if (!isOrdinalScale(scale)) { - if (scale.percent) candidate = `${candidate} (%)`; - if (key === "x" || key === "y") { - const order = scaleOrder(scale); - if (order) { - if (key === "x" || (axis && axis.labelAnchor === "center")) { - candidate = (key === "x") === order < 0 ? `← ${candidate}` : `${candidate} →`; - } else { - candidate = `${order < 0 ? "↑ " : "↓ "}${candidate}`; - } - } - } - } - } - return candidate; +import {format, utcFormat} from "d3"; +import {formatIsoDate} from "./format.js"; +import {constant, isTemporal, string} from "./options.js"; +import {isOrdinalScale} from "./scales.js"; + +export function inferFontVariant(scale) { + return isOrdinalScale(scale) && scale.interval === undefined ? undefined : "tabular-nums"; +} + +// D3 doesn’t provide a tick format for ordinal scales; we want shorthand when +// an ordinal domain is numbers or dates, and we want null to mean the empty +// string, not the default identity format. TODO Remove this in favor of the +// axis mark’s inferTickFormat. +export function maybeAutoTickFormat(tickFormat, domain) { + return tickFormat === undefined + ? isTemporal(domain) + ? formatIsoDate + : string + : typeof tickFormat === "function" + ? tickFormat + : (typeof tickFormat === "string" ? (isTemporal(domain) ? utcFormat : format) : constant)(tickFormat); } diff --git a/src/axis.js b/src/axis.js deleted file mode 100644 index a733a28e62..0000000000 --- a/src/axis.js +++ /dev/null @@ -1,298 +0,0 @@ -import {axisTop, axisBottom, axisRight, axisLeft, format, utcFormat} from "d3"; -import {create} from "./context.js"; -import {formatIsoDate} from "./format.js"; -import {radians} from "./math.js"; -import {boolean, take, number, string, keyword, maybeKeyword, constant, isTemporal} from "./options.js"; -import {isOrdinalScale, isTemporalScale} from "./scales.js"; -import {applyAttr, impliedString} from "./style.js"; -import {maybeTimeInterval, maybeUtcInterval} from "./time.js"; - -export class AxisX { - constructor( - scale, - { - name = "x", - axis, - ticks, - tickSize = name === "fx" ? 0 : 6, - tickPadding = tickSize === 0 ? 9 : 3, - tickFormat, - fontVariant = inferFontVariant(scale), - grid, - label, - labelAnchor, - labelOffset, - line, - tickRotate, - ariaLabel, - ariaDescription - } = {} - ) { - this.name = name; - this.axis = keyword(axis, "axis", ["top", "bottom"]); - this.ticks = maybeTicks(ticks, scale); - this.tickSize = number(tickSize); - this.tickPadding = number(tickPadding); - this.tickFormat = maybeTickFormat(tickFormat); - this.fontVariant = impliedString(fontVariant, "normal"); - this.grid = boolean(grid); - this.label = string(label); - this.labelAnchor = maybeKeyword(labelAnchor, "labelAnchor", ["center", "left", "right"]); - this.labelOffset = number(labelOffset); - this.line = boolean(line); - this.tickRotate = number(tickRotate); - this.ariaLabel = string(ariaLabel); - this.ariaDescription = string(ariaDescription); - } - render( - index, - {[this.name]: x, fy}, - { - width, - height, - marginTop, - marginRight, - marginBottom, - marginLeft, - offsetLeft = 0, - facetMarginTop, - facetMarginBottom, - labelMarginLeft = 0, - labelMarginRight = 0 - }, - context - ) { - const {axis, fontVariant, grid, label, labelAnchor, labelOffset, line, name, tickRotate} = this; - const offset = name === "x" ? 0 : axis === "top" ? marginTop - facetMarginTop : marginBottom - facetMarginBottom; - const offsetSign = axis === "top" ? -1 : 1; - const ty = offsetSign * offset + (axis === "top" ? marginTop : height - marginBottom); - return create("svg:g", context) - .call(applyAria, this) - .attr("transform", `translate(${offsetLeft},${ty})`) - .call(createAxis(axis === "top" ? axisTop : axisBottom, x, this)) - .call(maybeTickRotate, tickRotate) - .attr("font-size", null) - .attr("font-family", null) - .attr("font-variant", fontVariant) - .call(!line ? (g) => g.select(".domain").remove() : () => {}) - .call( - !grid ? () => {} : fy ? gridFacetX(index, fy, -ty) : gridX(offsetSign * (marginBottom + marginTop - height)) - ) - .call( - !label - ? () => {} - : (g) => - g - .append("text") - .attr("fill", "currentColor") - .attr( - "transform", - `translate(${ - labelAnchor === "center" - ? (width + marginLeft - marginRight) / 2 - : labelAnchor === "right" - ? width + labelMarginRight - : -labelMarginLeft - },${labelOffset * offsetSign})` - ) - .attr("dy", axis === "top" ? "1em" : "-0.32em") - .attr("text-anchor", labelAnchor === "center" ? "middle" : labelAnchor === "right" ? "end" : "start") - .text(label) - ) - .node(); - } -} - -export class AxisY { - constructor( - scale, - { - name = "y", - axis, - ticks, - tickSize = name === "fy" ? 0 : 6, - tickPadding = tickSize === 0 ? 9 : 3, - tickFormat, - fontVariant = inferFontVariant(scale), - grid, - label, - labelAnchor, - labelOffset, - line, - tickRotate, - ariaLabel, - ariaDescription - } = {} - ) { - this.name = name; - this.axis = keyword(axis, "axis", ["left", "right"]); - this.ticks = maybeTicks(ticks, scale); - this.tickSize = number(tickSize); - this.tickPadding = number(tickPadding); - this.tickFormat = maybeTickFormat(tickFormat); - this.fontVariant = impliedString(fontVariant, "normal"); - this.grid = boolean(grid); - this.label = string(label); - this.labelAnchor = maybeKeyword(labelAnchor, "labelAnchor", ["center", "top", "bottom"]); - this.labelOffset = number(labelOffset); - this.line = boolean(line); - this.tickRotate = number(tickRotate); - this.ariaLabel = string(ariaLabel); - this.ariaDescription = string(ariaDescription); - } - render( - index, - {[this.name]: y, fx}, - {width, height, marginTop, marginRight, marginBottom, marginLeft, offsetTop = 0, facetMarginLeft, facetMarginRight}, - context - ) { - const {axis, fontVariant, grid, label, labelAnchor, labelOffset, line, name, tickRotate} = this; - const offset = name === "y" ? 0 : axis === "left" ? marginLeft - facetMarginLeft : marginRight - facetMarginRight; - const offsetSign = axis === "left" ? -1 : 1; - const tx = offsetSign * offset + (axis === "right" ? width - marginRight : marginLeft); - return create("svg:g", context) - .call(applyAria, this) - .attr("transform", `translate(${tx},${offsetTop})`) - .call(createAxis(axis === "right" ? axisRight : axisLeft, y, this)) - .call(maybeTickRotate, tickRotate) - .attr("font-size", null) - .attr("font-family", null) - .attr("font-variant", fontVariant) - .call(!line ? (g) => g.select(".domain").remove() : () => {}) - .call(!grid ? () => {} : fx ? gridFacetY(index, fx, -tx) : gridY(offsetSign * (marginLeft + marginRight - width))) - .call( - !label - ? () => {} - : (g) => - g - .append("text") - .attr("fill", "currentColor") - .attr("font-variant", fontVariant == null ? null : "normal") - .attr( - "transform", - `translate(${labelOffset * offsetSign},${ - labelAnchor === "center" - ? (height + marginTop - marginBottom) / 2 - : labelAnchor === "bottom" - ? height - marginBottom - : marginTop - })${labelAnchor === "center" ? ` rotate(-90)` : ""}` - ) - .attr( - "dy", - labelAnchor === "center" - ? axis === "right" - ? "-0.32em" - : "0.75em" - : labelAnchor === "bottom" - ? "1.4em" - : "-1em" - ) - .attr("text-anchor", labelAnchor === "center" ? "middle" : axis === "right" ? "end" : "start") - .text(label) - ) - .node(); - } -} - -function applyAria(selection, {name, label, ariaLabel = `${name}-axis`, ariaDescription = label}) { - applyAttr(selection, "aria-label", ariaLabel); - applyAttr(selection, "aria-description", ariaDescription); -} - -function gridX(y2) { - return (g) => g.selectAll(".tick line").clone(true).attr("stroke-opacity", 0.1).attr("y2", y2); -} - -function gridY(x2) { - return (g) => g.selectAll(".tick line").clone(true).attr("stroke-opacity", 0.1).attr("x2", x2); -} - -function gridFacetX(index, fy, ty) { - const dy = fy.bandwidth(); - const domain = fy.domain(); - return (g) => - g - .selectAll(".tick") - .append("path") - .attr("stroke", "currentColor") - .attr("stroke-opacity", 0.1) - .attr("d", (index ? take(domain, index) : domain).map((v) => `M0,${fy(v) + ty}v${dy}`).join("")); -} - -function gridFacetY(index, fx, tx) { - const dx = fx.bandwidth(); - const domain = fx.domain(); - return (g) => - g - .selectAll(".tick") - .append("path") - .attr("stroke", "currentColor") - .attr("stroke-opacity", 0.1) - .attr("d", (index ? take(domain, index) : domain).map((v) => `M${fx(v) + tx},0h${dx}`).join("")); -} - -function maybeTicks(ticks, scale) { - return ticks === null - ? [] - : isTemporalScale(scale) && typeof ticks === "string" - ? (scale.type === "time" ? maybeTimeInterval : maybeUtcInterval)(ticks) - : ticks; -} - -function maybeTickFormat(tickFormat) { - return tickFormat === null ? () => null : tickFormat; -} - -// D3 doesn’t provide a tick format for ordinal scales; we want shorthand when -// an ordinal domain is numbers or dates, and we want null to mean the empty -// string, not the default identity format. -export function maybeAutoTickFormat(tickFormat, domain) { - return tickFormat === undefined - ? isTemporal(domain) - ? formatIsoDate - : string - : typeof tickFormat === "function" - ? tickFormat - : (typeof tickFormat === "string" ? (isTemporal(domain) ? utcFormat : format) : constant)(tickFormat); -} - -function createAxis(axis, scale, {ticks, tickSize, tickPadding, tickFormat}) { - if (!scale.tickFormat) { - tickFormat = maybeAutoTickFormat(tickFormat, scale.domain()); - } - return axis(scale) - .ticks(Array.isArray(ticks) ? null : ticks, typeof tickFormat === "function" ? null : tickFormat) - .tickFormat(typeof tickFormat === "function" ? tickFormat : null) - .tickSizeInner(tickSize) - .tickSizeOuter(0) - .tickPadding(tickPadding) - .tickValues(Array.isArray(ticks) ? ticks : null); -} - -function maybeTickRotate(g, rotate) { - if (!(rotate = +rotate)) return; - for (const text of g.selectAll("text")) { - const x = +text.getAttribute("x"); - const y = +text.getAttribute("y"); - if (Math.abs(y) > Math.abs(x)) { - const s = Math.sign(y); - text.setAttribute("transform", `translate(0, ${y + s * 4 * Math.cos(rotate * radians)}) rotate(${rotate})`); - text.setAttribute("text-anchor", Math.abs(rotate) < 10 ? "middle" : (rotate < 0) ^ (s > 0) ? "start" : "end"); - } else { - const s = Math.sign(x); - text.setAttribute( - "transform", - `translate(${x + s * 4 * Math.abs(Math.sin(rotate * radians))}, 0) rotate(${rotate})` - ); - text.setAttribute("text-anchor", Math.abs(rotate) > 60 ? "middle" : s > 0 ? "start" : "end"); - } - text.removeAttribute("x"); - text.removeAttribute("y"); - text.setAttribute("dy", "0.32em"); - } -} - -export function inferFontVariant(scale) { - return isOrdinalScale(scale) && scale.interval === undefined ? undefined : "tabular-nums"; -} diff --git a/src/dimensions.js b/src/dimensions.js index f919629817..a939725599 100644 --- a/src/dimensions.js +++ b/src/dimensions.js @@ -2,35 +2,20 @@ import {projectionAspectRatio} from "./projection.js"; import {isOrdinalScale} from "./scales.js"; import {offset} from "./style.js"; -export function Dimensions(scales, geometry, axes, options = {}) { - // The default margins depend on the presence and orientation of axes. If the - // corresponding scale is not present, the axis is necessarily null. - const {x: {axis: x} = {}, y: {axis: y} = {}, fx: {axis: fx} = {}, fy: {axis: fy} = {}} = axes; +export function Dimensions(scales, marks, options = {}) { + // Compute the default margins: the maximum of the marks’ margins. While not + // always used, they may be needed to compute the default height of the plot. + let marginTopDefault = 0.5 - offset, + marginRightDefault = 0.5 + offset, + marginBottomDefault = 0.5 + offset, + marginLeftDefault = 0.5 - offset; - // Compute the default facet margins. When faceting is not present (and hence - // the fx and fy axis are null), these will all be zero. - let { - facet: { - margin: facetMargin, - marginTop: facetMarginTop = facetMargin !== undefined ? facetMargin : fx === "top" ? 30 : 0, - marginRight: facetMarginRight = facetMargin !== undefined ? facetMargin : fy === "right" ? 40 : 0, - marginBottom: facetMarginBottom = facetMargin !== undefined ? facetMargin : fx === "bottom" ? 30 : 0, - marginLeft: facetMarginLeft = facetMargin !== undefined ? facetMargin : fy === "left" ? 40 : 0 - } = {} - } = options; - - // Coerce the facet margin options to numbers. - facetMarginTop = +facetMarginTop; - facetMarginRight = +facetMarginRight; - facetMarginBottom = +facetMarginBottom; - facetMarginLeft = +facetMarginLeft; - - // Compute the default margins; while not always used, they may be needed to - // compute the default height of the plot. - const marginTopDefault = Math.max((x === "top" ? 30 : 0) + facetMarginTop, y || fy ? 20 : 0.5 - offset); - const marginBottomDefault = Math.max((x === "bottom" ? 30 : 0) + facetMarginBottom, y || fy ? 20 : 0.5 + offset); - const marginRightDefault = Math.max((y === "right" ? 40 : 0) + facetMarginRight, x || fx ? 20 : 0.5 + offset); - const marginLeftDefault = Math.max((y === "left" ? 40 : 0) + facetMarginLeft, x || fx ? 20 : 0.5 - offset); + for (const {marginTop, marginRight, marginBottom, marginLeft} of marks) { + if (marginTop > marginTopDefault) marginTopDefault = marginTop; + if (marginRight > marginRightDefault) marginRightDefault = marginRight; + if (marginBottom > marginBottomDefault) marginBottomDefault = marginBottom; + if (marginLeft > marginLeftDefault) marginLeftDefault = marginLeft; + } // Compute the actual margins. The order of precedence is: the side-specific // margin options, then the global margin option, then the defaults. @@ -52,11 +37,11 @@ export function Dimensions(scales, geometry, axes, options = {}) { // specified explicitly, adjust the automatic height accordingly. let { width = 640, - height = autoHeight(scales, geometry, options, { + height = autoHeight(scales, marks, options, { width, marginTopDefault, - marginBottomDefault, marginRightDefault, + marginBottomDefault, marginLeftDefault }) + Math.max(0, marginTop - marginTopDefault + marginBottom - marginBottomDefault) } = options; @@ -65,30 +50,52 @@ export function Dimensions(scales, geometry, axes, options = {}) { width = +width; height = +height; - return { + const dimensions = { width, height, marginTop, marginRight, marginBottom, - marginLeft, - facetMarginTop, - facetMarginRight, - facetMarginBottom, - facetMarginLeft + marginLeft }; + + // Compute the facet margins. + if (scales.fx || scales.fy) { + let { + margin: facetMargin, + marginTop: facetMarginTop = facetMargin !== undefined ? facetMargin : marginTop, + marginRight: facetMarginRight = facetMargin !== undefined ? facetMargin : marginRight, + marginBottom: facetMarginBottom = facetMargin !== undefined ? facetMargin : marginBottom, + marginLeft: facetMarginLeft = facetMargin !== undefined ? facetMargin : marginLeft + } = options.facet ?? {}; + + // Coerce the facet margin options to numbers. + facetMarginTop = +facetMarginTop; + facetMarginRight = +facetMarginRight; + facetMarginBottom = +facetMarginBottom; + facetMarginLeft = +facetMarginLeft; + + dimensions.facet = { + marginTop: facetMarginTop, + marginRight: facetMarginRight, + marginBottom: facetMarginBottom, + marginLeft: facetMarginLeft + }; + } + + return dimensions; } function autoHeight( {y, fy, fx}, - geometry, + marks, {projection}, - {width, marginTopDefault, marginBottomDefault, marginRightDefault, marginLeftDefault} + {width, marginTopDefault, marginRightDefault, marginBottomDefault, marginLeftDefault} ) { const nfy = fy ? fy.scale.domain().length : 1; // If a projection is specified, use its natural aspect ratio (if known). - const ar = projectionAspectRatio(projection, geometry); + const ar = projectionAspectRatio(projection, marks); if (ar) { const nfx = fx ? fx.scale.domain().length : 1; const far = ((1.1 * nfy - 0.1) / (1.1 * nfx - 0.1)) * ar; // 0.1 is default facet padding diff --git a/src/facet.js b/src/facet.js new file mode 100644 index 0000000000..66f3f33941 --- /dev/null +++ b/src/facet.js @@ -0,0 +1,165 @@ +import {cross, rollup, sum} from "d3"; +import {range} from "./options.js"; +import {Scales} from "./scales.js"; + +// Returns an array of {x?, y?, i} objects representing the facet domain. +export function Facets(channelsByScale, options) { + const {fx, fy} = Scales(channelsByScale, options); + const fxDomain = fx?.scale.domain(); + const fyDomain = fy?.scale.domain(); + return fxDomain && fyDomain + ? cross(fxDomain, fyDomain).map(([x, y], i) => ({x, y, i})) + : fxDomain + ? fxDomain.map((x, i) => ({x, i})) + : fyDomain + ? fyDomain.map((y, i) => ({y, i})) + : undefined; +} + +// Returns an accessor function that returns the order of the given facet value +// in the associated facet scales’ domains. +export function facetOrder({x: X, y: Y}) { + const xi = X && new Map(X.map((v, i) => [v, i])); + const yi = Y && new Map(Y.map((v, i) => [v, i])); + return X && Y + ? (a, b) => xi.get(a.x) - xi.get(b.x) || yi.get(a.y) - yi.get(b.y) + : X + ? (a, b) => xi.get(a.x) - xi.get(b.x) + : (a, b) => yi.get(a.y) - yi.get(b.y); +} + +// Returns a (possibly nested) Map of [[key1, index1], [key2, index2], …] +// representing the data indexes associated with each facet. +export function facetGroups(data, {fx, fy}) { + const I = range(data); + const FX = fx?.value; + const FY = fy?.value; + return fx && fy + ? rollup( + I, + (G) => ((G.fx = FX[G[0]]), (G.fy = FY[G[0]]), G), + (i) => FX[i], + (i) => FY[i] + ) + : fx + ? rollup( + I, + (G) => ((G.fx = FX[G[0]]), G), + (i) => FX[i] + ) + : rollup( + I, + (G) => ((G.fy = FY[G[0]]), G), + (i) => FY[i] + ); +} + +export function facetTranslate(fx, fy, {marginTop, marginLeft}) { + return fx && fy + ? ({x, y}) => `translate(${fx(x) - marginLeft},${fy(y) - marginTop})` + : fx + ? ({x}) => `translate(${fx(x) - marginLeft},0)` + : ({y}) => `translate(0,${fy(y) - marginTop})`; +} + +// Returns an index that for each facet lists all the elements present in other +// facets in the original index. TODO Memoize to avoid repeated work? +export function facetExclude(index) { + const ex = []; + const e = new Uint32Array(sum(index, (d) => d.length)); + for (const i of index) { + let n = 0; + for (const j of index) { + if (i === j) continue; + e.set(j, n); + n += j.length; + } + ex.push(e.slice(0, n)); + } + return ex; +} + +const facetAnchors = new Map([ + ["top", facetAnchorTop], + ["right", facetAnchorRight], + ["bottom", facetAnchorBottom], + ["left", facetAnchorLeft], + ["top-left", and(facetAnchorTop, facetAnchorLeft)], + ["top-right", and(facetAnchorTop, facetAnchorRight)], + ["bottom-left", and(facetAnchorBottom, facetAnchorLeft)], + ["bottom-right", and(facetAnchorBottom, facetAnchorRight)], + ["top-empty", facetAnchorTopEmpty], + ["right-empty", facetAnchorRightEmpty], + ["bottom-empty", facetAnchorBottomEmpty], + ["left-empty", facetAnchorLeftEmpty] +]); + +export function maybeFacetAnchor(facetAnchor) { + if (facetAnchor == null) return null; + const anchor = facetAnchors.get(`${facetAnchor}`.toLowerCase()); + if (anchor) return anchor; + throw new Error(`invalid facet anchor: ${facetAnchor}`); +} + +function facetAnchorTop(facets, {y: Y}, {y}) { + return Y ? Y.indexOf(y) === 0 : true; +} + +function facetAnchorBottom(facets, {y: Y}, {y}) { + return Y ? Y.indexOf(y) === Y.length - 1 : true; +} + +function facetAnchorLeft(facets, {x: X}, {x}) { + return X ? X.indexOf(x) === 0 : true; +} + +function facetAnchorRight(facets, {x: X}, {x}) { + return X ? X.indexOf(x) === X.length - 1 : true; +} + +function facetAnchorTopEmpty(facets, {y: Y}, {x, y}) { + const i = Y?.indexOf(y); + if (i > 0) { + const y = Y[i - 1]; + return facets.find((f) => f.x === x && f.y === y)?.empty; + } +} + +function facetAnchorBottomEmpty(facets, {y: Y}, {x, y}) { + const i = Y?.indexOf(y); + if (i < Y?.length - 1) { + const y = Y[i + 1]; + return facets.find((f) => f.x === x && f.y === y)?.empty; + } +} + +function facetAnchorLeftEmpty(facets, {x: X}, {x, y}) { + const i = X?.indexOf(x); + if (i > 0) { + const x = X[i - 1]; + return facets.find((f) => f.x === x && f.y === y)?.empty; + } +} + +function facetAnchorRightEmpty(facets, {x: X}, {x, y}) { + const i = X?.indexOf(x); + if (i < X?.length - 1) { + const x = X[i + 1]; + return facets.find((f) => f.x === x && f.y === y)?.empty; + } +} + +function and(a, b) { + return function () { + return a.apply(null, arguments) && b.apply(null, arguments); + }; +} + +// Facet filter, by mark; for now only the "eq" filter is provided. +export function facetFilter(facets, {channels: {fx, fy}, groups}) { + return fx && fy + ? facets.map(({x, y}) => groups.get(x)?.get(y) ?? []) + : fx + ? facets.map(({x}) => groups.get(x) ?? []) + : facets.map(({y}) => groups.get(y) ?? []); +} diff --git a/src/index.js b/src/index.js index 1b7c7c4611..406907ba67 100644 --- a/src/index.js +++ b/src/index.js @@ -1,7 +1,8 @@ -export {plot, marks} from "./plot.js"; -export {Mark} from "./mark.js"; +export {plot} from "./plot.js"; +export {Mark, marks} from "./mark.js"; export {Area, area, areaX, areaY} from "./marks/area.js"; export {Arrow, arrow} from "./marks/arrow.js"; +export {axisX, axisY, axisFx, axisFy, gridX, gridY, gridFx, gridFy} from "./marks/axis.js"; export {BarX, BarY, barX, barY} from "./marks/bar.js"; export {boxX, boxY} from "./marks/box.js"; export {Cell, cell, cellX, cellY} from "./marks/cell.js"; diff --git a/src/legends/ramp.js b/src/legends/ramp.js index 09c9b360a2..a5494b1cb8 100644 --- a/src/legends/ramp.js +++ b/src/legends/ramp.js @@ -1,5 +1,5 @@ import {quantize, interpolateNumber, piecewise, format, scaleBand, scaleLinear, axisBottom} from "d3"; -import {inferFontVariant} from "../axis.js"; +import {inferFontVariant} from "../axes.js"; import {Context, create} from "../context.js"; import {map} from "../options.js"; import {interpolatePiecewise} from "../scales/quantitative.js"; diff --git a/src/legends/swatches.js b/src/legends/swatches.js index 39c21e2032..2b4820eeb4 100644 --- a/src/legends/swatches.js +++ b/src/legends/swatches.js @@ -1,6 +1,5 @@ import {pathRound as path} from "d3"; -import {inferFontVariant} from "../axis.js"; -import {maybeAutoTickFormat} from "../axis.js"; +import {inferFontVariant, maybeAutoTickFormat} from "../axes.js"; import {Context, create} from "../context.js"; import {isNoneish, maybeColorChannel, maybeNumberChannel} from "../options.js"; import {isOrdinalScale, isThresholdScale} from "../scales.js"; diff --git a/src/mark.js b/src/mark.js index e707e9d57b..1e44ef5179 100644 --- a/src/mark.js +++ b/src/mark.js @@ -1,5 +1,6 @@ import {Channels, channelDomain, valueObject} from "./channel.js"; import {defined} from "./defined.js"; +import {maybeFacetAnchor} from "./facet.js"; import {arrayify, isDomainSort, range} from "./options.js"; import {keyword, maybeNamed} from "./options.js"; import {maybeProject} from "./projection.js"; @@ -8,7 +9,22 @@ import {basic, initializer} from "./transforms/basic.js"; export class Mark { constructor(data, channels = {}, options = {}, defaults) { - const {facet = "auto", fx, fy, sort, dx, dy, clip, channels: extraChannels} = options; + const { + facet = "auto", + facetAnchor, + fx, + fy, + sort, + dx = 0, + dy = 0, + margin = 0, + marginTop = margin, + marginRight = margin, + marginBottom = margin, + marginLeft = margin, + clip, + channels: extraChannels + } = options; this.data = data; this.sort = isDomainSort(sort) ? sort : null; this.initializer = initializer(options).initializer; @@ -16,10 +32,11 @@ export class Mark { if (facet === null || facet === false) { this.facet = null; } else { - this.facet = keyword(facet === true ? "include" : facet, "facet", ["auto", "include", "exclude"]); + this.facet = keyword(facet === true ? "include" : facet, "facet", ["auto", "include", "exclude", "super"]); this.fx = fx; this.fy = fy; } + this.facetAnchor = maybeFacetAnchor(facetAnchor); channels = maybeNamed(channels); if (extraChannels !== undefined) channels = {...maybeNamed(extraChannels), ...channels}; if (defaults !== undefined) channels = {...styles(this, options, defaults), ...channels}; @@ -30,9 +47,24 @@ export class Mark { throw new Error(`missing channel value: ${name}`); }) ); - this.dx = +dx || 0; - this.dy = +dy || 0; + this.dx = +dx; + this.dy = +dy; + this.marginTop = +marginTop; + this.marginRight = +marginRight; + this.marginBottom = +marginBottom; + this.marginLeft = +marginLeft; this.clip = maybeClip(clip); + // Super-faceting currently disallow position channels; in the future, we + // could allow position to be specified in fx and fy in addition to (or + // instead of) x and y. + if (this.facet === "super") { + if (fx || fy) throw new Error(`super-faceting cannot use fx or fy`); + for (const name in this.channels) { + const {scale} = channels[name]; + if (scale !== "x" && scale !== "y") continue; + throw new Error(`super-faceting cannot use x or y`); + } + } } initialize(facets, facetChannels) { let data = arrayify(this.data); @@ -71,3 +103,9 @@ export class Mark { return values; } } + +/** @jsdoc marks */ +export function marks(...marks) { + marks.plot = Mark.prototype.plot; // Note: depends on side-effect in plot! + return marks; +} diff --git a/src/marks/area.js b/src/marks/area.js index 779137c77a..ae7d9e2da7 100644 --- a/src/marks/area.js +++ b/src/marks/area.js @@ -1,8 +1,8 @@ import {area as shapeArea} from "d3"; import {create} from "../context.js"; import {Curve} from "../curve.js"; -import {first, indexOf, maybeZ, second} from "../options.js"; import {Mark} from "../mark.js"; +import {first, indexOf, maybeZ, second} from "../options.js"; import { applyDirectStyles, applyIndirectStyles, diff --git a/src/marks/arrow.js b/src/marks/arrow.js index 39f0df2a41..087a8a1a12 100644 --- a/src/marks/arrow.js +++ b/src/marks/arrow.js @@ -1,7 +1,7 @@ import {create} from "../context.js"; +import {Mark} from "../mark.js"; import {radians} from "../math.js"; import {constant} from "../options.js"; -import {Mark} from "../mark.js"; import {applyChannelStyles, applyDirectStyles, applyIndirectStyles, applyTransform} from "../style.js"; import {maybeSameValue} from "./link.js"; diff --git a/src/marks/axis.js b/src/marks/axis.js new file mode 100644 index 0000000000..961c82a01b --- /dev/null +++ b/src/marks/axis.js @@ -0,0 +1,674 @@ +import {extent, format, utcFormat} from "d3"; +import {create} from "../context.js"; +import {formatDefault} from "../format.js"; +import {Mark, marks} from "../mark.js"; +import {radians} from "../math.js"; +import {range, valueof, arrayify, constant, keyword, identity, number} from "../options.js"; +import {isNone, isNoneish, isIterable, isTemporal, maybeInterval, orderof} from "../options.js"; +import {isTemporalScale} from "../scales.js"; +import {applyDirectStyles, applyIndirectStyles, applyTransform, offset} from "../style.js"; +import {initializer} from "../transforms/basic.js"; +import {ruleX, ruleY} from "./rule.js"; +import {text, textX, textY} from "./text.js"; +import {vectorX, vectorY} from "./vector.js"; + +function maybeData(data, options) { + if (arguments.length < 2 && !isIterable(data)) (options = data), (data = null); + if (options === undefined) options = {}; + return [data, options]; +} + +function maybeAnchor({anchor} = {}, anchors) { + return anchor === undefined ? anchors[0] : keyword(anchor, "anchor", anchors); +} + +function anchorY(options) { + return maybeAnchor(options, ["left", "right"]); +} + +function anchorFy(options) { + return maybeAnchor(options, ["right", "left"]); +} + +function anchorX(options) { + return maybeAnchor(options, ["bottom", "top"]); +} + +function anchorFx(options) { + return maybeAnchor(options, ["top", "bottom"]); +} + +export function axisY() { + const [data, options] = maybeData(...arguments); + return axisKy("y", anchorY(options), data, options); +} + +export function axisFy() { + const [data, options] = maybeData(...arguments); + return axisKy("fy", anchorFy(options), data, options); +} + +/** @jsdoc axisX */ +export function axisX() { + const [data, options] = maybeData(...arguments); + return axisKx("x", anchorX(options), data, options); +} + +export function axisFx() { + const [data, options] = maybeData(...arguments); + return axisKx("fx", anchorFx(options), data, options); +} + +function axisKy( + k, + anchor, + data, + { + line, + color = "currentColor", + opacity = 1, + stroke = color, + strokeOpacity = opacity, + strokeWidth = 1, + fill = color, + fillOpacity = opacity, + textAnchor, + textStroke, + textStrokeOpacity, + textStrokeWidth, + tickSize = k === "y" ? 6 : 0, + tickPadding, + tickRotate, + x, + marginTop = 20, + marginRight = anchor === "right" ? 40 : 0, + marginBottom = 20, + marginLeft = anchor === "left" ? 40 : 0, + label, + labelOffset, + labelAnchor, + ...options + } +) { + tickSize = number(tickSize); + tickPadding = number(tickPadding); + tickRotate = number(tickRotate); + if (labelAnchor !== undefined) labelAnchor = keyword(labelAnchor, "labelAnchor", ["center", "top", "bottom"]); + return marks( + k === "y" && line && !isNone(line) + ? new AxisLine(k, anchor, { + stroke: line === true ? stroke : line, + strokeOpacity, + strokeWidth, + ...options + }) + : null, + tickSize && !isNoneish(stroke) + ? axisTickKy(k, anchor, data, { + stroke, + strokeOpacity, + strokeWidth, + tickSize, + tickPadding, + tickRotate, + x, + ...options + }) + : null, + !isNoneish(fill) + ? axisTextKy(k, anchor, data, { + fill, + fillOpacity, + stroke: textStroke, + strokeOpacity: textStrokeOpacity, + strokeWidth: textStrokeWidth, + textAnchor, + tickSize, + tickPadding, + tickRotate, + x, + marginTop, + marginRight, + marginBottom, + marginLeft, + ...options + }) + : null, + !isNoneish(fill) && label !== null + ? text([], { + fill, + fillOpacity, + ...options, + facet: "super", + x: null, + y: null, + initializer: function (data, facets, channels, scales, dimensions) { + const scale = scales[k]; + const {marginTop, marginRight, marginBottom, marginLeft} = (k === "y" && dimensions.inset) || dimensions; + const cla = labelAnchor ?? (scale.bandwidth ? "center" : "top"); + const clo = labelOffset ?? (anchor === "right" ? marginRight : marginLeft) - 3; + if (cla === "center") { + this.textAnchor = undefined; // middle + this.lineAnchor = anchor === "right" ? "bottom" : "top"; + this.frameAnchor = anchor; + this.rotate = -90; + } else { + this.textAnchor = anchor === "right" ? "end" : "start"; + this.lineAnchor = cla; + this.frameAnchor = `${cla}-${anchor}`; + this.rotate = 0; + } + this.dy = cla === "top" ? 3 - marginTop : cla === "bottom" ? marginBottom - 3 : 0; + this.dx = anchor === "right" ? clo : -clo; + this.ariaLabel = `${k}-axis label`; + return { + facets: [[0]], + channels: { + text: { + value: [label === undefined ? inferAxisLabel(k, scale, cla) : label] + } + } + }; + } + }) + : null + ); +} + +function axisKx( + k, + anchor, + data, + { + line, + color = "currentColor", + opacity = 1, + stroke = color, + strokeOpacity = opacity, + strokeWidth = 1, + fill = color, + fillOpacity = opacity, + textAnchor, + textStroke, + textStrokeOpacity, + textStrokeWidth, + tickSize = k === "x" ? 6 : 0, + tickPadding, + tickRotate, + y, + marginTop = anchor === "top" ? 30 : 0, + marginRight = 20, + marginBottom = anchor === "bottom" ? 30 : 0, + marginLeft = 20, + label, + labelAnchor, + labelOffset, + ...options + } +) { + tickSize = number(tickSize); + tickPadding = number(tickPadding); + tickRotate = number(tickRotate); + if (labelAnchor !== undefined) labelAnchor = keyword(labelAnchor, "labelAnchor", ["center", "left", "right"]); + return marks( + k === "x" && line && !isNone(line) + ? new AxisLine(k, anchor, { + stroke: line === true ? stroke : line, + strokeOpacity, + strokeWidth, + ...options + }) + : null, + tickSize && !isNoneish(stroke) + ? axisTickKx(k, anchor, data, { + stroke, + strokeOpacity, + strokeWidth, + tickSize, + tickPadding, + tickRotate, + y, + ...options + }) + : null, + !isNoneish(fill) + ? axisTextKx(k, anchor, data, { + fill, + fillOpacity, + stroke: textStroke, + strokeOpacity: textStrokeOpacity, + strokeWidth: textStrokeWidth, + textAnchor, + tickSize, + tickPadding, + tickRotate, + y, + marginTop, + marginRight, + marginBottom, + marginLeft, + ...options + }) + : null, + !isNoneish(fill) && label !== null + ? text([], { + fill, + fillOpacity, + ...options, + facet: "super", + x: null, + y: null, + initializer: function (data, facets, channels, scales, dimensions) { + const scale = scales[k]; + const {marginTop, marginRight, marginBottom, marginLeft} = (k === "x" && dimensions.inset) || dimensions; + const cla = labelAnchor ?? (scale.bandwidth ? "center" : "right"); + const clo = labelOffset ?? (anchor === "top" ? marginTop : marginBottom) - 3; + if (cla === "center") { + this.frameAnchor = anchor; + this.textAnchor = undefined; // middle + } else { + this.frameAnchor = `${anchor}-${cla}`; + this.textAnchor = cla === "right" ? "end" : "start"; + } + this.lineAnchor = anchor; + this.dy = anchor === "top" ? -clo : clo; + this.dx = cla === "right" ? marginRight - 3 : cla === "left" ? 3 - marginLeft : 0; + this.ariaLabel = `${k}-axis label`; + return { + facets: [[0]], + channels: { + text: { + value: [label === undefined ? inferAxisLabel(k, scale, cla) : label] + } + } + }; + } + }) + : null + ); +} + +function axisTickKy( + k, + anchor, + data, + { + strokeWidth = 1, + strokeLinecap = null, + strokeLinejoin = null, + facetAnchor = anchor + (k === "y" ? "-empty" : ""), + frameAnchor = anchor, + tickSize, + inset = 0, + insetLeft = inset, + insetRight = inset, + dx = 0, + y = k === "y" ? undefined : null, + ...options + } +) { + return axisMark(vectorY, k, `${k}-axis tick`, data, { + strokeWidth, + strokeLinecap, + strokeLinejoin, + facetAnchor, + frameAnchor, + y, + ...options, + dx: anchor === "left" ? +dx - offset + +insetLeft : +dx + offset - insetRight, + anchor: "start", + length: tickSize, + shape: anchor === "left" ? shapeTickLeft : shapeTickRight + }); +} + +function axisTickKx( + k, + anchor, + data, + { + strokeWidth = 1, + strokeLinecap = null, + strokeLinejoin = null, + facetAnchor = anchor + (k === "x" ? "-empty" : ""), + frameAnchor = anchor, + tickSize, + inset = 0, + insetTop = inset, + insetBottom = inset, + dy = 0, + x = k === "x" ? undefined : null, + ...options + } +) { + return axisMark(vectorX, k, `${k}-axis tick`, data, { + strokeWidth, + strokeLinejoin, + strokeLinecap, + facetAnchor, + frameAnchor, + x, + ...options, + dy: anchor === "bottom" ? +dy - offset - insetBottom : +dy + offset + +insetTop, + anchor: "start", + length: tickSize, + shape: anchor === "bottom" ? shapeTickBottom : shapeTickTop + }); +} + +function axisTextKy( + k, + anchor, + data, + { + facetAnchor = anchor + (k === "y" ? "-empty" : ""), + frameAnchor = anchor, + tickSize, + tickRotate = 0, + tickPadding = Math.max(3, 9 - tickSize) + (Math.abs(tickRotate) > 60 ? 4 * Math.cos(tickRotate * radians) : 0), + tickFormat, + text = typeof tickFormat === "function" ? tickFormat : undefined, + textAnchor = Math.abs(tickRotate) > 60 ? "middle" : anchor === "left" ? "end" : "start", + lineAnchor = tickRotate > 60 ? "top" : tickRotate < -60 ? "bottom" : "middle", + fontVariant, + inset = 0, + insetLeft = inset, + insetRight = inset, + dx = 0, + y = k === "y" ? undefined : null, + ...options + } +) { + return axisMark( + textY, + k, + `${k}-axis tick label`, + data, + { + facetAnchor, + frameAnchor, + text: text === undefined ? null : text, + textAnchor, + lineAnchor, + fontVariant, + rotate: tickRotate, + y, + ...options, + dx: anchor === "left" ? +dx - tickSize - tickPadding + +insetLeft : +dx + +tickSize + +tickPadding - insetRight + }, + function (scale, ticks, channels) { + if (fontVariant === undefined) this.fontVariant = inferFontVariant(scale); + if (text === undefined) channels.text = inferTextChannel(scale, ticks, tickFormat); + } + ); +} + +function axisTextKx( + k, + anchor, + data, + { + facetAnchor = anchor + (k === "x" ? "-empty" : ""), + frameAnchor = anchor, + tickSize, + tickRotate = 0, + tickPadding = Math.max(3, 9 - tickSize) + (Math.abs(tickRotate) >= 10 ? 4 * Math.cos(tickRotate * radians) : 0), + tickFormat, + text = typeof tickFormat === "function" ? tickFormat : undefined, + textAnchor = Math.abs(tickRotate) >= 10 ? ((tickRotate < 0) ^ (anchor === "bottom") ? "start" : "end") : "middle", + lineAnchor = Math.abs(tickRotate) >= 10 ? "middle" : anchor === "bottom" ? "top" : "bottom", + fontVariant, + inset = 0, + insetTop = inset, + insetBottom = inset, + dy = 0, + x = k === "x" ? undefined : null, + ...options + } +) { + return axisMark( + textX, + k, + `${k}-axis tick label`, + data, + { + facetAnchor, + frameAnchor, + text: text === undefined ? null : text, + textAnchor, + lineAnchor, + fontVariant, + rotate: tickRotate, + x, + ...options, + dy: anchor === "bottom" ? +dy + +tickSize + +tickPadding - insetBottom : +dy - tickSize - tickPadding + +insetTop + }, + function (scale, ticks, channels) { + if (fontVariant === undefined) this.fontVariant = inferFontVariant(scale); + if (text === undefined) channels.text = inferTextChannel(scale, ticks, tickFormat); + } + ); +} + +export function gridY() { + const [data, options] = maybeData(...arguments); + return gridKy("y", anchorY(options), data, options); +} + +export function gridFy() { + const [data, options] = maybeData(...arguments); + return gridKy("fy", anchorFy(options), data, options); +} + +/** @jsdoc gridX */ +export function gridX() { + const [data, options] = maybeData(...arguments); + return gridKx("x", anchorX(options), data, options); +} + +export function gridFx() { + const [data, options] = maybeData(...arguments); + return gridKx("fx", anchorFx(options), data, options); +} + +function gridKy( + k, + anchor, + data, + { + y = k === "y" ? undefined : null, + x = null, + x1 = anchor === "left" ? x : null, + x2 = anchor === "right" ? x : null, + ...options + } +) { + return axisMark(ruleY, k, `${k}-grid`, data, {y, x1, x2, ...gridDefaults(options)}); +} + +function gridKx( + k, + anchor, + data, + { + x = k === "x" ? undefined : null, + y = null, + y1 = anchor === "top" ? y : null, + y2 = anchor === "bottom" ? y : null, + ...options + } +) { + return axisMark(ruleX, k, `${k}-grid`, data, {x, y1, y2, ...gridDefaults(options)}); +} + +function gridDefaults({ + color = "currentColor", + opacity = 0.1, + stroke = color, + strokeOpacity = opacity, + strokeWidth = 1, + ...options +}) { + return {stroke, strokeOpacity, strokeWidth, ...options}; +} + +function axisMark(mark, k, ariaLabel, data, options, initialize) { + let channels; + const m = mark( + data, + initializer(options, function (data, facets, _channels, scales) { + const {[k]: scale} = scales; + if (!scale) throw new Error(`missing scale: ${k}`); + let {ticks, tickSpacing, interval} = options; + if (isTemporalScale(scale) && typeof ticks === "string") (interval = ticks), (ticks = undefined); + if (data == null) { + if (isIterable(ticks)) { + data = arrayify(ticks); + } else if (scale.ticks) { + if (ticks !== undefined) { + data = scale.ticks(ticks); + } else { + interval = maybeInterval(interval === undefined ? scale.interval : interval, scale.type); + if (interval !== undefined) { + // For time scales, we could pass the interval directly to + // scale.ticks because it’s supported by d3.utcTicks; but + // quantitative scales and d3.ticks do not support numeric + // intervals for scale.ticks, so we compute them here. + const [min, max] = extent(scale.domain()); + data = interval.range(min, interval.offset(interval.floor(max))); // inclusive max + } else { + const [min, max] = extent(scale.range()); + ticks = (max - min) / (tickSpacing === undefined ? (k === "x" ? 80 : 35) : tickSpacing); + data = scale.ticks(ticks); + } + } + } else { + data = scale.domain(); + } + if (k === "y" || k === "x") { + facets = [range(data)]; + } else { + channels[k] = {scale: k, value: identity}; + facets = undefined; // computed automatically by plot + } + } + initialize?.call(this, scale, ticks, channels); + return { + data, + facets, + channels: Object.fromEntries( + Object.entries(channels).map(([name, channel]) => [name, {...channel, value: valueof(data, channel.value)}]) + ) + }; + }) + ); + if (data == null) { + channels = m.channels; + m.channels = {}; + } else { + channels = {}; + } + m.ariaLabel = ariaLabel; + return m; +} + +const axisLineDefaults = { + fill: null, + stroke: "currentColor" +}; + +class AxisLine extends Mark { + constructor(k, anchor, {facetAnchor = anchor + "-empty", ...options} = {}) { + super(undefined, undefined, {facetAnchor, ...options}, axisLineDefaults); + this.anchor = anchor; + this.ariaLabel = `${k}-axis line`; + } + render(index, scales, channels, dimensions, context) { + const {marginTop, marginRight, marginBottom, marginLeft, width, height} = dimensions; + const {anchor} = this; + const tx = anchor === "left" ? -0.5 : anchor === "right" ? 0.5 : undefined; + const ty = anchor === "top" ? -0.5 : anchor === "bottom" ? 0.5 : undefined; + return create("svg:line", context) + .call(applyIndirectStyles, this, dimensions, context) + .call(applyDirectStyles, this) + .call(applyTransform, this, {}, tx, ty) + .attr("x1", anchor === "right" ? width - marginRight : marginLeft) + .attr("y1", anchor === "bottom" ? height - marginBottom : marginTop) + .attr("x2", anchor === "left" ? marginLeft : width - marginRight) + .attr("y2", anchor === "top" ? marginTop : height - marginBottom) + .node(); + } +} + +function inferTextChannel(scale, ticks, tickFormat) { + return {value: inferTickFormat(scale, ticks, tickFormat)}; +} + +// D3’s ordinal scales simply use toString by default, but if the ordinal scale +// domain (or ticks) are numbers or dates (say because we’re applying a time +// interval to the ordinal scale), we want Plot’s default formatter. +function inferTickFormat(scale, ticks, tickFormat) { + return scale.tickFormat + ? scale.tickFormat(isIterable(ticks) ? null : ticks, tickFormat) + : tickFormat === undefined + ? formatDefault + : typeof tickFormat === "string" + ? (isTemporal(scale.domain()) ? utcFormat : format)(tickFormat) + : constant(tickFormat); +} + +const shapeTickBottom = { + draw(context, l) { + context.moveTo(0, 0); + context.lineTo(0, l); + } +}; + +const shapeTickTop = { + draw(context, l) { + context.moveTo(0, 0); + context.lineTo(0, -l); + } +}; + +const shapeTickLeft = { + draw(context, l) { + context.moveTo(0, 0); + context.lineTo(-l, 0); + } +}; + +const shapeTickRight = { + draw(context, l) { + context.moveTo(0, 0); + context.lineTo(l, 0); + } +}; + +// TODO Unify this with the other inferFontVariant; here we only have a scale +// function rather than a scale descriptor. +function inferFontVariant(scale) { + return scale.bandwidth && scale.interval === undefined ? undefined : "tabular-nums"; +} + +// Determines whether the scale points in the “positive” (right or down) or +// “negative” (left or up) direction; if the scale order cannot be determined, +// returns NaN; used to assign an appropriate label arrow. +function inferScaleOrder(scale) { + return Math.sign(orderof(scale.domain())) * Math.sign(orderof(scale.range())); +} + +// Takes the scale label, and if this is not an ordinal scale and the label was +// inferred from an associated channel, adds an orientation-appropriate arrow. +function inferAxisLabel(key, scale, labelAnchor) { + const label = scale.label; + if (scale.bandwidth || !label?.inferred) return label; + const order = inferScaleOrder(scale); + return order + ? key === "x" || labelAnchor === "center" + ? (key === "x") === order < 0 + ? `← ${label}` + : `${label} →` + : `${order < 0 ? "↑ " : "↓ "}${label}` + : label; +} diff --git a/src/marks/bar.js b/src/marks/bar.js index c659fcb3ab..e365695d99 100644 --- a/src/marks/bar.js +++ b/src/marks/bar.js @@ -1,6 +1,6 @@ import {create} from "../context.js"; -import {identity, indexOf, number} from "../options.js"; import {Mark} from "../mark.js"; +import {identity, indexOf, number} from "../options.js"; import {isCollapsed} from "../scales.js"; import { applyDirectStyles, diff --git a/src/marks/box.js b/src/marks/box.js index dcf15af8fd..73b6097c78 100644 --- a/src/marks/box.js +++ b/src/marks/box.js @@ -1,5 +1,5 @@ import {min, max, quantile} from "d3"; -import {marks} from "../plot.js"; +import {marks} from "../mark.js"; import {groupX, groupY, groupZ} from "../transforms/group.js"; import {map} from "../transforms/map.js"; import {barX, barY} from "./bar.js"; diff --git a/src/marks/delaunay.js b/src/marks/delaunay.js index a9566c4a69..af069e8ba5 100644 --- a/src/marks/delaunay.js +++ b/src/marks/delaunay.js @@ -1,8 +1,8 @@ import {group, pathRound as path, select, Delaunay} from "d3"; import {create} from "../context.js"; import {Curve} from "../curve.js"; -import {constant, maybeTuple, maybeZ} from "../options.js"; import {Mark} from "../mark.js"; +import {constant, maybeTuple, maybeZ} from "../options.js"; import { applyChannelStyles, applyDirectStyles, diff --git a/src/marks/density.js b/src/marks/density.js index 090f2f619b..afd18e3338 100644 --- a/src/marks/density.js +++ b/src/marks/density.js @@ -1,6 +1,6 @@ import {contourDensity, create, geoPath} from "d3"; -import {isTypedArray, maybeTuple, maybeZ} from "../options.js"; import {Mark} from "../mark.js"; +import {isTypedArray, maybeTuple, maybeZ} from "../options.js"; import {Position} from "../projection.js"; import {coerceNumbers} from "../scales.js"; import { diff --git a/src/marks/dot.js b/src/marks/dot.js index bc9edbf111..93f176b94b 100644 --- a/src/marks/dot.js +++ b/src/marks/dot.js @@ -1,8 +1,8 @@ import {pathRound as path, symbolCircle} from "d3"; import {create} from "../context.js"; import {negative, positive} from "../defined.js"; -import {identity, maybeFrameAnchor, maybeNumberChannel, maybeTuple} from "../options.js"; import {Mark} from "../mark.js"; +import {identity, maybeFrameAnchor, maybeNumberChannel, maybeTuple} from "../options.js"; import { applyChannelStyles, applyDirectStyles, diff --git a/src/marks/frame.js b/src/marks/frame.js index 9181e81ab8..9ae2ca545a 100644 --- a/src/marks/frame.js +++ b/src/marks/frame.js @@ -1,6 +1,6 @@ import {create} from "../context.js"; -import {number} from "../options.js"; import {Mark} from "../mark.js"; +import {number} from "../options.js"; import {applyDirectStyles, applyIndirectStyles, applyTransform} from "../style.js"; const defaults = { diff --git a/src/marks/geo.js b/src/marks/geo.js index 1e901e2384..7797189fee 100644 --- a/src/marks/geo.js +++ b/src/marks/geo.js @@ -1,8 +1,8 @@ import {geoGraticule10, geoPath, geoTransform} from "d3"; import {create} from "../context.js"; import {negative, positive} from "../defined.js"; -import {identity, maybeNumberChannel} from "../options.js"; import {Mark} from "../mark.js"; +import {identity, maybeNumberChannel} from "../options.js"; import {applyChannelStyles, applyDirectStyles, applyIndirectStyles, applyTransform} from "../style.js"; import {withDefaultSort} from "./dot.js"; diff --git a/src/marks/hexgrid.js b/src/marks/hexgrid.js index ac920550b9..2ec7d0a5b0 100644 --- a/src/marks/hexgrid.js +++ b/src/marks/hexgrid.js @@ -1,6 +1,6 @@ import {create} from "../context.js"; -import {number} from "../options.js"; import {Mark} from "../mark.js"; +import {number} from "../options.js"; import {applyDirectStyles, applyIndirectStyles, applyTransform, offset} from "../style.js"; import {sqrt4_3} from "../symbols.js"; import {ox, oy} from "../transforms/hexbin.js"; diff --git a/src/marks/image.js b/src/marks/image.js index 0d8b003b9c..381aecaca6 100644 --- a/src/marks/image.js +++ b/src/marks/image.js @@ -1,7 +1,7 @@ import {create} from "../context.js"; import {positive} from "../defined.js"; -import {maybeFrameAnchor, maybeNumberChannel, maybeTuple, string} from "../options.js"; import {Mark} from "../mark.js"; +import {maybeFrameAnchor, maybeNumberChannel, maybeTuple, string} from "../options.js"; import { applyChannelStyles, applyDirectStyles, diff --git a/src/marks/line.js b/src/marks/line.js index b195c3c9db..77a7d080ad 100644 --- a/src/marks/line.js +++ b/src/marks/line.js @@ -1,8 +1,8 @@ import {curveLinear, geoPath, line as shapeLine} from "d3"; import {create} from "../context.js"; import {Curve} from "../curve.js"; -import {indexOf, identity, maybeTuple, maybeZ} from "../options.js"; import {Mark} from "../mark.js"; +import {indexOf, identity, maybeTuple, maybeZ} from "../options.js"; import {coerceNumbers} from "../scales.js"; import { applyDirectStyles, diff --git a/src/marks/linearRegression.js b/src/marks/linearRegression.js index 9528de4dba..39cd8182e3 100644 --- a/src/marks/linearRegression.js +++ b/src/marks/linearRegression.js @@ -1,7 +1,7 @@ import {extent, range, sum, area as shapeArea, namespaces} from "d3"; import {create} from "../context.js"; -import {identity, indexOf, isNone, isNoneish, maybeZ} from "../options.js"; import {Mark} from "../mark.js"; +import {identity, indexOf, isNone, isNoneish, maybeZ} from "../options.js"; import {qt} from "../stats.js"; import {applyDirectStyles, applyGroupedChannelStyles, applyIndirectStyles, applyTransform, groupZ} from "../style.js"; import {maybeDenseIntervalX, maybeDenseIntervalY} from "../transforms/bin.js"; diff --git a/src/marks/rect.js b/src/marks/rect.js index 4713ba7ef5..5230122cad 100644 --- a/src/marks/rect.js +++ b/src/marks/rect.js @@ -1,6 +1,6 @@ import {create} from "../context.js"; -import {identity, indexOf, number} from "../options.js"; import {Mark} from "../mark.js"; +import {identity, indexOf, number} from "../options.js"; import {isCollapsed} from "../scales.js"; import { applyDirectStyles, diff --git a/src/marks/rule.js b/src/marks/rule.js index 6ee8867a1d..8de70a1e0d 100644 --- a/src/marks/rule.js +++ b/src/marks/rule.js @@ -1,6 +1,6 @@ import {create} from "../context.js"; -import {identity, number} from "../options.js"; import {Mark} from "../mark.js"; +import {identity, number} from "../options.js"; import {isCollapsed} from "../scales.js"; import {applyDirectStyles, applyIndirectStyles, applyTransform, applyChannelStyles, offset} from "../style.js"; import {maybeIntervalX, maybeIntervalY} from "../transforms/interval.js"; diff --git a/src/marks/text.js b/src/marks/text.js index a76199b989..dc5a76f0de 100644 --- a/src/marks/text.js +++ b/src/marks/text.js @@ -2,6 +2,7 @@ import {namespaces} from "d3"; import {create} from "../context.js"; import {nonempty} from "../defined.js"; import {formatDefault} from "../format.js"; +import {Mark} from "../mark.js"; import { indexOf, identity, @@ -16,7 +17,6 @@ import { isTextual, isIterable } from "../options.js"; -import {Mark} from "../mark.js"; import { applyChannelStyles, applyDirectStyles, @@ -36,6 +36,8 @@ const defaults = { paintOrder: "stroke" }; +const softHyphen = "\u00ad"; + export class Text extends Mark { constructor(data, options = {}) { const { @@ -64,7 +66,7 @@ export class Text extends Mark { y: {value: y, scale: "y", optional: true}, fontSize: {value: vfontSize, optional: true}, rotate: {value: numberChannel(vrotate), optional: true}, - text: {value: text, filter: nonempty} + text: {value: text, filter: nonempty, optional: true} }, options, defaults @@ -223,7 +225,7 @@ function lineWrap(input, maxWidth, widthof = (_, i, j) => j - i) { // make the line longer than the allowed width, then break the line at the // previous word end. if (lineEnd > lineStart && widthof(input, lineStart, wordEnd) > maxWidth) { - lines.push(input.slice(lineStart, lineEnd)); + lines.push(input.slice(lineStart, lineEnd) + (input[lineEnd - 1] === softHyphen ? "-" : "")); lineStart = wordStart; } @@ -251,6 +253,7 @@ function* lineBreaks(input) { while (j < n) { let k = 1; switch (input[j]) { + case softHyphen: case "-": // hyphen ++j; yield [i, j, false]; diff --git a/src/marks/tree.js b/src/marks/tree.js index 326f47f586..d24c219bb9 100644 --- a/src/marks/tree.js +++ b/src/marks/tree.js @@ -1,6 +1,6 @@ import {cluster as Cluster} from "d3"; import {isNoneish} from "../options.js"; -import {marks} from "../plot.js"; +import {marks} from "../mark.js"; import {maybeTreeAnchor, treeLink, treeNode} from "../transforms/tree.js"; import {dot} from "./dot.js"; import {link} from "./link.js"; diff --git a/src/marks/vector.js b/src/marks/vector.js index c5f85ad858..cae03e0b63 100644 --- a/src/marks/vector.js +++ b/src/marks/vector.js @@ -1,7 +1,7 @@ import {pathRound as path} from "d3"; import {create} from "../context.js"; -import {maybeFrameAnchor, maybeNumberChannel, maybeTuple, keyword, identity} from "../options.js"; import {Mark} from "../mark.js"; +import {maybeFrameAnchor, maybeNumberChannel, maybeTuple, keyword, identity} from "../options.js"; import { applyChannelStyles, applyDirectStyles, diff --git a/src/options.js b/src/options.js index dad2df2f62..0ddae11e30 100644 --- a/src/options.js +++ b/src/options.js @@ -1,6 +1,6 @@ import {parse as isoParse} from "isoformat"; import {color, descending, range as rangei, quantile} from "d3"; -import {maybeUtcInterval} from "./time.js"; +import {maybeTimeInterval, maybeUtcInterval} from "./time.js"; // https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Global_Objects/TypedArray const TypedArray = Object.getPrototypeOf(Uint8Array); @@ -236,10 +236,10 @@ export function mid(x1, x2) { }; } -// TODO Allow the interval to be specified as a string, e.g. “day” or “hour”? -// This will require the interval knowing the type of the associated scale to -// chose between UTC and local time (or better, an explicit timeZone option). -export function maybeInterval(interval) { +// If interval is not nullish, converts interval shorthand such as a number (for +// multiples) or a time interval name (such as “day”) to a {floor, offset, +// range} object similar to a D3 time interval. +export function maybeInterval(interval, type) { if (interval == null) return; if (typeof interval === "number") { const n = interval; @@ -249,7 +249,7 @@ export function maybeInterval(interval) { range: (lo, hi) => rangei(Math.ceil(lo / n), hi / n).map((x) => n * x) }; } - if (typeof interval === "string") return maybeUtcInterval(interval); // TODO local time, or timeZone option + if (typeof interval === "string") return (type === "time" ? maybeTimeInterval : maybeUtcInterval)(interval); if (typeof interval.floor !== "function") throw new Error("invalid interval; missing floor method"); if (typeof interval.offset !== "function") throw new Error("invalid interval; missing offset method"); return interval; @@ -400,7 +400,7 @@ export function maybeFrameAnchor(value = "middle") { // Like a sort comparator, returns a positive value if the given array of values // is in ascending order, a negative value if the values are in descending // order. Assumes monotonicity; only tests the first and last values. -export function order(values) { +export function orderof(values) { if (values == null) return; const first = values[0]; const last = values[values.length - 1]; diff --git a/src/plot.js b/src/plot.js index b59f183f7e..1bbb1e84b5 100644 --- a/src/plot.js +++ b/src/plot.js @@ -1,12 +1,13 @@ -import {cross, group, sum, select, sort, InternMap, rollup} from "d3"; -import {Axes, autoAxisTicks, autoScaleLabels} from "./axes.js"; +import {select} from "d3"; import {Channel} from "./channel.js"; import {Context, create} from "./context.js"; import {Dimensions} from "./dimensions.js"; +import {Facets, facetExclude, facetGroups, facetOrder, facetTranslate, facetFilter} from "./facet.js"; import {Legends, exposeLegends} from "./legends.js"; import {Mark} from "./mark.js"; -import {arrayify, isScaleOptions, map, range, where, yes, maybeInterval} from "./options.js"; -import {Scales, ScaleFunctions, autoScaleRange, exposeScales} from "./scales.js"; +import {axisFx, axisFy, axisX, axisY, gridFx, gridFy, gridX, gridY} from "./marks/axis.js"; +import {arrayify, isColor, isIterable, isNone, isScaleOptions, map, yes, maybeInterval} from "./options.js"; +import {Scales, ScaleFunctions, autoScaleRange, exposeScales, innerDimensions, outerDimensions} from "./scales.js"; import {position, registry as scaleRegistry} from "./scales/index.js"; import {applyInlineStyles, maybeClassName} from "./style.js"; import {consumeWarnings, warn} from "./warnings.js"; @@ -42,22 +43,32 @@ export function plot(options = {}) { if (topFacetState) addScaleChannels(channelsByScale, [topFacetState]); addScaleChannels(channelsByScale, facetStateByMark); + // Add implicit axis marks. Because this happens after faceting (because it + // depends on whether faceting is present), we must initialize the facet state + // of any implicit axes, too. + const axes = flatMarks(inferAxes(marks, channelsByScale, options)); + for (const mark of axes) { + const facetState = maybeMarkFacet(mark, topFacetState, options); + if (facetState) facetStateByMark.set(mark, facetState); + } + marks.unshift(...axes); + // All the possible facets are given by the domains of the fx or fy scales, or // the cross-product of these domains if we facet by both x and y. We sort // them in order to apply the facet filters afterwards. - let facets = Facets(channelsByScale, options); + const facets = Facets(channelsByScale, options); if (facets !== undefined) { - const topFacetsIndex = topFacetState ? filterFacets(facets, topFacetState) : undefined; + const topFacetsIndex = topFacetState ? facetFilter(facets, topFacetState) : undefined; // Compute a facet index for each mark, parallel to the facets array. For // mark-level facets, compute an index for that mark’s data and options. // Otherwise, use the top-level facet index. for (const mark of marks) { - if (mark.facet === null) continue; + if (mark.facet === null || mark.facet === "super") continue; const facetState = facetStateByMark.get(mark); if (facetState === undefined) continue; - facetState.facetsIndex = mark.fx != null || mark.fy != null ? filterFacets(facets, facetState) : topFacetsIndex; + facetState.facetsIndex = mark.fx != null || mark.fy != null ? facetFilter(facets, facetState) : topFacetsIndex; } // The cross product of the domains of fx and fy can include fx-fy @@ -75,20 +86,20 @@ export function plot(options = {}) { } }); } - if (0 < nonEmpty.size && nonEmpty.size < facets.length) { - facets = facets.filter((_, i) => nonEmpty.has(i)); - for (const state of facetStateByMark.values()) { - const {facetsIndex} = state; - if (!facetsIndex) continue; - state.facetsIndex = facetsIndex.filter((_, i) => nonEmpty.has(i)); - } - } + + // If all the facets are empty (as when none of the marks are actually + // faceted), none of them are empty. + facets.forEach( + 0 < nonEmpty.size && nonEmpty.size < facets.length + ? (f, i) => (f.empty = !nonEmpty.has(i)) + : (f) => (f.empty = false) + ); // For any mark using the “exclude” facet mode, invert the index. for (const mark of marks) { if (mark.facet === "exclude") { const facetState = facetStateByMark.get(mark); - facetState.facetsIndex = excludeIndex(facetState.facetsIndex); + facetState.facetsIndex = facetExclude(facetState.facetsIndex); } } } @@ -113,72 +124,78 @@ export function plot(options = {}) { // Initialize the marks’ state. for (const mark of marks) { if (stateByMark.has(mark)) throw new Error("duplicate mark; each mark must be unique"); - const {facetsIndex, channels: facetChannels} = facetStateByMark.get(mark) || {}; + const {facetsIndex, channels: facetChannels} = facetStateByMark.get(mark) ?? {}; const {data, facets, channels} = mark.initialize(facetsIndex, facetChannels); applyScaleTransforms(channels, options); stateByMark.set(mark, {data, facets, channels}); } - // Initalize the scales and axes. + // Initalize the scales and dimensions. const scaleDescriptors = Scales(addScaleChannels(channelsByScale, stateByMark), options); const scales = ScaleFunctions(scaleDescriptors); - const axes = Axes(scaleDescriptors, options); - const dimensions = Dimensions(scaleDescriptors, hasGeometry(stateByMark), axes, options); + const dimensions = Dimensions(scaleDescriptors, marks, options); autoScaleRange(scaleDescriptors, dimensions); - autoAxisTicks(scaleDescriptors, axes); const {fx, fy} = scales; - const fyMargins = fy && {marginTop: 0, marginBottom: 0, height: fy.bandwidth()}; - const fxMargins = fx && {marginRight: 0, marginLeft: 0, width: fx.bandwidth()}; - const subdimensions = {...dimensions, ...fxMargins, ...fyMargins}; - const context = Context(options, subdimensions); + const subdimensions = fx || fy ? innerDimensions(scaleDescriptors, dimensions) : dimensions; + const superdimensions = fx || fy ? actualDimensions(scales, dimensions) : dimensions; + const context = Context(options, subdimensions, scaleDescriptors); // Reinitialize; for deriving channels dependent on other channels. const newByScale = new Set(); for (const [mark, state] of stateByMark) { if (mark.initializer != null) { - const {facets, channels} = mark.initializer( - state.data, - state.facets, - state.channels, - scales, - subdimensions, - context - ); - if (facets !== undefined) { - state.facets = facets; + const dimensions = mark.facet === "super" ? superdimensions : subdimensions; + const update = mark.initializer(state.data, state.facets, state.channels, scales, dimensions, context); + if (update.data !== undefined) { + state.data = update.data; } - if (channels !== undefined) { - inferChannelScale(channels, mark); - applyScaleTransforms(channels, options); - Object.assign(state.channels, channels); - for (const {scale} of Object.values(channels)) if (scale != null) newByScale.add(scale); + if (update.facets !== undefined) { + state.facets = update.facets; + } + if (update.channels !== undefined) { + inferChannelScale(update.channels, mark); + Object.assign(state.channels, update.channels); + for (const channel of Object.values(update.channels)) { + const {scale} = channel; + // Initializers aren’t allowed to redefine position scales as this + // would introduce a circular dependency; so simply scale these + // channels as-is rather than creating new scales, and assume that + // they already have the scale’s transform applied, if any (e.g., when + // generating ticks for the axis mark). + if (scale != null && scaleRegistry.get(scale) !== position) { + applyScaleTransform(channel, options); + newByScale.add(scale); + } + } + // If the initializer returns new mark-level facet channels, we must + // also recompute the facet state. + const {fx, fy} = update.channels; + if (fx != null || fy != null) { + const facetState = facetStateByMark.get(mark) ?? {channels: {}}; + if (fx != null) facetState.channels.fx = fx; + if (fy != null) facetState.channels.fy = fy; + facetState.groups = facetGroups(state.data, facetState.channels); + facetState.facetsIndex = state.facets = facetFilter(facets, facetState); + facetStateByMark.set(mark, facetState); + } } } } - // Reconstruct scales if new scaled channels were created during reinitialization. + // Reconstruct scales if new scaled channels were created during + // reinitialization. Preserve existing scale labels, if any. if (newByScale.size) { - for (const key of newByScale) { - if (scaleRegistry.get(key) === position) { - throw new Error(`initializers cannot declare position scales: ${key}`); - } - } const newChannelsByScale = new Map(); addScaleChannels(newChannelsByScale, stateByMark, (key) => newByScale.has(key)); addScaleChannels(channelsByScale, stateByMark, (key) => newByScale.has(key)); - const newScaleDescriptors = Scales(newChannelsByScale, options); + const newScaleDescriptors = inheritScaleLabels(Scales(newChannelsByScale, options), scaleDescriptors); const newScales = ScaleFunctions(newScaleDescriptors); Object.assign(scaleDescriptors, newScaleDescriptors); Object.assign(scales, newScales); } - // Compute the scale labels. Note that with initializers, this may include - // both old channels (no longer used) and new channels for redefined scales; - // we include both because initializers don’t always propagate labels. - autoScaleLabels(channelsByScale, scaleDescriptors, axes, dimensions, options); - // Compute value objects, applying scales and projection as needed. for (const [mark, state] of stateByMark) { state.values = mark.scale(state.channels, scales, context); @@ -215,110 +232,56 @@ export function plot(options = {}) { .call(applyInlineStyles, style) .node(); - // When faceting, render axes for fx and fy instead of x and y. - const axisY = axes[facets !== undefined && fy ? "fy" : "y"]; - const axisX = axes[facets !== undefined && fx ? "fx" : "x"]; - if (axisY) svg.appendChild(axisY.render(null, scales, dimensions, context)); - if (axisX) svg.appendChild(axisX.render(null, scales, dimensions, context)); - - // Render (possibly faceted) marks. + // Render facets. if (facets !== undefined) { - const fxDomain = fx?.domain(); - const fyDomain = fy?.domain(); - const selection = select(svg); - // When faceting by both fx and fy, this nested Map allows to look up the - // non-empty facets and draw the grid lines properly. - const fxy = - fx && fy && (axes.x || axes.y) - ? group( - facets, - ({x}) => x, - ({y}) => y - ) - : undefined; - if (fy && axes.y) { - const axis1 = axes.y, - axis2 = nolabel(axis1); - const j = - axis1.labelAnchor === "bottom" - ? fyDomain.length - 1 - : axis1.labelAnchor === "center" - ? fyDomain.length >> 1 - : 0; - selection - .selectAll() - .data(fyDomain) - .enter() - .append((ky, i) => - (i === j ? axis1 : axis2).render( - fx && where(fxDomain, (kx) => fxy.get(kx).has(ky)), - scales, - {...dimensions, ...fyMargins, offsetTop: fy(ky)}, - context - ) - ); - } - if (fx && axes.x) { - const axis1 = axes.x, - axis2 = nolabel(axis1); - const j = - axis1.labelAnchor === "right" ? fxDomain.length - 1 : axis1.labelAnchor === "center" ? fxDomain.length >> 1 : 0; - const {marginLeft, marginRight} = dimensions; - selection - .selectAll() - .data(fxDomain) - .enter() - .append((kx, i) => - (i === j ? axis1 : axis2).render( - fy && where(fyDomain, (ky) => fxy.get(kx).has(ky)), - scales, - { - ...dimensions, - ...fxMargins, - labelMarginLeft: marginLeft, - labelMarginRight: marginRight, - offsetLeft: fx(kx) - }, - context - ) - ); - } + const facetDomains = {x: fx?.domain(), y: fy?.domain()}; + + // Sort the facets to match the fx and fy domains; this is needed because + // the facets were constructed prior to the fx and fy scales. + facets.sort(facetOrder(facetDomains)); - // Render facets in the order of the fx-fy domain, which might not be the - // ordering used to build the nested index initially; see domainChannel. - const facetPosition = new Map(facets.map((f, j) => [f, j])); - selection + // Render the facets. + select(svg) .selectAll() - .data(facetKeys(facets, fx, fy)) + .data(facets) .enter() .append("g") .attr("aria-label", "facet") - .attr("transform", facetTranslate(fx, fy)) - .each(function (key) { - for (const [mark, {channels, values, facets}] of stateByMark) { - let facet = null; - if (facets) { - const fi = facetPosition.get(key); - facet = facets[fi] ?? facets[0]; - facet = mark.filter(facet, channels, values); - if (!facet.length) continue; - facet.fi = fi; + .attr("transform", facetTranslate(fx, fy, dimensions)) + .each(function (f) { + let empty = true; + for (const mark of marks) { + if (mark.facet === "super") continue; // rendered below + const {channels, values, facets: indexes} = stateByMark.get(mark); + if (!(mark.facetAnchor?.(facets, facetDomains, f) ?? !f.empty)) continue; + let index = null; + if (indexes) { + index = indexes[facetStateByMark.has(mark) ? f.i : 0]; + index = mark.filter(index, channels, values); + if (index.length === 0) continue; + index.fi = f.i; // TODO cleaner way of exposing the current facet index? } - const node = mark.render(facet, scales, values, subdimensions, context); - if (node != null) this.appendChild(node); + const node = mark.render(index, scales, values, subdimensions, context); + if (node == null) continue; + empty = false; + this.appendChild(node); } + if (empty) this.remove(); }); - } else { - for (const [mark, {channels, values, facets}] of stateByMark) { - let facet = null; - if (facets) { - facet = facets[0]; - facet = mark.filter(facet, channels, values); - if (!facet.length) continue; - } - const node = mark.render(facet, scales, values, dimensions, context); - if (node != null) svg.appendChild(node); + } + + // Render non-faceted marks. + for (const mark of marks) { + if (facets !== undefined && mark.facet !== "super") continue; + const {channels, values, facets: indexes} = stateByMark.get(mark); + let index = null; + if (indexes) { + index = indexes[0]; + index = mark.filter(index, channels, values); + if (index.length === 0) continue; } + const node = mark.render(index, scales, values, superdimensions, context); + if (node != null) svg.appendChild(node); } // Wrap the plot in a figure with a caption, if desired. @@ -364,12 +327,6 @@ function plotThis({marks = [], ...options} = {}) { // Note: This side-effect avoids a circular dependency. Mark.prototype.plot = plotThis; -/** @jsdoc marks */ -export function marks(...marks) { - marks.plot = plotThis; - return marks; -} - function flatMarks(marks) { return marks .flat(Infinity) @@ -392,21 +349,23 @@ class Render extends Mark { // Note: mutates channel.value to apply the scale transform, if any. function applyScaleTransforms(channels, options) { - for (const name in channels) { - const channel = channels[name]; - const {scale} = channel; - if (scale != null) { - const { - percent, - interval, - transform = percent ? (x) => x * 100 : maybeInterval(interval)?.floor - } = options[scale] || {}; - if (transform != null) channel.value = map(channel.value, transform); - } - } + for (const name in channels) applyScaleTransform(channels[name], options); return channels; } +// Note: mutates channel.value to apply the scale transform, if any. +function applyScaleTransform(channel, options) { + const {scale} = channel; + if (scale == null) return; + const { + type, + percent, + interval, + transform = percent ? (x) => x * 100 : maybeInterval(interval, type)?.floor + } = options[scale] ?? {}; + if (transform != null) channel.value = map(channel.value, transform); +} + // An initializer may generate channels without knowing how the downstream mark // will use them. Marks are typically responsible associated scales with // channels, but here we assume common behavior across marks. @@ -449,94 +408,6 @@ function addScaleChannels(channelsByScale, stateByMark, filter = yes) { return channelsByScale; } -function hasGeometry(stateByMark) { - for (const {channels} of stateByMark.values()) { - if (channels.geometry) return true; - } - return false; -} - -// Derives a copy of the specified axis with the label disabled. -function nolabel(axis) { - return axis === undefined || axis.label === undefined - ? axis // use the existing axis if unlabeled - : Object.assign(Object.create(axis), {label: undefined}); -} - -// Returns an array of {x?, y?} objects representing the facet domain. -function Facets(channelsByScale, options) { - const {fx, fy} = Scales(channelsByScale, options); - const fxDomain = fx?.scale.domain(); - const fyDomain = fy?.scale.domain(); - return fxDomain && fyDomain - ? cross(fxDomain, fyDomain).map(([x, y]) => ({x, y})) - : fxDomain - ? fxDomain.map((x) => ({x})) - : fyDomain - ? fyDomain.map((y) => ({y})) - : undefined; -} - -// Returns keys in order of the associated scale’s domains. (We don’t want to -// recompute the keys here because facets may already be filtered, and facets -// isn’t sorted because it’s constructed prior to the other mark channels.) -function facetKeys(facets, fx, fy) { - const fxI = fx && new InternMap(fx.domain().map((x, i) => [x, i])); - const fyI = fy && new InternMap(fy.domain().map((y, i) => [y, i])); - return sort(facets, (a, b) => (fxI && fxI.get(a.x) - fxI.get(b.x)) || (fyI && fyI.get(a.y) - fyI.get(b.y))); -} - -// Returns a (possibly nested) Map of [[key1, index1], [key2, index2], …] -// representing the data indexes associated with each facet. -function facetGroups(data, {fx, fy}) { - const I = range(data); - const FX = fx?.value; - const FY = fy?.value; - return fx && fy - ? rollup( - I, - (G) => ((G.fx = FX[G[0]]), (G.fy = FY[G[0]]), G), - (i) => FX[i], - (i) => FY[i] - ) - : fx - ? rollup( - I, - (G) => ((G.fx = FX[G[0]]), G), - (i) => FX[i] - ) - : rollup( - I, - (G) => ((G.fy = FY[G[0]]), G), - (i) => FY[i] - ); -} - -function facetTranslate(fx, fy) { - return fx && fy - ? ({x, y}) => `translate(${fx(x)},${fy(y)})` - : fx - ? ({x}) => `translate(${fx(x)},0)` - : ({y}) => `translate(0,${fy(y)})`; -} - -// Returns an index that for each facet lists all the elements present in other -// facets in the original index. TODO Memoize to avoid repeated work? -function excludeIndex(index) { - const ex = []; - const e = new Uint32Array(sum(index, (d) => d.length)); - for (const i of index) { - let n = 0; - for (const j of index) { - if (i === j) continue; - e.set(j, n); - n += j.length; - } - ex.push(e.slice(0, n)); - } - return ex; -} - // Returns the facet groups, and possibly fx and fy channels, associated with // the top-level facet option {data, x, y}. function maybeTopFacet(facet, options) { @@ -550,29 +421,24 @@ function maybeTopFacet(facet, options) { if (y != null) channels.fy = Channel(data, {value: y, scale: "fy"}); applyScaleTransforms(channels, options); const groups = facetGroups(data, channels); - // When the top-level facet option generated several frames, track the - // corresponding data length in order to compare it for the warning above. - const dataLength = - groups.size > 1 || (channels.fx && channels.fy && groups.size === 1 && [...groups][0][1].size > 1) - ? data.length - : undefined; - return {channels, groups, data: facet.data, dataLength}; + return {channels, groups, data: facet.data}; } // Returns the facet groups, and possibly fx and fy channels, associated with a // mark, either through top-level faceting or mark-level facet options {fx, fy}. function maybeMarkFacet(mark, topFacetState, options) { - if (mark.facet === null) return; + if (mark.facet === null || mark.facet === "super") return; // This mark defines a mark-level facet. TODO There’s some code duplication // here with maybeTopFacet that we could reduce. - const {fx: x, fy: y} = mark; - if (x != null || y != null) { - const data = arrayify(mark.data ?? x ?? y); + const {fx, fy} = mark; + if (fx != null || fy != null) { + const data = arrayify(mark.data ?? fx ?? fy); if (data === undefined) throw new Error(`missing facet data in ${mark.ariaLabel}`); + if (data === null) return; // ignore channel definitions if no data is provided TODO this right? const channels = {}; - if (x != null) channels.fx = Channel(data, {value: x, scale: "fx"}); - if (y != null) channels.fy = Channel(data, {value: y, scale: "fy"}); + if (fx != null) channels.fx = Channel(data, {value: fx, scale: "fx"}); + if (fy != null) channels.fy = Channel(data, {value: fy, scale: "fy"}); applyScaleTransforms(channels, options); return {channels, groups: facetGroups(data, channels)}; } @@ -581,23 +447,210 @@ function maybeMarkFacet(mark, topFacetState, options) { if (topFacetState === undefined) return; // TODO Can we link the top-level facet channels here? - const {channels, groups, data, dataLength} = topFacetState; + const {channels, groups, data} = topFacetState; if (mark.facet !== "auto" || mark.data === data) return {channels, groups}; - // Warn for the common pitfall of wanting to facet mapped data. See above for - // the initialization of dataLength. - if (dataLength !== undefined && arrayify(mark.data)?.length === dataLength) { + // Warn for the common pitfall of wanting to facet mapped data with the + // top-level facet option. + if ( + (groups.size > 1 || (groups.size === 1 && channels.fx && channels.fy && [...groups][0][1].size > 1)) && + arrayify(mark.data)?.length === data.length + ) { warn( `Warning: the ${mark.ariaLabel} mark appears to use faceted data, but isn’t faceted. The mark data has the same length as the facet data and the mark facet option is "auto", but the mark data and facet data are distinct. If this mark should be faceted, set the mark facet option to true; otherwise, suppress this warning by setting the mark facet option to false.` ); } } -// Facet filter, by mark; for now only the "eq" filter is provided. -function filterFacets(facets, {channels: {fx, fy}, groups}) { - return fx && fy - ? facets.map(({x, y}) => groups.get(x)?.get(y) ?? []) - : fx - ? facets.map(({x}) => groups.get(x) ?? []) - : facets.map(({y}) => groups.get(y) ?? []); +function inferAxes(marks, channelsByScale, options) { + let { + projection, + x = {}, + y = {}, + fx = {}, + fy = {}, + axis, + grid, + facet = {}, + facet: {axis: facetAxis = axis, grid: facetGrid} = facet, + x: {type: xType = hasScale(marks, "x"), axis: xAxis = axis, grid: xGrid = xAxis === null ? null : grid} = x, + y: {type: yType = hasScale(marks, "y"), axis: yAxis = axis, grid: yGrid = yAxis === null ? null : grid} = y, + fx: {axis: fxAxis = facetAxis, grid: fxGrid = fxAxis === null ? null : facetGrid} = fx, + fy: {axis: fyAxis = facetAxis, grid: fyGrid = fyAxis === null ? null : facetGrid} = fy + } = options; + + // Disable axes if the corresponding scale is not present. + if (projection || !xType) xAxis = xGrid = null; + if (projection || !yType) yAxis = yGrid = null; + if (!channelsByScale.has("fx")) fxAxis = fxGrid = null; + if (!channelsByScale.has("fy")) fyAxis = fyGrid = null; + + // Resolve the default implicit axes by checking for explicit ones. + if (xAxis === undefined) xAxis = !hasAxis(marks, "x"); + if (yAxis === undefined) yAxis = !hasAxis(marks, "y"); + if (fxAxis === undefined) fxAxis = !hasAxis(marks, "fx"); + if (fyAxis === undefined) fyAxis = !hasAxis(marks, "fy"); + + // Resolve the default orientation of axes. + if (xAxis === true) xAxis = "bottom"; + if (yAxis === true) yAxis = "left"; + if (fxAxis === true) fxAxis = xAxis === "top" || xAxis === null ? "bottom" : "top"; + if (fyAxis === true) fyAxis = yAxis === "right" || yAxis === null ? "left" : "right"; + + const axes = []; + maybeGrid(axes, fyGrid, gridFy, fy); + maybeAxis(axes, fyAxis, axisFy, "right", "left", facet, fy); + maybeGrid(axes, fxGrid, gridFx, fx); + maybeAxis(axes, fxAxis, axisFx, "top", "bottom", facet, fx); + maybeGrid(axes, yGrid, gridY, y); + maybeAxis(axes, yAxis, axisY, "left", "right", options, y); + maybeGrid(axes, xGrid, gridX, x); + maybeAxis(axes, xAxis, axisX, "bottom", "top", options, x); + return axes; +} + +function maybeAxis(axes, axis, axisType, primary, secondary, defaults, options) { + if (!axis) return; + const both = isBoth(axis); + options = axisOptions(both ? primary : axis, defaults, options); + axes.push(axisType(options)); + if (both) axes.push(axisType({...options, anchor: secondary, label: null})); +} + +function maybeGrid(axes, grid, gridType, options) { + if (!grid || isNone(grid)) return; + axes.push(gridType(gridOptions(grid, options))); +} + +function isBoth(value) { + return /^\s*both\s*$/i.test(value); +} + +function axisOptions( + anchor, + defaults, + { + line = defaults.line, + ticks, + tickSize, + tickSpacing, + tickPadding, + tickFormat, + tickRotate, + fontVariant, + ariaLabel, + ariaDescription, + label = defaults.label, + labelAnchor, + labelOffset + } +) { + return { + anchor, + line, + ticks, + tickSize, + tickSpacing, + tickPadding, + tickFormat, + tickRotate, + fontVariant, + ariaLabel, + ariaDescription, + label, + labelAnchor, + labelOffset + }; +} + +function gridOptions( + grid, + { + stroke = isColor(grid) ? grid : undefined, + ticks = isGridTicks(grid) ? grid : undefined, + tickSpacing, + ariaLabel, + ariaDescription + } +) { + return { + stroke, + ticks, + tickSpacing, + ariaLabel, + ariaDescription + }; +} + +function isGridTicks(grid) { + switch (typeof grid) { + case "number": + return true; + case "string": + return !isColor(grid); + } + return isIterable(grid) || typeof grid?.range === "function"; +} + +// Is there an explicit axis already present? TODO We probably want a more +// explicit test than looking for the ARIA label, but it does afford some +// flexibility in axis implementation which is nice. +function hasAxis(marks, k) { + const prefix = `${k}-axis `; + return marks.some((m) => m.ariaLabel?.startsWith(prefix)); +} + +function hasScale(marks, k) { + for (const mark of marks) { + for (const key in mark.channels) { + if (mark.channels[key].scale === k) { + return true; + } + } + } + return false; +} + +function inheritScaleLabels(newScales, scales) { + for (const key in newScales) { + const newScale = newScales[key]; + const scale = scales[key]; + if (newScale.label === undefined && scale) { + newScale.label = scale.label; + } + } + return newScales; +} + +// This differs from the other outerDimensions in that it accounts for rounding +// and outer padding in the fact scales; we want the frame to align exactly with +// the actual range, not the desired range. +function actualDimensions({fx, fy}, dimensions) { + const {marginTop, marginRight, marginBottom, marginLeft, width, height} = outerDimensions(dimensions); + const fxr = fx && outerRange(fx); + const fyr = fy && outerRange(fy); + return { + marginTop: fy ? fyr[0] : marginTop, + marginRight: fx ? width - fxr[1] : marginRight, + marginBottom: fy ? height - fyr[1] : marginBottom, + marginLeft: fx ? fxr[0] : marginLeft, + // Some marks, namely the x- and y-axis labels, want to know what the + // desired (rather than actual) margins are for positioning. + inset: { + marginTop: dimensions.marginTop, + marginRight: dimensions.marginRight, + marginBottom: dimensions.marginBottom, + marginLeft: dimensions.marginLeft + }, + width, + height + }; +} + +function outerRange(scale) { + const domain = scale.domain(); + let x1 = scale(domain[0]); + let x2 = scale(domain[domain.length - 1]); + if (x2 < x1) [x1, x2] = [x2, x1]; + return [x1, x2 + scale.bandwidth()]; } diff --git a/src/projection.js b/src/projection.js index 36a9f1cfee..f6f31b99d0 100644 --- a/src/projection.js +++ b/src/projection.js @@ -242,10 +242,10 @@ function project(cx, cy, values, projection) { // construct the projection), we have to test the raw projection option rather // than the materialized projection; therefore we must be extremely careful that // the logic of this function exactly matches Projection above! -export function projectionAspectRatio(projection, geometry) { +export function projectionAspectRatio(projection, marks) { if (typeof projection?.stream === "function") return defaultAspectRatio; if (isObject(projection)) projection = projection.type; - if (projection == null) return geometry ? defaultAspectRatio : undefined; + if (projection == null) return hasGeometry(marks) ? defaultAspectRatio : undefined; if (typeof projection !== "function") { const {aspectRatio} = namedProjection(projection); if (aspectRatio) return aspectRatio; @@ -266,3 +266,8 @@ export function Position(channels, scales, context) { if (y) position.y = coerceNumbers(position.y); return position; } + +function hasGeometry(marks) { + for (const mark of marks) if (mark.channels.geometry) return true; + return false; +} diff --git a/src/scales.js b/src/scales.js index 54ea764c8f..3d690eeed2 100644 --- a/src/scales.js +++ b/src/scales.js @@ -10,7 +10,6 @@ import { isScaleOptions, isTypedArray, map, - order, slice } from "./options.js"; import {registry, color, position, radius, opacity, symbol, length} from "./scales/index.js"; @@ -41,6 +40,7 @@ import {warn} from "./warnings.js"; export function Scales( channelsByScale, { + label: globalLabel, inset: globalInset = 0, insetTop: globalInsetTop = globalInset, insetRight: globalInsetRight = globalInset, @@ -53,6 +53,7 @@ export function Scales( align, padding, projection, + facet: {label: facetLabel = globalLabel} = {}, ...options } = {} ) { @@ -72,6 +73,7 @@ export function Scales( if (scale) { // populate generic scale options (percent, transform, insets) let { + label = key === "fx" || key === "fy" ? facetLabel : globalLabel, percent, transform, inset, @@ -83,6 +85,7 @@ export function Scales( if (transform == null) transform = undefined; else if (typeof transform !== "function") throw new Error("invalid scale transform; not a function"); scale.percent = !!percent; + scale.label = label === undefined ? inferScaleLabel(channels, scale) : label; scale.transform = transform; if (key === "x" || key === "fx") { scale.insetLeft = +insetLeft; @@ -98,15 +101,88 @@ export function Scales( } export function ScaleFunctions(scales) { - return Object.fromEntries(Object.entries(scales).map(([name, {scale}]) => [name, scale])); + return Object.fromEntries( + Object.entries(scales) + .filter(([, {scale}]) => scale) // drop identity scales + .map(([name, {scale, type, interval, label}]) => { + scale.type = type; // for axis + if (interval != null) scale.interval = interval; // for axis + if (label != null) scale.label = label; // for axis + return [name, scale]; + }) + ); } // Mutates scale.range! -export function autoScaleRange({x, y, fx, fy}, dimensions) { - if (fx) autoScaleRangeX(fx, dimensions); - if (fy) autoScaleRangeY(fy, dimensions); - if (x) autoScaleRangeX(x, fx ? {width: fx.scale.bandwidth()} : dimensions); - if (y) autoScaleRangeY(y, fy ? {height: fy.scale.bandwidth()} : dimensions); +export function autoScaleRange(scales, dimensions) { + const {x, y, fx, fy} = scales; + const superdimensions = fx || fy ? outerDimensions(dimensions) : dimensions; + if (fx) autoScaleRangeX(fx, superdimensions); + if (fy) autoScaleRangeY(fy, superdimensions); + const subdimensions = fx || fy ? innerDimensions(scales, dimensions) : dimensions; + if (x) autoScaleRangeX(x, subdimensions); + if (y) autoScaleRangeY(y, subdimensions); +} + +// Channels can have labels; if all the channels for a given scale are +// consistently labeled (i.e., have the same value if not undefined), and the +// corresponding scale doesn’t already have an explicit label, then the +// channels’ label is promoted to the scale. This inferred label should have an +// orientation-appropriate arrow added when used as an axis, but we don’t want +// to add the arrow when the label is set explicitly as an option; so, the +// inferred label is distinguished as an object with an “inferred” property. +function inferScaleLabel(channels = [], scale) { + let label; + for (const {label: l} of channels) { + if (l === undefined) continue; + if (label === undefined) label = l; + else if (label !== l) return; + } + if (label === undefined) return; + // Ignore the implicit label for temporal scales if it’s simply “date”. + if (isTemporalScale(scale) && /^(date|time|year)$/i.test(label)) return; + if (!isOrdinalScale(scale) && scale.percent) label = `${label} (%)`; + return {inferred: true, toString: () => label}; +} + +// Returns the dimensions of the outer frame; this is subdivided into facets +// with the margins of each facet collapsing into the outer margins. +export function outerDimensions(dimensions) { + const { + marginTop, + marginRight, + marginBottom, + marginLeft, + width, + height, + facet: { + marginTop: facetMarginTop, + marginRight: facetMarginRight, + marginBottom: facetMarginBottom, + marginLeft: facetMarginLeft + } + } = dimensions; + return { + marginTop: Math.max(marginTop, facetMarginTop), + marginRight: Math.max(marginRight, facetMarginRight), + marginBottom: Math.max(marginBottom, facetMarginBottom), + marginLeft: Math.max(marginLeft, facetMarginLeft), + width, + height + }; +} + +// Returns the dimensions of each facet. +export function innerDimensions({fx, fy}, dimensions) { + const {marginTop, marginRight, marginBottom, marginLeft, width, height} = outerDimensions(dimensions); + return { + marginTop, + marginRight, + marginBottom, + marginLeft, + width: fx ? fx.scale.bandwidth() + marginLeft + marginRight : width, + height: fy ? fy.scale.bandwidth() + marginTop + marginBottom : height + }; } function autoScaleRangeX(scale, dimensions) { @@ -412,11 +488,6 @@ export function isDivergingScale({type}) { return /^diverging($|-)/.test(type); } -// If the domain is undefined, we assume an identity scale. -export function scaleOrder({range, domain = range}) { - return Math.sign(order(domain)) * Math.sign(order(range)); -} - // Certain marks have special behavior if a scale is collapsed, i.e. if the // domain is degenerate and represents only a single value such as [3, 3]; for // example, a rect will span the full extent of the chart along a collapsed @@ -502,7 +573,9 @@ export function exposeScales(scaleDescriptors) { }; } -function exposeScale({scale, type, domain, range, label, interpolate, interval, transform, percent, pivot}) { +// Note: axis- and legend-related properties (such as label, ticks and +// tickFormat) are not included here as they do not affect the scale’s behavior. +function exposeScale({scale, type, domain, range, interpolate, interval, transform, percent, pivot}) { if (type === "identity") return {type: "identity", apply: (d) => d, invert: (d) => d}; const unknown = scale.unknown ? scale.unknown() : undefined; return { @@ -511,7 +584,6 @@ function exposeScale({scale, type, domain, range, label, interpolate, interval, ...(range !== undefined && {range: slice(range)}), // defensive copy ...(transform !== undefined && {transform}), ...(percent && {percent}), // only exposed if truthy - ...(label !== undefined && {label}), ...(unknown !== undefined && {unknown}), ...(interval !== undefined && {interval}), diff --git a/src/scales/ordinal.js b/src/scales/ordinal.js index 97593f340c..2ba97d847f 100644 --- a/src/scales/ordinal.js +++ b/src/scales/ordinal.js @@ -13,7 +13,7 @@ import {maybeBooleanRange, ordinalScheme, quantitativeScheme} from "./schemes.js export const ordinalImplicit = Symbol("ordinal"); function ScaleO(key, scale, channels, {type, interval, domain, range, reverse, hint}) { - interval = maybeInterval(interval); + interval = maybeInterval(interval, type); if (domain === undefined) domain = inferDomain(channels, interval, key); if (type === "categorical" || type === ordinalImplicit) type = "ordinal"; // shorthand for color schemes if (reverse) domain = reverseof(domain); @@ -27,7 +27,7 @@ function ScaleO(key, scale, channels, {type, interval, domain, range, reverse, h } export function ScaleOrdinal(key, channels, {type, interval, domain, range, scheme, unknown, ...options}) { - interval = maybeInterval(interval); + interval = maybeInterval(interval, type); if (domain === undefined) domain = inferDomain(channels, interval, key); let hint; if (registry.get(key) === symbol) { diff --git a/src/scales/quantitative.js b/src/scales/quantitative.js index 355aee8583..fa682a5d6a 100644 --- a/src/scales/quantitative.js +++ b/src/scales/quantitative.js @@ -24,7 +24,7 @@ import { ticks } from "d3"; import {positive, negative, finite} from "../defined.js"; -import {arrayify, constant, order, slice, maybeInterval} from "../options.js"; +import {arrayify, constant, orderof, slice, maybeInterval} from "../options.js"; import {ordinalRange, quantitativeScheme} from "./schemes.js"; import {registry, radius, opacity, color, length} from "./index.js"; @@ -79,7 +79,7 @@ export function ScaleQ( reverse } ) { - interval = maybeInterval(interval); + interval = maybeInterval(interval, type); if (type === "cyclical" || type === "sequential") type = "linear"; // shorthand for color schemes reverse = !!reverse; @@ -114,7 +114,7 @@ export function ScaleQ( const [min, max] = extent(domain); if (min > 0 || max < 0) { domain = slice(domain); - if (order(domain) !== Math.sign(min)) domain[domain.length - 1] = 0; + if (orderof(domain) !== Math.sign(min)) domain[domain.length - 1] = 0; // [2, 1] or [-2, -1] else domain[0] = 0; // [1, 2] or [-1, -2] } @@ -205,7 +205,7 @@ export function ScaleQuantize( thresholds = quantize(interpolateNumber(min, max), n + 1).slice(1, -1); // exactly n - 1 thresholds to match range if (min instanceof Date) thresholds = thresholds.map((x) => new Date(x)); // preserve date types } - if (order(arrayify(domain)) < 0) thresholds.reverse(); // preserve descending domain + if (orderof(arrayify(domain)) < 0) thresholds.reverse(); // preserve descending domain return ScaleThreshold(key, channels, {domain: thresholds, range, reverse, unknown}); } @@ -225,7 +225,7 @@ export function ScaleThreshold( reverse } ) { - const sign = order(arrayify(domain)); // preserve descending domain + const sign = orderof(arrayify(domain)); // preserve descending domain if (!pairs(domain).every(([a, b]) => isOrdered(a, b, sign))) throw new Error(`the ${key} scale has a non-monotonic domain`); if (reverse) range = reverseof(range); // domain ascending, so reverse range diff --git a/test/data/README.md b/test/data/README.md index 102f145925..e4e77a68a3 100644 --- a/test/data/README.md +++ b/test/data/README.md @@ -71,10 +71,18 @@ https://archive.nytimes.com/www.nytimes.com/imagepages/2010/05/02/business/02met Daily downloads of the npm “@observablehq/cars” package https://observablehq.com/@mbostock/npm-daily-downloads?name=@observablehq/cars +## electricity-demand.csv +Hourly electricity demand for California from the U.S. Energy Information Administration, Jan. 2021 +https://www.eia.gov/opendata/ + ## energy-production.csv U.S. Energy Information Administration; monthly energy review, primary energy production by source, Jan. 2022 https://www.eia.gov/totalenergy/data/monthly/index.php +## federal-funds.csv +U.S. Federal Reserve, Jan. 2023 +https://www.federalreserve.gov/releases/h15/ + ## flare.csv Flare visualization toolkit package hierarchy https://observablehq.com/@d3/treemap diff --git a/test/data/electricity-demand.csv b/test/data/electricity-demand.csv new file mode 100644 index 0000000000..7d07461845 --- /dev/null +++ b/test/data/electricity-demand.csv @@ -0,0 +1,9962 @@ +date,mwh +2020-12-05,30186 +2020-12-05T01:00Z,32275 +2020-12-05T02:00Z,34912 +2020-12-05T03:00Z,34773 +2020-12-05T04:00Z,34135 +2020-12-05T05:00Z,33375 +2020-12-05T06:00Z,32403 +2020-12-05T07:00Z,30772 +2020-12-05T08:00Z,28506 +2020-12-05T09:00Z,27356 +2020-12-05T10:00Z,26443 +2020-12-05T11:00Z,25808 +2020-12-05T12:00Z,25567 +2020-12-05T13:00Z,25816 +2020-12-05T14:00Z,26565 +2020-12-05T15:00Z,27717 +2020-12-05T16:00Z,28044 +2020-12-05T17:00Z,27615 +2020-12-05T18:00Z,26992 +2020-12-05T19:00Z,26041 +2020-12-05T20:00Z,25183 +2020-12-05T21:00Z,25092 +2020-12-05T22:00Z,25855 +2020-12-05T23:00Z,26545 +2020-12-06,27851 +2020-12-06T01:00Z,30118 +2020-12-06T02:00Z,32863 +2020-12-06T03:00Z,32959 +2020-12-06T04:00Z,32481 +2020-12-06T05:00Z,31853 +2020-12-06T06:00Z,30868 +2020-12-06T07:00Z,29282 +2020-12-06T08:00Z,27544 +2020-12-06T09:00Z,26379 +2020-12-06T10:00Z,25391 +2020-12-06T11:00Z,24845 +2020-12-06T12:00Z,24652 +2020-12-06T13:00Z,24660 +2020-12-06T14:00Z,25174 +2020-12-06T15:00Z,26047 +2020-12-06T16:00Z,26380 +2020-12-06T17:00Z,25825 +2020-12-06T18:00Z,25099 +2020-12-06T19:00Z,24442 +2020-12-06T20:00Z,23991 +2020-12-06T21:00Z,24207 +2020-12-06T22:00Z,24663 +2020-12-06T23:00Z,25399 +2020-12-07,26893 +2020-12-07T01:00Z,29369 +2020-12-07T02:00Z,32608 +2020-12-07T03:00Z,32992 +2020-12-07T04:00Z,32558 +2020-12-07T05:00Z,31796 +2020-12-07T06:00Z,30648 +2020-12-07T07:00Z,28748 +2020-12-07T08:00Z,26915 +2020-12-07T09:00Z,25771 +2020-12-07T10:00Z,24965 +2020-12-07T11:00Z,24595 +2020-12-07T12:00Z,24588 +2020-12-07T13:00Z,25299 +2020-12-07T14:00Z,27096 +2020-12-07T15:00Z,29630 +2020-12-07T16:00Z,31635 +2020-12-07T17:00Z,32297 +2020-12-07T18:00Z,31873 +2020-12-07T19:00Z,31001 +2020-12-07T20:00Z,30369 +2020-12-07T21:00Z,29851 +2020-12-07T22:00Z,29693 +2020-12-07T23:00Z,29987 +2020-12-08,30912 +2020-12-08T01:00Z,32532 +2020-12-08T02:00Z,35351 +2020-12-08T03:00Z,35326 +2020-12-08T04:00Z,34354 +2020-12-08T05:00Z,33222 +2020-12-08T06:00Z,31711 +2020-12-08T07:00Z,29557 +2020-12-08T08:00Z,27467 +2020-12-08T09:00Z,26090 +2020-12-08T10:00Z,25141 +2020-12-08T11:00Z,24630 +2020-12-08T12:00Z,24555 +2020-12-08T13:00Z,25165 +2020-12-08T14:00Z,26768 +2020-12-08T15:00Z,29300 +2020-12-08T16:00Z,30768 +2020-12-08T17:00Z,30934 +2020-12-08T18:00Z,30166 +2020-12-08T19:00Z,29621 +2020-12-08T20:00Z,29427 +2020-12-08T21:00Z,29247 +2020-12-08T22:00Z,29541 +2020-12-08T23:00Z,30114 +2020-12-09,31004 +2020-12-09T01:00Z,32494 +2020-12-09T02:00Z,35230 +2020-12-09T03:00Z,34976 +2020-12-09T04:00Z,34124 +2020-12-09T05:00Z,33033 +2020-12-09T06:00Z,31620 +2020-12-09T07:00Z,29433 +2020-12-09T08:00Z,27420 +2020-12-09T09:00Z,26065 +2020-12-09T10:00Z,25250 +2020-12-09T11:00Z,24921 +2020-12-09T12:00Z,24846 +2020-12-09T13:00Z,25436 +2020-12-09T14:00Z,27172 +2020-12-09T15:00Z,29627 +2020-12-09T16:00Z,31130 +2020-12-09T17:00Z,31145 +2020-12-09T18:00Z,30154 +2020-12-09T19:00Z,29241 +2020-12-09T20:00Z,28628 +2020-12-09T21:00Z,28715 +2020-12-09T22:00Z,29069 +2020-12-09T23:00Z,29770 +2020-12-10,30930 +2020-12-10T01:00Z,32164 +2020-12-10T02:00Z,34886 +2020-12-10T03:00Z,34893 +2020-12-10T04:00Z,34129 +2020-12-10T05:00Z,33094 +2020-12-10T06:00Z,31750 +2020-12-10T07:00Z,29701 +2020-12-10T08:00Z,27713 +2020-12-10T09:00Z,26330 +2020-12-10T10:00Z,25426 +2020-12-10T11:00Z,25032 +2020-12-10T12:00Z,24956 +2020-12-10T13:00Z,25549 +2020-12-10T14:00Z,27225 +2020-12-10T15:00Z,29809 +2020-12-10T16:00Z,31264 +2020-12-10T17:00Z,31074 +2020-12-10T18:00Z,30269 +2020-12-10T19:00Z,29298 +2020-12-10T20:00Z,28512 +2020-12-10T21:00Z,27921 +2020-12-10T22:00Z,28229 +2020-12-10T23:00Z,28905 +2020-12-11,30157 +2020-12-11T01:00Z,31988 +2020-12-11T02:00Z,34733 +2020-12-11T03:00Z,35241 +2020-12-11T04:00Z,34568 +2020-12-11T05:00Z,33656 +2020-12-11T06:00Z,32240 +2020-12-11T07:00Z,30186 +2020-12-11T08:00Z,28132 +2020-12-11T09:00Z,26756 +2020-12-11T10:00Z,25861 +2020-12-11T11:00Z,25392 +2020-12-11T12:00Z,25303 +2020-12-11T13:00Z,25849 +2020-12-11T14:00Z,27566 +2020-12-11T15:00Z,29939 +2020-12-11T16:00Z,31311 +2020-12-11T17:00Z,31911 +2020-12-11T18:00Z,31168 +2020-12-11T19:00Z,30498 +2020-12-11T20:00Z,30305 +2020-12-11T21:00Z,29877 +2020-12-11T22:00Z,29923 +2020-12-11T23:00Z,30264 +2020-12-12,30978 +2020-12-12T01:00Z,32666 +2020-12-12T02:00Z,35366 +2020-12-12T03:00Z,35320 +2020-12-12T04:00Z,34596 +2020-12-12T05:00Z,33715 +2020-12-12T06:00Z,32537 +2020-12-12T07:00Z,30584 +2020-12-12T08:00Z,28622 +2020-12-12T09:00Z,27072 +2020-12-12T10:00Z,25967 +2020-12-12T11:00Z,25279 +2020-12-12T12:00Z,24873 +2020-12-12T13:00Z,24995 +2020-12-12T14:00Z,25635 +2020-12-12T15:00Z,28714 +2020-12-12T16:00Z,27434 +2020-12-12T17:00Z,28225 +2020-12-12T18:00Z,28629 +2020-12-12T19:00Z,28737 +2020-12-12T20:00Z,28288 +2020-12-12T21:00Z,27815 +2020-12-12T22:00Z,27633 +2020-12-12T23:00Z,27955 +2020-12-13,28794 +2020-12-13T01:00Z,30514 +2020-12-13T02:00Z,33263 +2020-12-13T03:00Z,33472 +2020-12-13T04:00Z,32856 +2020-12-13T05:00Z,32131 +2020-12-13T06:00Z,31069 +2020-12-13T07:00Z,29390 +2020-12-13T08:00Z,27461 +2020-12-13T09:00Z,26174 +2020-12-13T10:00Z,25184 +2020-12-13T11:00Z,24610 +2020-12-13T12:00Z,24323 +2020-12-13T13:00Z,24323 +2020-12-13T14:00Z,24778 +2020-12-13T15:00Z,25573 +2020-12-13T16:00Z,25838 +2020-12-13T17:00Z,26251 +2020-12-13T18:00Z,26508 +2020-12-13T19:00Z,26825 +2020-12-13T20:00Z,26890 +2020-12-13T21:00Z,27030 +2020-12-13T22:00Z,27204 +2020-12-13T23:00Z,27684 +2020-12-14,28622 +2020-12-14T01:00Z,30397 +2020-12-14T02:00Z,33146 +2020-12-14T03:00Z,33217 +2020-12-14T04:00Z,32650 +2020-12-14T05:00Z,31763 +2020-12-14T06:00Z,30514 +2020-12-14T07:00Z,28548 +2020-12-14T08:00Z,26500 +2020-12-14T09:00Z,25169 +2020-12-14T10:00Z,24436 +2020-12-14T11:00Z,24107 +2020-12-14T12:00Z,24131 +2020-12-14T13:00Z,24858 +2020-12-14T14:00Z,26543 +2020-12-14T15:00Z,29140 +2020-12-14T16:00Z,30862 +2020-12-14T17:00Z,31222 +2020-12-14T18:00Z,30426 +2020-12-14T19:00Z,29647 +2020-12-14T20:00Z,28858 +2020-12-14T21:00Z,28372 +2020-12-14T22:00Z,28167 +2020-12-14T23:00Z,28772 +2020-12-15,29990 +2020-12-15T01:00Z,32133 +2020-12-15T02:00Z,35405 +2020-12-15T03:00Z,35677 +2020-12-15T04:00Z,35023 +2020-12-15T05:00Z,34100 +2020-12-15T06:00Z,32625 +2020-12-15T07:00Z,30369 +2020-12-15T08:00Z,28219 +2020-12-15T09:00Z,26939 +2020-12-15T10:00Z,25951 +2020-12-15T11:00Z,25382 +2020-12-15T12:00Z,25331 +2020-12-15T13:00Z,26031 +2020-12-15T14:00Z,27828 +2020-12-15T15:00Z,30350 +2020-12-15T16:00Z,31871 +2020-12-15T17:00Z,31679 +2020-12-15T18:00Z,30602 +2020-12-15T19:00Z,29620 +2020-12-15T20:00Z,28899 +2020-12-15T21:00Z,28845 +2020-12-15T22:00Z,28767 +2020-12-15T23:00Z,29173 +2020-12-16,30181 +2020-12-16T01:00Z,32377 +2020-12-16T02:00Z,35476 +2020-12-16T03:00Z,35837 +2020-12-16T04:00Z,35124 +2020-12-16T05:00Z,34193 +2020-12-16T06:00Z,32837 +2020-12-16T07:00Z,30551 +2020-12-16T08:00Z,28522 +2020-12-16T09:00Z,27162 +2020-12-16T10:00Z,26222 +2020-12-16T11:00Z,25728 +2020-12-16T12:00Z,25631 +2020-12-16T13:00Z,26205 +2020-12-16T14:00Z,27974 +2020-12-16T15:00Z,30522 +2020-12-16T16:00Z,32172 +2020-12-16T17:00Z,32002 +2020-12-16T18:00Z,30864 +2020-12-16T19:00Z,29654 +2020-12-16T20:00Z,28658 +2020-12-16T21:00Z,28278 +2020-12-16T22:00Z,28434 +2020-12-16T23:00Z,29195 +2020-12-17,30504 +2020-12-17T01:00Z,32277 +2020-12-17T02:00Z,35368 +2020-12-17T03:00Z,35597 +2020-12-17T04:00Z,34880 +2020-12-17T05:00Z,33915 +2020-12-17T06:00Z,32515 +2020-12-17T07:00Z,30486 +2020-12-17T08:00Z,28463 +2020-12-17T09:00Z,27093 +2020-12-17T10:00Z,26026 +2020-12-17T11:00Z,25298 +2020-12-17T12:00Z,25130 +2020-12-17T13:00Z,25664 +2020-12-17T14:00Z,27123 +2020-12-17T15:00Z,29305 +2020-12-17T16:00Z,30960 +2020-12-17T17:00Z,31555 +2020-12-17T18:00Z,30845 +2020-12-17T19:00Z,29591 +2020-12-17T20:00Z,28904 +2020-12-17T21:00Z,28677 +2020-12-17T22:00Z,28792 +2020-12-17T23:00Z,29317 +2020-12-18,30267 +2020-12-18T01:00Z,32107 +2020-12-18T02:00Z,35177 +2020-12-18T03:00Z,35444 +2020-12-18T04:00Z,34797 +2020-12-18T05:00Z,33852 +2020-12-18T06:00Z,32656 +2020-12-18T07:00Z,30524 +2020-12-18T08:00Z,28331 +2020-12-18T09:00Z,27076 +2020-12-18T10:00Z,26105 +2020-12-18T11:00Z,25597 +2020-12-18T12:00Z,25570 +2020-12-18T13:00Z,26201 +2020-12-18T14:00Z,27798 +2020-12-18T15:00Z,30277 +2020-12-18T16:00Z,31677 +2020-12-18T17:00Z,31573 +2020-12-18T18:00Z,30262 +2020-12-18T19:00Z,29155 +2020-12-18T20:00Z,28266 +2020-12-18T21:00Z,27840 +2020-12-18T22:00Z,27832 +2020-12-18T23:00Z,28350 +2020-12-19,29321 +2020-12-19T01:00Z,31416 +2020-12-19T02:00Z,34580 +2020-12-19T03:00Z,34827 +2020-12-19T04:00Z,34253 +2020-12-19T05:00Z,33481 +2020-12-19T06:00Z,32488 +2020-12-19T07:00Z,30637 +2020-12-19T08:00Z,28760 +2020-12-19T09:00Z,27495 +2020-12-19T10:00Z,26500 +2020-12-19T11:00Z,25808 +2020-12-19T12:00Z,25552 +2020-12-19T13:00Z,25761 +2020-12-19T14:00Z,26613 +2020-12-19T15:00Z,27835 +2020-12-19T16:00Z,28489 +2020-12-19T17:00Z,28202 +2020-12-19T18:00Z,27010 +2020-12-19T19:00Z,26026 +2020-12-19T20:00Z,25175 +2020-12-19T21:00Z,24718 +2020-12-19T22:00Z,24784 +2020-12-19T23:00Z,25363 +2020-12-20,27029 +2020-12-20T01:00Z,29559 +2020-12-20T02:00Z,33052 +2020-12-20T03:00Z,33484 +2020-12-20T04:00Z,33038 +2020-12-20T05:00Z,32333 +2020-12-20T06:00Z,31460 +2020-12-20T07:00Z,30002 +2020-12-20T08:00Z,28302 +2020-12-20T09:00Z,27047 +2020-12-20T10:00Z,26094 +2020-12-20T11:00Z,25501 +2020-12-20T12:00Z,25335 +2020-12-20T13:00Z,25510 +2020-12-20T14:00Z,26073 +2020-12-20T15:00Z,26572 +2020-12-20T16:00Z,27097 +2020-12-20T17:00Z,27043 +2020-12-20T18:00Z,26175 +2020-12-20T19:00Z,25351 +2020-12-20T20:00Z,24908 +2020-12-20T21:00Z,24674 +2020-12-20T22:00Z,24810 +2020-12-20T23:00Z,25493 +2020-12-21,27004 +2020-12-21T01:00Z,29254 +2020-12-21T02:00Z,32452 +2020-12-21T03:00Z,32890 +2020-12-21T04:00Z,32691 +2020-12-21T05:00Z,31991 +2020-12-21T06:00Z,30947 +2020-12-21T07:00Z,29161 +2020-12-21T08:00Z,27253 +2020-12-21T09:00Z,25928 +2020-12-21T10:00Z,25081 +2020-12-21T11:00Z,24738 +2020-12-21T12:00Z,24755 +2020-12-21T13:00Z,25435 +2020-12-21T14:00Z,27070 +2020-12-21T15:00Z,29370 +2020-12-21T16:00Z,30725 +2020-12-21T17:00Z,30794 +2020-12-21T18:00Z,30122 +2020-12-21T19:00Z,29569 +2020-12-21T20:00Z,29045 +2020-12-21T21:00Z,28769 +2020-12-21T22:00Z,28925 +2020-12-21T23:00Z,29371 +2020-12-22,30286 +2020-12-22T01:00Z,32127 +2020-12-22T02:00Z,35053 +2020-12-22T03:00Z,34967 +2020-12-22T04:00Z,34355 +2020-12-22T05:00Z,33395 +2020-12-22T06:00Z,32080 +2020-12-22T07:00Z,30067 +2020-12-22T08:00Z,28064 +2020-12-22T09:00Z,26593 +2020-12-22T10:00Z,25693 +2020-12-22T11:00Z,25115 +2020-12-22T12:00Z,25083 +2020-12-22T13:00Z,25533 +2020-12-22T14:00Z,26989 +2020-12-22T15:00Z,29174 +2020-12-22T16:00Z,30516 +2020-12-22T17:00Z,30810 +2020-12-22T18:00Z,30084 +2020-12-22T19:00Z,29474 +2020-12-22T20:00Z,28882 +2020-12-22T21:00Z,28369 +2020-12-22T22:00Z,28332 +2020-12-22T23:00Z,28858 +2020-12-23,29754 +2020-12-23T01:00Z,31634 +2020-12-23T02:00Z,34709 +2020-12-23T03:00Z,34877 +2020-12-23T04:00Z,34303 +2020-12-23T05:00Z,33504 +2020-12-23T06:00Z,32210 +2020-12-23T07:00Z,30265 +2020-12-23T08:00Z,28244 +2020-12-23T09:00Z,26897 +2020-12-23T10:00Z,26018 +2020-12-23T11:00Z,25612 +2020-12-23T12:00Z,25434 +2020-12-23T13:00Z,25940 +2020-12-23T14:00Z,27356 +2020-12-23T15:00Z,29383 +2020-12-23T16:00Z,30511 +2020-12-23T17:00Z,30904 +2020-12-23T18:00Z,30554 +2020-12-23T19:00Z,29852 +2020-12-23T20:00Z,29093 +2020-12-23T21:00Z,28524 +2020-12-23T22:00Z,28424 +2020-12-23T23:00Z,28643 +2020-12-24,29671 +2020-12-24T01:00Z,32679 +2020-12-24T02:00Z,34799 +2020-12-24T03:00Z,35119 +2020-12-24T04:00Z,34554 +2020-12-24T05:00Z,33798 +2020-12-24T06:00Z,32675 +2020-12-24T07:00Z,30728 +2020-12-24T08:00Z,28729 +2020-12-24T09:00Z,27127 +2020-12-24T10:00Z,26009 +2020-12-24T11:00Z,25457 +2020-12-24T12:00Z,25147 +2020-12-24T13:00Z,25400 +2020-12-24T14:00Z,26290 +2020-12-24T15:00Z,27867 +2020-12-24T16:00Z,28886 +2020-12-24T17:00Z,29738 +2020-12-24T18:00Z,30424 +2020-12-24T19:00Z,30402 +2020-12-24T20:00Z,29655 +2020-12-24T21:00Z,28610 +2020-12-24T22:00Z,28315 +2020-12-24T23:00Z,28714 +2020-12-25,29379 +2020-12-25T01:00Z,30903 +2020-12-25T02:00Z,33380 +2020-12-25T03:00Z,32850 +2020-12-25T04:00Z,31887 +2020-12-25T05:00Z,31016 +2020-12-25T06:00Z,30183 +2020-12-25T07:00Z,28782 +2020-12-25T08:00Z,27304 +2020-12-25T09:00Z,25961 +2020-12-25T10:00Z,25174 +2020-12-25T11:00Z,24552 +2020-12-25T12:00Z,24188 +2020-12-25T13:00Z,24183 +2020-12-25T14:00Z,24765 +2020-12-25T15:00Z,25702 +2020-12-25T16:00Z,26028 +2020-12-25T17:00Z,25858 +2020-12-25T18:00Z,25301 +2020-12-25T19:00Z,24706 +2020-12-25T20:00Z,24296 +2020-12-25T21:00Z,24124 +2020-12-25T22:00Z,24527 +2020-12-25T23:00Z,25127 +2020-12-26,26213 +2020-12-26T01:00Z,28066 +2020-12-26T02:00Z,30534 +2020-12-26T03:00Z,30506 +2020-12-26T04:00Z,29851 +2020-12-26T05:00Z,29275 +2020-12-26T06:00Z,28570 +2020-12-26T07:00Z,27227 +2020-12-26T08:00Z,25678 +2020-12-26T09:00Z,24501 +2020-12-26T10:00Z,23700 +2020-12-26T11:00Z,23256 +2020-12-26T12:00Z,23103 +2020-12-26T13:00Z,23273 +2020-12-26T14:00Z,23888 +2020-12-26T15:00Z,24877 +2020-12-26T16:00Z,25214 +2020-12-26T17:00Z,25218 +2020-12-26T18:00Z,24872 +2020-12-26T19:00Z,24493 +2020-12-26T20:00Z,24010 +2020-12-26T21:00Z,23754 +2020-12-26T22:00Z,23944 +2020-12-26T23:00Z,24225 +2020-12-27,25458 +2020-12-27T01:00Z,27696 +2020-12-27T02:00Z,31340 +2020-12-27T03:00Z,31812 +2020-12-27T04:00Z,31317 +2020-12-27T05:00Z,30711 +2020-12-27T06:00Z,29750 +2020-12-27T07:00Z,28212 +2020-12-27T08:00Z,26581 +2020-12-27T09:00Z,25296 +2020-12-27T10:00Z,24426 +2020-12-27T11:00Z,23909 +2020-12-27T12:00Z,23582 +2020-12-27T13:00Z,23583 +2020-12-27T14:00Z,24107 +2020-12-27T15:00Z,24879 +2020-12-27T16:00Z,25166 +2020-12-27T17:00Z,25582 +2020-12-27T18:00Z,26056 +2020-12-27T19:00Z,25745 +2020-12-27T20:00Z,25041 +2020-12-27T21:00Z,24686 +2020-12-27T22:00Z,24259 +2020-12-27T23:00Z,24499 +2020-12-28,25973 +2020-12-28T01:00Z,28463 +2020-12-28T02:00Z,31777 +2020-12-28T03:00Z,32416 +2020-12-28T04:00Z,32023 +2020-12-28T05:00Z,31238 +2020-12-28T06:00Z,30182 +2020-12-28T07:00Z,28614 +2020-12-28T08:00Z,26609 +2020-12-28T09:00Z,25334 +2020-12-28T10:00Z,24374 +2020-12-28T11:00Z,23956 +2020-12-28T12:00Z,23834 +2020-12-28T13:00Z,24395 +2020-12-28T14:00Z,25822 +2020-12-28T15:00Z,27763 +2020-12-28T16:00Z,29131 +2020-12-28T17:00Z,29640 +2020-12-28T18:00Z,29528 +2020-12-28T19:00Z,28829 +2020-12-28T20:00Z,28693 +2020-12-28T21:00Z,28978 +2020-12-28T22:00Z,29466 +2020-12-28T23:00Z,30045 +2020-12-29,31020 +2020-12-29T01:00Z,32570 +2020-12-29T02:00Z,35258 +2020-12-29T03:00Z,35323 +2020-12-29T04:00Z,34645 +2020-12-29T05:00Z,33615 +2020-12-29T06:00Z,32018 +2020-12-29T07:00Z,30094 +2020-12-29T08:00Z,28141 +2020-12-29T09:00Z,26851 +2020-12-29T10:00Z,25884 +2020-12-29T11:00Z,25236 +2020-12-29T12:00Z,25040 +2020-12-29T13:00Z,25595 +2020-12-29T14:00Z,27044 +2020-12-29T15:00Z,29124 +2020-12-29T16:00Z,30235 +2020-12-29T17:00Z,29745 +2020-12-29T18:00Z,28422 +2020-12-29T19:00Z,27355 +2020-12-29T20:00Z,26476 +2020-12-29T21:00Z,26111 +2020-12-29T22:00Z,26203 +2020-12-29T23:00Z,26669 +2020-12-30,28077 +2020-12-30T01:00Z,30285 +2020-12-30T02:00Z,33804 +2020-12-30T03:00Z,34275 +2020-12-30T04:00Z,33734 +2020-12-30T05:00Z,33191 +2020-12-30T06:00Z,32127 +2020-12-30T07:00Z,30309 +2020-12-30T08:00Z,28503 +2020-12-30T09:00Z,27154 +2020-12-30T10:00Z,26165 +2020-12-30T11:00Z,25651 +2020-12-30T12:00Z,25625 +2020-12-30T13:00Z,26109 +2020-12-30T14:00Z,27601 +2020-12-30T15:00Z,29756 +2020-12-30T16:00Z,30693 +2020-12-30T17:00Z,30236 +2020-12-30T18:00Z,28967 +2020-12-30T19:00Z,27969 +2020-12-30T20:00Z,26795 +2020-12-30T21:00Z,26166 +2020-12-30T22:00Z,26272 +2020-12-30T23:00Z,26784 +2020-12-31,28238 +2020-12-31T01:00Z,30676 +2020-12-31T02:00Z,33772 +2020-12-31T03:00Z,34114 +2020-12-31T04:00Z,33505 +2020-12-31T05:00Z,32702 +2020-12-31T06:00Z,31476 +2020-12-31T07:00Z,29569 +2020-12-31T08:00Z,27708 +2020-12-31T09:00Z,26450 +2020-12-31T10:00Z,25504 +2020-12-31T11:00Z,24881 +2020-12-31T12:00Z,24740 +2020-12-31T13:00Z,25132 +2020-12-31T14:00Z,26329 +2020-12-31T15:00Z,28152 +2020-12-31T16:00Z,29122 +2020-12-31T17:00Z,28776 +2020-12-31T18:00Z,27853 +2020-12-31T19:00Z,26970 +2020-12-31T20:00Z,26281 +2020-12-31T21:00Z,25586 +2020-12-31T22:00Z,25379 +2020-12-31T23:00Z,25850 +2021-01-01,27145 +2021-01-01T01:00Z,29416 +2021-01-01T02:00Z,32605 +2021-01-01T03:00Z,32836 +2021-01-01T04:00Z,31907 +2021-01-01T05:00Z,30914 +2021-01-01T06:00Z,29934 +2021-01-01T07:00Z,28669 +2021-01-01T08:00Z,27497 +2021-01-01T09:00Z,26257 +2021-01-01T10:00Z,25234 +2021-01-01T11:00Z,24414 +2021-01-01T12:00Z,24031 +2021-01-01T13:00Z,24017 +2021-01-01T14:00Z,24566 +2021-01-01T15:00Z,25439 +2021-01-01T16:00Z,25486 +2021-01-01T17:00Z,24620 +2021-01-01T18:00Z,23651 +2021-01-01T19:00Z,22861 +2021-01-01T20:00Z,22627 +2021-01-01T21:00Z,22485 +2021-01-01T22:00Z,22766 +2021-01-01T23:00Z,23337 +2021-01-02,24662 +2021-01-02T01:00Z,27271 +2021-01-02T02:00Z,30692 +2021-01-02T03:00Z,31108 +2021-01-02T04:00Z,30789 +2021-01-02T05:00Z,30175 +2021-01-02T06:00Z,29298 +2021-01-02T07:00Z,27783 +2021-01-02T08:00Z,26205 +2021-01-02T09:00Z,25297 +2021-01-02T10:00Z,24378 +2021-01-02T11:00Z,23816 +2021-01-02T12:00Z,23591 +2021-01-02T13:00Z,23739 +2021-01-02T14:00Z,24329 +2021-01-02T15:00Z,25362 +2021-01-02T16:00Z,25860 +2021-01-02T17:00Z,25835 +2021-01-02T18:00Z,25401 +2021-01-02T19:00Z,25175 +2021-01-02T20:00Z,25054 +2021-01-02T21:00Z,25045 +2021-01-02T22:00Z,25301 +2021-01-02T23:00Z,25807 +2021-01-03,26841 +2021-01-03T01:00Z,28736 +2021-01-03T02:00Z,31736 +2021-01-03T03:00Z,32038 +2021-01-03T04:00Z,31462 +2021-01-03T05:00Z,30536 +2021-01-03T06:00Z,29540 +2021-01-03T07:00Z,27931 +2021-01-03T08:00Z,26351 +2021-01-03T09:00Z,25251 +2021-01-03T10:00Z,24273 +2021-01-03T11:00Z,23584 +2021-01-03T12:00Z,23322 +2021-01-03T13:00Z,23454 +2021-01-03T14:00Z,23963 +2021-01-03T15:00Z,24756 +2021-01-03T16:00Z,25150 +2021-01-03T17:00Z,25177 +2021-01-03T18:00Z,24591 +2021-01-03T19:00Z,24071 +2021-01-03T20:00Z,23696 +2021-01-03T21:00Z,23489 +2021-01-03T22:00Z,23828 +2021-01-03T23:00Z,24350 +2021-01-04,25622 +2021-01-04T01:00Z,28025 +2021-01-04T02:00Z,31465 +2021-01-04T03:00Z,31911 +2021-01-04T04:00Z,31401 +2021-01-04T05:00Z,30573 +2021-01-04T06:00Z,29406 +2021-01-04T07:00Z,27693 +2021-01-04T08:00Z,25993 +2021-01-04T09:00Z,24816 +2021-01-04T10:00Z,24123 +2021-01-04T11:00Z,23717 +2021-01-04T12:00Z,23720 +2021-01-04T13:00Z,24412 +2021-01-04T14:00Z,25990 +2021-01-04T15:00Z,28482 +2021-01-04T16:00Z,29851 +2021-01-04T17:00Z,30155 +2021-01-04T18:00Z,29457 +2021-01-04T19:00Z,29030 +2021-01-04T20:00Z,28862 +2021-01-04T21:00Z,28708 +2021-01-04T22:00Z,28566 +2021-01-04T23:00Z,28572 +2021-01-05,29188 +2021-01-05T01:00Z,30744 +2021-01-05T02:00Z,33388 +2021-01-05T03:00Z,33638 +2021-01-05T04:00Z,32917 +2021-01-05T05:00Z,31850 +2021-01-05T06:00Z,30514 +2021-01-05T07:00Z,28665 +2021-01-05T08:00Z,26932 +2021-01-05T09:00Z,25940 +2021-01-05T10:00Z,25167 +2021-01-05T11:00Z,24650 +2021-01-05T12:00Z,24571 +2021-01-05T13:00Z,25241 +2021-01-05T14:00Z,26828 +2021-01-05T15:00Z,29218 +2021-01-05T16:00Z,30915 +2021-01-05T17:00Z,30887 +2021-01-05T18:00Z,29779 +2021-01-05T19:00Z,28471 +2021-01-05T20:00Z,27480 +2021-01-05T21:00Z,26955 +2021-01-05T22:00Z,27110 +2021-01-05T23:00Z,27782 +2021-01-06,28971 +2021-01-06T01:00Z,30579 +2021-01-06T02:00Z,33403 +2021-01-06T03:00Z,33790 +2021-01-06T04:00Z,33203 +2021-01-06T05:00Z,32254 +2021-01-06T06:00Z,30973 +2021-01-06T07:00Z,29158 +2021-01-06T08:00Z,27196 +2021-01-06T09:00Z,25896 +2021-01-06T10:00Z,25129 +2021-01-06T11:00Z,24693 +2021-01-06T12:00Z,24659 +2021-01-06T13:00Z,25340 +2021-01-06T14:00Z,27086 +2021-01-06T15:00Z,29602 +2021-01-06T16:00Z,31270 +2021-01-06T17:00Z,31461 +2021-01-06T18:00Z,30849 +2021-01-06T19:00Z,29956 +2021-01-06T20:00Z,29276 +2021-01-06T21:00Z,29165 +2021-01-06T22:00Z,29305 +2021-01-06T23:00Z,29378 +2021-01-07,29666 +2021-01-07T01:00Z,31030 +2021-01-07T02:00Z,33743 +2021-01-07T03:00Z,33866 +2021-01-07T04:00Z,33178 +2021-01-07T05:00Z,32391 +2021-01-07T06:00Z,31152 +2021-01-07T07:00Z,29253 +2021-01-07T08:00Z,27348 +2021-01-07T09:00Z,26116 +2021-01-07T10:00Z,25217 +2021-01-07T11:00Z,24733 +2021-01-07T12:00Z,24880 +2021-01-07T13:00Z,25582 +2021-01-07T14:00Z,27202 +2021-01-07T15:00Z,29700 +2021-01-07T16:00Z,31341 +2021-01-07T17:00Z,31587 +2021-01-07T18:00Z,30856 +2021-01-07T19:00Z,29915 +2021-01-07T20:00Z,29217 +2021-01-07T21:00Z,28644 +2021-01-07T22:00Z,28203 +2021-01-07T23:00Z,28429 +2021-01-08,29452 +2021-01-08T01:00Z,31051 +2021-01-08T02:00Z,33869 +2021-01-08T03:00Z,34224 +2021-01-08T04:00Z,33522 +2021-01-08T05:00Z,32666 +2021-01-08T06:00Z,31400 +2021-01-08T07:00Z,29565 +2021-01-08T08:00Z,27678 +2021-01-08T09:00Z,26321 +2021-01-08T10:00Z,25480 +2021-01-08T11:00Z,24938 +2021-01-08T12:00Z,24838 +2021-01-08T13:00Z,25448 +2021-01-08T14:00Z,27064 +2021-01-08T15:00Z,29480 +2021-01-08T16:00Z,31192 +2021-01-08T17:00Z,31566 +2021-01-08T18:00Z,30733 +2021-01-08T19:00Z,29696 +2021-01-08T20:00Z,28851 +2021-01-08T21:00Z,28229 +2021-01-08T22:00Z,27904 +2021-01-08T23:00Z,27883 +2021-01-09,28556 +2021-01-09T01:00Z,30155 +2021-01-09T02:00Z,32546 +2021-01-09T03:00Z,32925 +2021-01-09T04:00Z,32277 +2021-01-09T05:00Z,31504 +2021-01-09T06:00Z,30432 +2021-01-09T07:00Z,29014 +2021-01-09T08:00Z,27295 +2021-01-09T09:00Z,26165 +2021-01-09T10:00Z,25148 +2021-01-09T11:00Z,24676 +2021-01-09T12:00Z,24440 +2021-01-09T13:00Z,24711 +2021-01-09T14:00Z,25636 +2021-01-09T15:00Z,26973 +2021-01-09T16:00Z,27738 +2021-01-09T17:00Z,27443 +2021-01-09T18:00Z,26793 +2021-01-09T19:00Z,25878 +2021-01-09T20:00Z,24964 +2021-01-09T21:00Z,24572 +2021-01-09T22:00Z,24352 +2021-01-09T23:00Z,24741 +2021-01-10,25999 +2021-01-10T01:00Z,27941 +2021-01-10T02:00Z,30808 +2021-01-10T03:00Z,31448 +2021-01-10T04:00Z,30998 +2021-01-10T05:00Z,30386 +2021-01-10T06:00Z,29348 +2021-01-10T07:00Z,27890 +2021-01-10T08:00Z,26441 +2021-01-10T09:00Z,25347 +2021-01-10T10:00Z,24624 +2021-01-10T11:00Z,24115 +2021-01-10T12:00Z,23913 +2021-01-10T13:00Z,24041 +2021-01-10T14:00Z,24544 +2021-01-10T15:00Z,25515 +2021-01-10T16:00Z,25975 +2021-01-10T17:00Z,25624 +2021-01-10T18:00Z,25006 +2021-01-10T19:00Z,24405 +2021-01-10T20:00Z,24078 +2021-01-10T21:00Z,24168 +2021-01-10T22:00Z,23934 +2021-01-10T23:00Z,24366 +2021-01-11,25764 +2021-01-11T01:00Z,27643 +2021-01-11T02:00Z,30782 +2021-01-11T03:00Z,31331 +2021-01-11T04:00Z,30807 +2021-01-11T05:00Z,30116 +2021-01-11T06:00Z,29054 +2021-01-11T07:00Z,27373 +2021-01-11T08:00Z,25724 +2021-01-11T09:00Z,24735 +2021-01-11T10:00Z,24048 +2021-01-11T11:00Z,23753 +2021-01-11T12:00Z,23841 +2021-01-11T13:00Z,24770 +2021-01-11T14:00Z,26658 +2021-01-11T15:00Z,29402 +2021-01-11T16:00Z,31306 +2021-01-11T17:00Z,31372 +2021-01-11T18:00Z,30288 +2021-01-11T19:00Z,29091 +2021-01-11T20:00Z,27995 +2021-01-11T21:00Z,27252 +2021-01-11T22:00Z,27086 +2021-01-11T23:00Z,27516 +2021-01-12,28622 +2021-01-12T01:00Z,30083 +2021-01-12T02:00Z,33031 +2021-01-12T03:00Z,33368 +2021-01-12T04:00Z,32597 +2021-01-12T05:00Z,31607 +2021-01-12T06:00Z,30385 +2021-01-12T07:00Z,28494 +2021-01-12T08:00Z,26685 +2021-01-12T09:00Z,25582 +2021-01-12T10:00Z,24768 +2021-01-12T11:00Z,24327 +2021-01-12T12:00Z,24299 +2021-01-12T13:00Z,24991 +2021-01-12T14:00Z,26698 +2021-01-12T15:00Z,29337 +2021-01-12T16:00Z,30848 +2021-01-12T17:00Z,31090 +2021-01-12T18:00Z,30624 +2021-01-12T19:00Z,29968 +2021-01-12T20:00Z,29427 +2021-01-12T21:00Z,29035 +2021-01-12T22:00Z,28938 +2021-01-12T23:00Z,29265 +2021-01-13,29997 +2021-01-13T01:00Z,30809 +2021-01-13T02:00Z,33313 +2021-01-13T03:00Z,33404 +2021-01-13T04:00Z,32538 +2021-01-13T05:00Z,31505 +2021-01-13T06:00Z,30164 +2021-01-13T07:00Z,28343 +2021-01-13T08:00Z,26528 +2021-01-13T09:00Z,25407 +2021-01-13T10:00Z,24533 +2021-01-13T11:00Z,24130 +2021-01-13T12:00Z,24127 +2021-01-13T13:00Z,24764 +2021-01-13T14:00Z,26422 +2021-01-13T15:00Z,28900 +2021-01-13T16:00Z,30407 +2021-01-13T17:00Z,30431 +2021-01-13T18:00Z,29317 +2021-01-13T19:00Z,28131 +2021-01-13T20:00Z,27772 +2021-01-13T21:00Z,27290 +2021-01-13T22:00Z,27108 +2021-01-13T23:00Z,27591 +2021-01-14,28453 +2021-01-14T01:00Z,29973 +2021-01-14T02:00Z,32491 +2021-01-14T03:00Z,32860 +2021-01-14T04:00Z,32051 +2021-01-14T05:00Z,31217 +2021-01-14T06:00Z,29878 +2021-01-14T07:00Z,28047 +2021-01-14T08:00Z,26446 +2021-01-14T09:00Z,25443 +2021-01-14T10:00Z,24619 +2021-01-14T11:00Z,24165 +2021-01-14T12:00Z,24151 +2021-01-14T13:00Z,24723 +2021-01-14T14:00Z,26338 +2021-01-14T15:00Z,28802 +2021-01-14T16:00Z,30290 +2021-01-14T17:00Z,30197 +2021-01-14T18:00Z,29262 +2021-01-14T19:00Z,28107 +2021-01-14T20:00Z,27809 +2021-01-14T21:00Z,27694 +2021-01-14T22:00Z,27868 +2021-01-14T23:00Z,28133 +2021-01-15,28798 +2021-01-15T01:00Z,30202 +2021-01-15T02:00Z,32415 +2021-01-15T03:00Z,32675 +2021-01-15T04:00Z,31802 +2021-01-15T05:00Z,30709 +2021-01-15T06:00Z,29402 +2021-01-15T07:00Z,27696 +2021-01-15T08:00Z,26120 +2021-01-15T09:00Z,24990 +2021-01-15T10:00Z,24170 +2021-01-15T11:00Z,23835 +2021-01-15T12:00Z,23786 +2021-01-15T13:00Z,24336 +2021-01-15T14:00Z,25796 +2021-01-15T15:00Z,28058 +2021-01-15T16:00Z,29413 +2021-01-15T17:00Z,29564 +2021-01-15T18:00Z,28992 +2021-01-15T19:00Z,28488 +2021-01-15T20:00Z,27949 +2021-01-15T21:00Z,27693 +2021-01-15T22:00Z,28210 +2021-01-15T23:00Z,28727 +2021-01-16,29901 +2021-01-16T01:00Z,31311 +2021-01-16T02:00Z,32902 +2021-01-16T03:00Z,32583 +2021-01-16T04:00Z,31378 +2021-01-16T05:00Z,30191 +2021-01-16T06:00Z,28999 +2021-01-16T07:00Z,27573 +2021-01-16T08:00Z,26080 +2021-01-16T09:00Z,24909 +2021-01-16T10:00Z,24168 +2021-01-16T11:00Z,23794 +2021-01-16T12:00Z,23514 +2021-01-16T13:00Z,23726 +2021-01-16T14:00Z,24310 +2021-01-16T15:00Z,25446 +2021-01-16T16:00Z,25826 +2021-01-16T17:00Z,25823 +2021-01-16T18:00Z,25174 +2021-01-16T19:00Z,24618 +2021-01-16T20:00Z,23865 +2021-01-16T21:00Z,23816 +2021-01-16T22:00Z,24409 +2021-01-16T23:00Z,25057 +2021-01-17,26169 +2021-01-17T01:00Z,27955 +2021-01-17T02:00Z,30172 +2021-01-17T03:00Z,30734 +2021-01-17T04:00Z,29935 +2021-01-17T05:00Z,28956 +2021-01-17T06:00Z,28025 +2021-01-17T07:00Z,26650 +2021-01-17T08:00Z,25261 +2021-01-17T09:00Z,24267 +2021-01-17T10:00Z,23380 +2021-01-17T11:00Z,22841 +2021-01-17T12:00Z,22708 +2021-01-17T13:00Z,22805 +2021-01-17T14:00Z,23284 +2021-01-17T15:00Z,24070 +2021-01-17T16:00Z,24282 +2021-01-17T17:00Z,24082 +2021-01-17T18:00Z,23605 +2021-01-17T19:00Z,23165 +2021-01-17T20:00Z,23048 +2021-01-17T21:00Z,23258 +2021-01-17T22:00Z,23796 +2021-01-17T23:00Z,24728 +2021-01-18,25771 +2021-01-18T01:00Z,27632 +2021-01-18T02:00Z,29973 +2021-01-18T03:00Z,30377 +2021-01-18T04:00Z,29581 +2021-01-18T05:00Z,28560 +2021-01-18T06:00Z,27426 +2021-01-18T07:00Z,26123 +2021-01-18T08:00Z,24910 +2021-01-18T09:00Z,24264 +2021-01-18T10:00Z,23550 +2021-01-18T11:00Z,23133 +2021-01-18T12:00Z,23054 +2021-01-18T13:00Z,23555 +2021-01-18T14:00Z,24822 +2021-01-18T15:00Z,26454 +2021-01-18T16:00Z,27150 +2021-01-18T17:00Z,26930 +2021-01-18T18:00Z,26134 +2021-01-18T19:00Z,25887 +2021-01-18T20:00Z,25592 +2021-01-18T21:00Z,25679 +2021-01-18T22:00Z,26090 +2021-01-18T23:00Z,26698 +2021-01-19,27740 +2021-01-19T01:00Z,29332 +2021-01-19T02:00Z,31772 +2021-01-19T03:00Z,32273 +2021-01-19T04:00Z,31235 +2021-01-19T05:00Z,30174 +2021-01-19T06:00Z,28888 +2021-01-19T07:00Z,27069 +2021-01-19T08:00Z,25374 +2021-01-19T09:00Z,24555 +2021-01-19T10:00Z,23719 +2021-01-19T11:00Z,23214 +2021-01-19T12:00Z,23116 +2021-01-19T13:00Z,23730 +2021-01-19T14:00Z,25300 +2021-01-19T15:00Z,27688 +2021-01-19T16:00Z,29194 +2021-01-19T17:00Z,29424 +2021-01-19T18:00Z,28431 +2021-01-19T19:00Z,27590 +2021-01-19T20:00Z,27446 +2021-01-19T21:00Z,27352 +2021-01-19T22:00Z,27426 +2021-01-19T23:00Z,27929 +2021-01-20,28711 +2021-01-20T01:00Z,29828 +2021-01-20T02:00Z,32041 +2021-01-20T03:00Z,32543 +2021-01-20T04:00Z,31707 +2021-01-20T05:00Z,30626 +2021-01-20T06:00Z,29279 +2021-01-20T07:00Z,27403 +2021-01-20T08:00Z,25788 +2021-01-20T09:00Z,24803 +2021-01-20T10:00Z,24045 +2021-01-20T11:00Z,23569 +2021-01-20T12:00Z,23570 +2021-01-20T13:00Z,24227 +2021-01-20T14:00Z,25882 +2021-01-20T15:00Z,28364 +2021-01-20T16:00Z,29978 +2021-01-20T17:00Z,29875 +2021-01-20T18:00Z,28594 +2021-01-20T19:00Z,28188 +2021-01-20T20:00Z,27759 +2021-01-20T21:00Z,27458 +2021-01-20T22:00Z,27347 +2021-01-20T23:00Z,27719 +2021-01-21,28569 +2021-01-21T01:00Z,30015 +2021-01-21T02:00Z,32290 +2021-01-21T03:00Z,32869 +2021-01-21T04:00Z,32006 +2021-01-21T05:00Z,30963 +2021-01-21T06:00Z,29628 +2021-01-21T07:00Z,27855 +2021-01-21T08:00Z,26182 +2021-01-21T09:00Z,25187 +2021-01-21T10:00Z,24343 +2021-01-21T11:00Z,23928 +2021-01-21T12:00Z,23880 +2021-01-21T13:00Z,24630 +2021-01-21T14:00Z,26227 +2021-01-21T15:00Z,28663 +2021-01-21T16:00Z,30135 +2021-01-21T17:00Z,29999 +2021-01-21T18:00Z,28806 +2021-01-21T19:00Z,27839 +2021-01-21T20:00Z,27048 +2021-01-21T21:00Z,26849 +2021-01-21T22:00Z,27156 +2021-01-21T23:00Z,27595 +2021-01-22,28252 +2021-01-22T01:00Z,29766 +2021-01-22T02:00Z,32347 +2021-01-22T03:00Z,33075 +2021-01-22T04:00Z,32222 +2021-01-22T05:00Z,31255 +2021-01-22T06:00Z,30077 +2021-01-22T07:00Z,28273 +2021-01-22T08:00Z,26589 +2021-01-22T09:00Z,25475 +2021-01-22T10:00Z,24645 +2021-01-22T11:00Z,24157 +2021-01-22T12:00Z,24029 +2021-01-22T13:00Z,24486 +2021-01-22T14:00Z,26040 +2021-01-22T15:00Z,28451 +2021-01-22T16:00Z,29977 +2021-01-22T17:00Z,30526 +2021-01-22T18:00Z,30167 +2021-01-22T19:00Z,29640 +2021-01-22T20:00Z,29415 +2021-01-22T21:00Z,29227 +2021-01-22T22:00Z,29184 +2021-01-22T23:00Z,29007 +2021-01-23,29564 +2021-01-23T01:00Z,30561 +2021-01-23T02:00Z,32695 +2021-01-23T03:00Z,33065 +2021-01-23T04:00Z,32340 +2021-01-23T05:00Z,31453 +2021-01-23T06:00Z,30214 +2021-01-23T07:00Z,28584 +2021-01-23T08:00Z,26979 +2021-01-23T09:00Z,25863 +2021-01-23T10:00Z,25030 +2021-01-23T11:00Z,24523 +2021-01-23T12:00Z,24209 +2021-01-23T13:00Z,24385 +2021-01-23T14:00Z,25158 +2021-01-23T15:00Z,26334 +2021-01-23T16:00Z,27161 +2021-01-23T17:00Z,27545 +2021-01-23T18:00Z,27486 +2021-01-23T19:00Z,27272 +2021-01-23T20:00Z,26981 +2021-01-23T21:00Z,26600 +2021-01-23T22:00Z,26579 +2021-01-23T23:00Z,26942 +2021-01-24,27740 +2021-01-24T01:00Z,28941 +2021-01-24T02:00Z,31360 +2021-01-24T03:00Z,32216 +2021-01-24T04:00Z,31656 +2021-01-24T05:00Z,30921 +2021-01-24T06:00Z,29898 +2021-01-24T07:00Z,28267 +2021-01-24T08:00Z,26665 +2021-01-24T09:00Z,25499 +2021-01-24T10:00Z,24627 +2021-01-24T11:00Z,24149 +2021-01-24T12:00Z,23977 +2021-01-24T13:00Z,24144 +2021-01-24T14:00Z,24687 +2021-01-24T15:00Z,25630 +2021-01-24T16:00Z,26223 +2021-01-24T17:00Z,26507 +2021-01-24T18:00Z,26275 +2021-01-24T19:00Z,25826 +2021-01-24T20:00Z,25973 +2021-01-24T21:00Z,26207 +2021-01-24T22:00Z,26380 +2021-01-24T23:00Z,26589 +2021-01-25,27156 +2021-01-25T01:00Z,28953 +2021-01-25T02:00Z,31734 +2021-01-25T03:00Z,32428 +2021-01-25T04:00Z,31831 +2021-01-25T05:00Z,30815 +2021-01-25T06:00Z,29592 +2021-01-25T07:00Z,27729 +2021-01-25T08:00Z,25999 +2021-01-25T09:00Z,24541 +2021-01-25T10:00Z,23852 +2021-01-25T11:00Z,23604 +2021-01-25T12:00Z,23877 +2021-01-25T13:00Z,24582 +2021-01-25T14:00Z,26189 +2021-01-25T15:00Z,28743 +2021-01-25T16:00Z,30700 +2021-01-25T17:00Z,31428 +2021-01-25T18:00Z,31183 +2021-01-25T19:00Z,30213 +2021-01-25T20:00Z,29477 +2021-01-25T21:00Z,29168 +2021-01-25T22:00Z,28763 +2021-01-25T23:00Z,29072 +2021-01-26,30006 +2021-01-26T01:00Z,31233 +2021-01-26T02:00Z,34217 +2021-01-26T03:00Z,35303 +2021-01-26T04:00Z,34552 +2021-01-26T05:00Z,33540 +2021-01-26T06:00Z,32108 +2021-01-26T07:00Z,30008 +2021-01-26T08:00Z,28034 +2021-01-26T09:00Z,26702 +2021-01-26T10:00Z,25958 +2021-01-26T11:00Z,25615 +2021-01-26T12:00Z,25665 +2021-01-26T13:00Z,26401 +2021-01-26T14:00Z,28198 +2021-01-26T15:00Z,31039 +2021-01-26T16:00Z,32603 +2021-01-26T17:00Z,32255 +2021-01-26T18:00Z,31087 +2021-01-26T19:00Z,30009 +2021-01-26T20:00Z,29528 +2021-01-26T21:00Z,29176 +2021-01-26T22:00Z,29312 +2021-01-26T23:00Z,29529 +2021-01-27,30008 +2021-01-27T01:00Z,31549 +2021-01-27T02:00Z,34519 +2021-01-27T03:00Z,35514 +2021-01-27T04:00Z,34860 +2021-01-27T05:00Z,33698 +2021-01-27T06:00Z,32074 +2021-01-27T07:00Z,29662 +2021-01-27T08:00Z,27629 +2021-01-27T09:00Z,26495 +2021-01-27T10:00Z,25526 +2021-01-27T11:00Z,25030 +2021-01-27T12:00Z,24814 +2021-01-27T13:00Z,25436 +2021-01-27T14:00Z,26932 +2021-01-27T15:00Z,29443 +2021-01-27T16:00Z,31155 +2021-01-27T17:00Z,31577 +2021-01-27T18:00Z,31351 +2021-01-27T19:00Z,30951 +2021-01-27T20:00Z,30844 +2021-01-27T21:00Z,30823 +2021-01-27T22:00Z,30556 +2021-01-27T23:00Z,30357 +2021-01-28,30482 +2021-01-28T01:00Z,31590 +2021-01-28T02:00Z,33735 +2021-01-28T03:00Z,34296 +2021-01-28T04:00Z,33450 +2021-01-28T05:00Z,32363 +2021-01-28T06:00Z,30837 +2021-01-28T07:00Z,28659 +2021-01-28T08:00Z,26935 +2021-01-28T09:00Z,25703 +2021-01-28T10:00Z,25007 +2021-01-28T11:00Z,24835 +2021-01-28T12:00Z,24806 +2021-01-28T13:00Z,25423 +2021-01-28T14:00Z,27017 +2021-01-28T15:00Z,29187 +2021-01-28T16:00Z,30907 +2021-01-28T17:00Z,31771 +2021-01-28T18:00Z,31293 +2021-01-28T19:00Z,30562 +2021-01-28T20:00Z,29772 +2021-01-28T21:00Z,29520 +2021-01-28T22:00Z,29430 +2021-01-28T23:00Z,29515 +2021-01-29,29966 +2021-01-29T01:00Z,30907 +2021-01-29T02:00Z,32987 +2021-01-29T03:00Z,33657 +2021-01-29T04:00Z,32957 +2021-01-29T05:00Z,32016 +2021-01-29T06:00Z,30810 +2021-01-29T07:00Z,28852 +2021-01-29T08:00Z,26903 +2021-01-29T09:00Z,25735 +2021-01-29T10:00Z,24963 +2021-01-29T11:00Z,24356 +2021-01-29T12:00Z,24158 +2021-01-29T13:00Z,24653 +2021-01-29T14:00Z,26172 +2021-01-29T15:00Z,28735 +2021-01-29T16:00Z,30445 +2021-01-29T17:00Z,30872 +2021-01-29T18:00Z,30468 +2021-01-29T19:00Z,30052 +2021-01-29T20:00Z,30116 +2021-01-29T21:00Z,30193 +2021-01-29T22:00Z,29249 +2021-01-29T23:00Z,28940 +2021-01-30,29178 +2021-01-30T01:00Z,29859 +2021-01-30T02:00Z,32168 +2021-01-30T03:00Z,33193 +2021-01-30T04:00Z,32546 +2021-01-30T05:00Z,31740 +2021-01-30T06:00Z,30683 +2021-01-30T07:00Z,28979 +2021-01-30T08:00Z,27358 +2021-01-30T09:00Z,26369 +2021-01-30T10:00Z,25426 +2021-01-30T11:00Z,24742 +2021-01-30T12:00Z,24496 +2021-01-30T13:00Z,24635 +2021-01-30T14:00Z,25449 +2021-01-30T15:00Z,26344 +2021-01-30T16:00Z,26968 +2021-01-30T17:00Z,26787 +2021-01-30T18:00Z,25850 +2021-01-30T19:00Z,24536 +2021-01-30T20:00Z,23293 +2021-01-30T21:00Z,22613 +2021-01-30T22:00Z,22336 +2021-01-30T23:00Z,22923 +2021-01-31,24341 +2021-01-31T01:00Z,26327 +2021-01-31T02:00Z,29096 +2021-01-31T03:00Z,30705 +2021-01-31T04:00Z,30374 +2021-01-31T05:00Z,29780 +2021-01-31T06:00Z,28882 +2021-01-31T07:00Z,27516 +2021-01-31T08:00Z,26237 +2021-01-31T09:00Z,24750 +2021-01-31T10:00Z,23881 +2021-01-31T11:00Z,23373 +2021-01-31T12:00Z,23081 +2021-01-31T13:00Z,23101 +2021-01-31T14:00Z,23616 +2021-01-31T15:00Z,24415 +2021-01-31T16:00Z,24661 +2021-01-31T17:00Z,24945 +2021-01-31T18:00Z,24304 +2021-01-31T19:00Z,23186 +2021-01-31T20:00Z,22475 +2021-01-31T21:00Z,22525 +2021-01-31T22:00Z,23144 +2021-01-31T23:00Z,24260 +2021-02-01,25289 +2021-02-01T01:00Z,26790 +2021-02-01T02:00Z,29167 +2021-02-01T03:00Z,30060 +2021-02-01T04:00Z,29550 +2021-02-01T05:00Z,28714 +2021-02-01T06:00Z,27601 +2021-02-01T07:00Z,26124 +2021-02-01T08:00Z,24558 +2021-02-01T09:00Z,23671 +2021-02-01T10:00Z,23045 +2021-02-01T11:00Z,22680 +2021-02-01T12:00Z,22682 +2021-02-01T13:00Z,23378 +2021-02-01T14:00Z,25109 +2021-02-01T15:00Z,27552 +2021-02-01T16:00Z,28979 +2021-02-01T17:00Z,29877 +2021-02-01T18:00Z,29539 +2021-02-01T19:00Z,28400 +2021-02-01T20:00Z,27862 +2021-02-01T21:00Z,27766 +2021-02-01T22:00Z,27540 +2021-02-01T23:00Z,27452 +2021-02-02,28041 +2021-02-02T01:00Z,28918 +2021-02-02T02:00Z,31124 +2021-02-02T03:00Z,32141 +2021-02-02T04:00Z,31364 +2021-02-02T05:00Z,30298 +2021-02-02T06:00Z,28896 +2021-02-02T07:00Z,26996 +2021-02-02T08:00Z,25158 +2021-02-02T09:00Z,24229 +2021-02-02T10:00Z,23535 +2021-02-02T11:00Z,23087 +2021-02-02T12:00Z,23071 +2021-02-02T13:00Z,23624 +2021-02-02T14:00Z,24876 +2021-02-02T15:00Z,27309 +2021-02-02T16:00Z,28714 +2021-02-02T17:00Z,28891 +2021-02-02T18:00Z,28354 +2021-02-02T19:00Z,27775 +2021-02-02T20:00Z,27129 +2021-02-02T21:00Z,26798 +2021-02-02T22:00Z,26539 +2021-02-02T23:00Z,26856 +2021-02-03,27514 +2021-02-03T01:00Z,28637 +2021-02-03T02:00Z,30830 +2021-02-03T03:00Z,32116 +2021-02-03T04:00Z,31291 +2021-02-03T05:00Z,30219 +2021-02-03T06:00Z,28930 +2021-02-03T07:00Z,27180 +2021-02-03T08:00Z,25352 +2021-02-03T09:00Z,24785 +2021-02-03T10:00Z,24204 +2021-02-03T11:00Z,23926 +2021-02-03T12:00Z,23881 +2021-02-03T13:00Z,24425 +2021-02-03T14:00Z,25844 +2021-02-03T15:00Z,28011 +2021-02-03T16:00Z,29275 +2021-02-03T17:00Z,29074 +2021-02-03T18:00Z,28608 +2021-02-03T19:00Z,28218 +2021-02-03T20:00Z,27468 +2021-02-03T21:00Z,26815 +2021-02-03T22:00Z,26406 +2021-02-03T23:00Z,27048 +2021-02-04,27769 +2021-02-04T01:00Z,28794 +2021-02-04T02:00Z,31186 +2021-02-04T03:00Z,32453 +2021-02-04T04:00Z,31740 +2021-02-04T05:00Z,30796 +2021-02-04T06:00Z,29648 +2021-02-04T07:00Z,27970 +2021-02-04T08:00Z,26422 +2021-02-04T09:00Z,25824 +2021-02-04T10:00Z,25207 +2021-02-04T11:00Z,24759 +2021-02-04T12:00Z,24720 +2021-02-04T13:00Z,25379 +2021-02-04T14:00Z,26747 +2021-02-04T15:00Z,28771 +2021-02-04T16:00Z,30340 +2021-02-04T17:00Z,30182 +2021-02-04T18:00Z,29248 +2021-02-04T19:00Z,27898 +2021-02-04T20:00Z,26690 +2021-02-04T21:00Z,25896 +2021-02-04T22:00Z,25729 +2021-02-04T23:00Z,25990 +2021-02-05,26921 +2021-02-05T01:00Z,28222 +2021-02-05T02:00Z,31268 +2021-02-05T03:00Z,32788 +2021-02-05T04:00Z,32261 +2021-02-05T05:00Z,31344 +2021-02-05T06:00Z,30222 +2021-02-05T07:00Z,28398 +2021-02-05T08:00Z,26631 +2021-02-05T09:00Z,25441 +2021-02-05T10:00Z,24784 +2021-02-05T11:00Z,24431 +2021-02-05T12:00Z,24461 +2021-02-05T13:00Z,25103 +2021-02-05T14:00Z,26795 +2021-02-05T15:00Z,29132 +2021-02-05T16:00Z,30355 +2021-02-05T17:00Z,29637 +2021-02-05T18:00Z,27983 +2021-02-05T19:00Z,26646 +2021-02-05T20:00Z,25991 +2021-02-05T21:00Z,25550 +2021-02-05T22:00Z,25406 +2021-02-05T23:00Z,25529 +2021-02-06,27188 +2021-02-06T01:00Z,28221 +2021-02-06T02:00Z,30751 +2021-02-06T03:00Z,32060 +2021-02-06T04:00Z,31410 +2021-02-06T05:00Z,30589 +2021-02-06T06:00Z,29613 +2021-02-06T07:00Z,28223 +2021-02-06T08:00Z,26771 +2021-02-06T09:00Z,25641 +2021-02-06T10:00Z,24700 +2021-02-06T11:00Z,24135 +2021-02-06T12:00Z,24002 +2021-02-06T13:00Z,24208 +2021-02-06T14:00Z,25041 +2021-02-06T15:00Z,26262 +2021-02-06T16:00Z,26521 +2021-02-06T17:00Z,25911 +2021-02-06T18:00Z,24731 +2021-02-06T19:00Z,23576 +2021-02-06T20:00Z,22597 +2021-02-06T21:00Z,22122 +2021-02-06T22:00Z,22118 +2021-02-06T23:00Z,22822 +2021-02-07,24154 +2021-02-07T01:00Z,25911 +2021-02-07T02:00Z,28770 +2021-02-07T03:00Z,30355 +2021-02-07T04:00Z,29892 +2021-02-07T05:00Z,29243 +2021-02-07T06:00Z,28316 +2021-02-07T07:00Z,26955 +2021-02-07T08:00Z,25604 +2021-02-07T09:00Z,24592 +2021-02-07T10:00Z,23753 +2021-02-07T11:00Z,23271 +2021-02-07T12:00Z,23136 +2021-02-07T13:00Z,23300 +2021-02-07T14:00Z,23882 +2021-02-07T15:00Z,24896 +2021-02-07T16:00Z,24960 +2021-02-07T17:00Z,24469 +2021-02-07T18:00Z,23463 +2021-02-07T19:00Z,22255 +2021-02-07T20:00Z,21522 +2021-02-07T21:00Z,21360 +2021-02-07T22:00Z,21670 +2021-02-07T23:00Z,22671 +2021-02-08,23975 +2021-02-08T01:00Z,25566 +2021-02-08T02:00Z,28020 +2021-02-08T03:00Z,29459 +2021-02-08T04:00Z,29193 +2021-02-08T05:00Z,28756 +2021-02-08T06:00Z,27824 +2021-02-08T07:00Z,26449 +2021-02-08T08:00Z,24951 +2021-02-08T09:00Z,24091 +2021-02-08T10:00Z,23393 +2021-02-08T11:00Z,23258 +2021-02-08T12:00Z,23496 +2021-02-08T13:00Z,24246 +2021-02-08T14:00Z,25787 +2021-02-08T15:00Z,28257 +2021-02-08T16:00Z,29600 +2021-02-08T17:00Z,29644 +2021-02-08T18:00Z,28561 +2021-02-08T19:00Z,27032 +2021-02-08T20:00Z,26067 +2021-02-08T21:00Z,25936 +2021-02-08T22:00Z,25921 +2021-02-08T23:00Z,26869 +2021-02-09,27692 +2021-02-09T01:00Z,29122 +2021-02-09T02:00Z,31607 +2021-02-09T03:00Z,32976 +2021-02-09T04:00Z,32293 +2021-02-09T05:00Z,31241 +2021-02-09T06:00Z,29976 +2021-02-09T07:00Z,28312 +2021-02-09T08:00Z,26645 +2021-02-09T09:00Z,25298 +2021-02-09T10:00Z,24415 +2021-02-09T11:00Z,23895 +2021-02-09T12:00Z,23806 +2021-02-09T13:00Z,24390 +2021-02-09T14:00Z,26048 +2021-02-09T15:00Z,28246 +2021-02-09T16:00Z,29863 +2021-02-09T17:00Z,30841 +2021-02-09T18:00Z,30838 +2021-02-09T19:00Z,30223 +2021-02-09T20:00Z,29522 +2021-02-09T21:00Z,28531 +2021-02-09T22:00Z,27903 +2021-02-09T23:00Z,27632 +2021-02-10,28320 +2021-02-10T01:00Z,29532 +2021-02-10T02:00Z,31869 +2021-02-10T03:00Z,33243 +2021-02-10T04:00Z,32520 +2021-02-10T05:00Z,31449 +2021-02-10T06:00Z,30001 +2021-02-10T07:00Z,28143 +2021-02-10T08:00Z,26317 +2021-02-10T09:00Z,25298 +2021-02-10T10:00Z,24635 +2021-02-10T11:00Z,24257 +2021-02-10T12:00Z,24072 +2021-02-10T13:00Z,24726 +2021-02-10T14:00Z,26409 +2021-02-10T15:00Z,28595 +2021-02-10T16:00Z,29722 +2021-02-10T17:00Z,29304 +2021-02-10T18:00Z,28264 +2021-02-10T19:00Z,27210 +2021-02-10T20:00Z,27379 +2021-02-10T21:00Z,25942 +2021-02-10T22:00Z,25647 +2021-02-10T23:00Z,26290 +2021-02-11,26788 +2021-02-11T01:00Z,28348 +2021-02-11T02:00Z,30875 +2021-02-11T03:00Z,32608 +2021-02-11T04:00Z,32166 +2021-02-11T05:00Z,31197 +2021-02-11T06:00Z,29911 +2021-02-11T07:00Z,28140 +2021-02-11T08:00Z,26266 +2021-02-11T09:00Z,25298 +2021-02-11T10:00Z,24651 +2021-02-11T11:00Z,24198 +2021-02-11T12:00Z,24106 +2021-02-11T13:00Z,24802 +2021-02-11T14:00Z,26522 +2021-02-11T15:00Z,29068 +2021-02-11T16:00Z,29863 +2021-02-11T17:00Z,29561 +2021-02-11T18:00Z,28879 +2021-02-11T19:00Z,28494 +2021-02-11T20:00Z,28104 +2021-02-11T21:00Z,28052 +2021-02-11T22:00Z,27942 +2021-02-11T23:00Z,28676 +2021-02-12,29347 +2021-02-12T01:00Z,30573 +2021-02-12T02:00Z,32321 +2021-02-12T03:00Z,33204 +2021-02-12T04:00Z,32398 +2021-02-12T05:00Z,31359 +2021-02-12T06:00Z,30008 +2021-02-12T07:00Z,28241 +2021-02-12T08:00Z,26521 +2021-02-12T09:00Z,25604 +2021-02-12T10:00Z,24704 +2021-02-12T11:00Z,24111 +2021-02-12T12:00Z,24034 +2021-02-12T13:00Z,24563 +2021-02-12T14:00Z,25827 +2021-02-12T15:00Z,27829 +2021-02-12T16:00Z,29107 +2021-02-12T17:00Z,28972 +2021-02-12T18:00Z,28241 +2021-02-12T19:00Z,26968 +2021-02-12T20:00Z,26126 +2021-02-12T21:00Z,25517 +2021-02-12T22:00Z,25774 +2021-02-12T23:00Z,25159 +2021-02-13,26004 +2021-02-13T01:00Z,27469 +2021-02-13T02:00Z,30091 +2021-02-13T03:00Z,31727 +2021-02-13T04:00Z,31094 +2021-02-13T05:00Z,30309 +2021-02-13T06:00Z,29362 +2021-02-13T07:00Z,27784 +2021-02-13T08:00Z,26205 +2021-02-13T09:00Z,25219 +2021-02-13T10:00Z,24259 +2021-02-13T11:00Z,23698 +2021-02-13T12:00Z,23494 +2021-02-13T13:00Z,23753 +2021-02-13T14:00Z,24214 +2021-02-13T15:00Z,25280 +2021-02-13T16:00Z,25720 +2021-02-13T17:00Z,25772 +2021-02-13T18:00Z,25592 +2021-02-13T19:00Z,25093 +2021-02-13T20:00Z,24628 +2021-02-13T21:00Z,23731 +2021-02-13T22:00Z,23103 +2021-02-13T23:00Z,23362 +2021-02-14,24228 +2021-02-14T01:00Z,25652 +2021-02-14T02:00Z,28286 +2021-02-14T03:00Z,30297 +2021-02-14T04:00Z,30041 +2021-02-14T05:00Z,29461 +2021-02-14T06:00Z,28550 +2021-02-14T07:00Z,27214 +2021-02-14T08:00Z,25763 +2021-02-14T09:00Z,24660 +2021-02-14T10:00Z,23861 +2021-02-14T11:00Z,23321 +2021-02-14T12:00Z,23054 +2021-02-14T13:00Z,23211 +2021-02-14T14:00Z,23767 +2021-02-14T15:00Z,24558 +2021-02-14T16:00Z,24741 +2021-02-14T17:00Z,24868 +2021-02-14T18:00Z,23974 +2021-02-14T19:00Z,23579 +2021-02-14T20:00Z,23241 +2021-02-14T21:00Z,23061 +2021-02-14T22:00Z,23300 +2021-02-14T23:00Z,24039 +2021-02-15,24372 +2021-02-15T01:00Z,25581 +2021-02-15T02:00Z,28526 +2021-02-15T03:00Z,30215 +2021-02-15T04:00Z,29852 +2021-02-15T05:00Z,29262 +2021-02-15T06:00Z,28415 +2021-02-15T07:00Z,26997 +2021-02-15T08:00Z,25436 +2021-02-15T09:00Z,24406 +2021-02-15T10:00Z,23739 +2021-02-15T11:00Z,23223 +2021-02-15T12:00Z,23382 +2021-02-15T13:00Z,23895 +2021-02-15T14:00Z,25138 +2021-02-15T15:00Z,26930 +2021-02-15T16:00Z,27903 +2021-02-15T17:00Z,28393 +2021-02-15T18:00Z,29025 +2021-02-15T19:00Z,28743 +2021-02-15T20:00Z,28659 +2021-02-15T21:00Z,28132 +2021-02-15T22:00Z,27577 +2021-02-15T23:00Z,27522 +2021-02-16,27634 +2021-02-16T01:00Z,28788 +2021-02-16T02:00Z,30953 +2021-02-16T03:00Z,32720 +2021-02-16T04:00Z,32200 +2021-02-16T05:00Z,31238 +2021-02-16T06:00Z,29968 +2021-02-16T07:00Z,28225 +2021-02-16T08:00Z,26477 +2021-02-16T09:00Z,25217 +2021-02-16T10:00Z,24417 +2021-02-16T11:00Z,24001 +2021-02-16T12:00Z,23965 +2021-02-16T13:00Z,24639 +2021-02-16T14:00Z,26332 +2021-02-16T15:00Z,28614 +2021-02-16T16:00Z,29663 +2021-02-16T17:00Z,29639 +2021-02-16T18:00Z,29269 +2021-02-16T19:00Z,28191 +2021-02-16T20:00Z,27442 +2021-02-16T21:00Z,26654 +2021-02-16T22:00Z,26463 +2021-02-16T23:00Z,26665 +2021-02-17,27191 +2021-02-17T01:00Z,28448 +2021-02-17T02:00Z,31110 +2021-02-17T03:00Z,33157 +2021-02-17T04:00Z,32670 +2021-02-17T05:00Z,31729 +2021-02-17T06:00Z,30579 +2021-02-17T07:00Z,28848 +2021-02-17T08:00Z,27071 +2021-02-17T09:00Z,26140 +2021-02-17T10:00Z,25394 +2021-02-17T11:00Z,24886 +2021-02-17T12:00Z,24964 +2021-02-17T13:00Z,25681 +2021-02-17T14:00Z,27340 +2021-02-17T15:00Z,29672 +2021-02-17T16:00Z,30512 +2021-02-17T17:00Z,29824 +2021-02-17T18:00Z,28535 +2021-02-17T19:00Z,27632 +2021-02-17T20:00Z,26688 +2021-02-17T21:00Z,26196 +2021-02-17T22:00Z,25813 +2021-02-17T23:00Z,26069 +2021-02-18,26394 +2021-02-18T01:00Z,28254 +2021-02-18T02:00Z,31213 +2021-02-18T03:00Z,33291 +2021-02-18T04:00Z,32822 +2021-02-18T05:00Z,31952 +2021-02-18T06:00Z,30711 +2021-02-18T07:00Z,29019 +2021-02-18T08:00Z,27501 +2021-02-18T09:00Z,26350 +2021-02-18T10:00Z,25840 +2021-02-18T11:00Z,25246 +2021-02-18T12:00Z,25118 +2021-02-18T13:00Z,25830 +2021-02-18T14:00Z,27623 +2021-02-18T15:00Z,29894 +2021-02-18T16:00Z,30546 +2021-02-18T17:00Z,29656 +2021-02-18T18:00Z,28544 +2021-02-18T19:00Z,28210 +2021-02-18T20:00Z,27171 +2021-02-18T21:00Z,26450 +2021-02-18T22:00Z,26570 +2021-02-18T23:00Z,26623 +2021-02-19,26720 +2021-02-19T01:00Z,27912 +2021-02-19T02:00Z,30491 +2021-02-19T03:00Z,32492 +2021-02-19T04:00Z,32385 +2021-02-19T05:00Z,31464 +2021-02-19T06:00Z,30197 +2021-02-19T07:00Z,28605 +2021-02-19T08:00Z,27250 +2021-02-19T09:00Z,25921 +2021-02-19T10:00Z,25128 +2021-02-19T11:00Z,24609 +2021-02-19T12:00Z,24479 +2021-02-19T13:00Z,25201 +2021-02-19T14:00Z,26920 +2021-02-19T15:00Z,29155 +2021-02-19T16:00Z,29959 +2021-02-19T17:00Z,29394 +2021-02-19T18:00Z,29042 +2021-02-19T19:00Z,28479 +2021-02-19T20:00Z,28108 +2021-02-19T21:00Z,27452 +2021-02-19T22:00Z,27132 +2021-02-19T23:00Z,27013 +2021-02-20,27176 +2021-02-20T01:00Z,28041 +2021-02-20T02:00Z,30347 +2021-02-20T03:00Z,32229 +2021-02-20T04:00Z,31718 +2021-02-20T05:00Z,30918 +2021-02-20T06:00Z,29938 +2021-02-20T07:00Z,28422 +2021-02-20T08:00Z,26828 +2021-02-20T09:00Z,25946 +2021-02-20T10:00Z,25188 +2021-02-20T11:00Z,24677 +2021-02-20T12:00Z,24410 +2021-02-20T13:00Z,24636 +2021-02-20T14:00Z,25465 +2021-02-20T15:00Z,26332 +2021-02-20T16:00Z,26338 +2021-02-20T17:00Z,26028 +2021-02-20T18:00Z,24905 +2021-02-20T19:00Z,24256 +2021-02-20T20:00Z,23374 +2021-02-20T21:00Z,22495 +2021-02-20T22:00Z,22258 +2021-02-20T23:00Z,22654 +2021-02-21,23705 +2021-02-21T01:00Z,25428 +2021-02-21T02:00Z,28043 +2021-02-21T03:00Z,30453 +2021-02-21T04:00Z,30243 +2021-02-21T05:00Z,29589 +2021-02-21T06:00Z,28660 +2021-02-21T07:00Z,27531 +2021-02-21T08:00Z,26158 +2021-02-21T09:00Z,25675 +2021-02-21T10:00Z,24883 +2021-02-21T11:00Z,24328 +2021-02-21T12:00Z,24118 +2021-02-21T13:00Z,24075 +2021-02-21T14:00Z,24579 +2021-02-21T15:00Z,25353 +2021-02-21T16:00Z,25330 +2021-02-21T17:00Z,24185 +2021-02-21T18:00Z,22925 +2021-02-21T19:00Z,21854 +2021-02-21T20:00Z,21380 +2021-02-21T21:00Z,21078 +2021-02-21T22:00Z,21091 +2021-02-21T23:00Z,21763 +2021-02-22,22699 +2021-02-22T01:00Z,24678 +2021-02-22T02:00Z,27571 +2021-02-22T03:00Z,29869 +2021-02-22T04:00Z,29916 +2021-02-22T05:00Z,29180 +2021-02-22T06:00Z,28080 +2021-02-22T07:00Z,26599 +2021-02-22T08:00Z,25440 +2021-02-22T09:00Z,24464 +2021-02-22T10:00Z,23861 +2021-02-22T11:00Z,23653 +2021-02-22T12:00Z,23805 +2021-02-22T13:00Z,24405 +2021-02-22T14:00Z,26273 +2021-02-22T15:00Z,28416 +2021-02-22T16:00Z,29182 +2021-02-22T17:00Z,28412 +2021-02-22T18:00Z,27143 +2021-02-22T19:00Z,26358 +2021-02-22T20:00Z,25660 +2021-02-22T21:00Z,25418 +2021-02-22T22:00Z,25546 +2021-02-22T23:00Z,26141 +2021-02-23,26960 +2021-02-23T01:00Z,28623 +2021-02-23T02:00Z,31033 +2021-02-23T03:00Z,32616 +2021-02-23T04:00Z,31810 +2021-02-23T05:00Z,30859 +2021-02-23T06:00Z,29546 +2021-02-23T07:00Z,27561 +2021-02-23T08:00Z,25875 +2021-02-23T09:00Z,24913 +2021-02-23T10:00Z,24117 +2021-02-23T11:00Z,23653 +2021-02-23T12:00Z,23584 +2021-02-23T13:00Z,24110 +2021-02-23T14:00Z,25874 +2021-02-23T15:00Z,28146 +2021-02-23T16:00Z,28862 +2021-02-23T17:00Z,28668 +2021-02-23T18:00Z,27555 +2021-02-23T19:00Z,26644 +2021-02-23T20:00Z,25947 +2021-02-23T21:00Z,25726 +2021-02-23T22:00Z,25830 +2021-02-23T23:00Z,26289 +2021-02-24,27041 +2021-02-24T01:00Z,28364 +2021-02-24T02:00Z,30381 +2021-02-24T03:00Z,31832 +2021-02-24T04:00Z,31226 +2021-02-24T05:00Z,30025 +2021-02-24T06:00Z,28657 +2021-02-24T07:00Z,26954 +2021-02-24T08:00Z,25337 +2021-02-24T09:00Z,24685 +2021-02-24T10:00Z,23690 +2021-02-24T11:00Z,23279 +2021-02-24T12:00Z,23182 +2021-02-24T13:00Z,23812 +2021-02-24T14:00Z,25545 +2021-02-24T15:00Z,27822 +2021-02-24T16:00Z,28432 +2021-02-24T17:00Z,28083 +2021-02-24T18:00Z,27004 +2021-02-24T19:00Z,25939 +2021-02-24T20:00Z,25442 +2021-02-24T21:00Z,25305 +2021-02-24T22:00Z,25478 +2021-02-24T23:00Z,26014 +2021-02-25,26688 +2021-02-25T01:00Z,28263 +2021-02-25T02:00Z,30336 +2021-02-25T03:00Z,32280 +2021-02-25T04:00Z,31747 +2021-02-25T05:00Z,30615 +2021-02-25T06:00Z,29351 +2021-02-25T07:00Z,27625 +2021-02-25T08:00Z,25977 +2021-02-25T09:00Z,24888 +2021-02-25T10:00Z,24015 +2021-02-25T11:00Z,23767 +2021-02-25T12:00Z,23748 +2021-02-25T13:00Z,24222 +2021-02-25T14:00Z,26233 +2021-02-25T15:00Z,28472 +2021-02-25T16:00Z,29118 +2021-02-25T17:00Z,28161 +2021-02-25T18:00Z,27237 +2021-02-25T19:00Z,26181 +2021-02-25T20:00Z,25452 +2021-02-25T21:00Z,25077 +2021-02-25T22:00Z,25219 +2021-02-25T23:00Z,25654 +2021-02-26,26547 +2021-02-26T01:00Z,27847 +2021-02-26T02:00Z,30401 +2021-02-26T03:00Z,32459 +2021-02-26T04:00Z,32054 +2021-02-26T05:00Z,31095 +2021-02-26T06:00Z,29957 +2021-02-26T07:00Z,28250 +2021-02-26T08:00Z,26649 +2021-02-26T09:00Z,25581 +2021-02-26T10:00Z,24827 +2021-02-26T11:00Z,24500 +2021-02-26T12:00Z,24534 +2021-02-26T13:00Z,25093 +2021-02-26T14:00Z,26766 +2021-02-26T15:00Z,28952 +2021-02-26T16:00Z,29457 +2021-02-26T17:00Z,28940 +2021-02-26T18:00Z,27446 +2021-02-26T19:00Z,26368 +2021-02-26T20:00Z,25553 +2021-02-26T21:00Z,24897 +2021-02-26T22:00Z,24880 +2021-02-26T23:00Z,25412 +2021-02-27,26352 +2021-02-27T01:00Z,27417 +2021-02-27T02:00Z,29706 +2021-02-27T03:00Z,31754 +2021-02-27T04:00Z,31387 +2021-02-27T05:00Z,30574 +2021-02-27T06:00Z,29513 +2021-02-27T07:00Z,28176 +2021-02-27T08:00Z,26594 +2021-02-27T09:00Z,25421 +2021-02-27T10:00Z,24559 +2021-02-27T11:00Z,24002 +2021-02-27T12:00Z,23813 +2021-02-27T13:00Z,24066 +2021-02-27T14:00Z,24913 +2021-02-27T15:00Z,25890 +2021-02-27T16:00Z,25713 +2021-02-27T17:00Z,24717 +2021-02-27T18:00Z,23877 +2021-02-27T19:00Z,23220 +2021-02-27T20:00Z,22298 +2021-02-27T21:00Z,21780 +2021-02-27T22:00Z,21752 +2021-02-27T23:00Z,22324 +2021-02-28,23456 +2021-02-28T01:00Z,25049 +2021-02-28T02:00Z,27594 +2021-02-28T03:00Z,29828 +2021-02-28T04:00Z,29456 +2021-02-28T05:00Z,28703 +2021-02-28T06:00Z,27956 +2021-02-28T07:00Z,26740 +2021-02-28T08:00Z,25357 +2021-02-28T09:00Z,24342 +2021-02-28T10:00Z,23632 +2021-02-28T11:00Z,23346 +2021-02-28T12:00Z,23150 +2021-02-28T13:00Z,23329 +2021-02-28T14:00Z,23852 +2021-02-28T15:00Z,24427 +2021-02-28T16:00Z,24116 +2021-02-28T17:00Z,23396 +2021-02-28T18:00Z,22380 +2021-02-28T19:00Z,21390 +2021-02-28T20:00Z,20636 +2021-02-28T21:00Z,20317 +2021-02-28T22:00Z,20264 +2021-02-28T23:00Z,20996 +2021-03-01,22270 +2021-03-01T01:00Z,23887 +2021-03-01T02:00Z,27000 +2021-03-01T03:00Z,29458 +2021-03-01T04:00Z,29310 +2021-03-01T05:00Z,28587 +2021-03-01T06:00Z,27654 +2021-03-01T07:00Z,26109 +2021-03-01T08:00Z,24575 +2021-03-01T09:00Z,23796 +2021-03-01T10:00Z,23265 +2021-03-01T11:00Z,23040 +2021-03-01T12:00Z,23093 +2021-03-01T13:00Z,23961 +2021-03-01T14:00Z,25825 +2021-03-01T15:00Z,28102 +2021-03-01T16:00Z,28603 +2021-03-01T17:00Z,27929 +2021-03-01T18:00Z,27017 +2021-03-01T19:00Z,25817 +2021-03-01T20:00Z,25067 +2021-03-01T21:00Z,24801 +2021-03-01T22:00Z,24818 +2021-03-01T23:00Z,25388 +2021-03-02,26226 +2021-03-02T01:00Z,27500 +2021-03-02T02:00Z,30036 +2021-03-02T03:00Z,32204 +2021-03-02T04:00Z,31597 +2021-03-02T05:00Z,30626 +2021-03-02T06:00Z,29403 +2021-03-02T07:00Z,27598 +2021-03-02T08:00Z,25968 +2021-03-02T09:00Z,24901 +2021-03-02T10:00Z,24176 +2021-03-02T11:00Z,23795 +2021-03-02T12:00Z,23837 +2021-03-02T13:00Z,24651 +2021-03-02T14:00Z,26315 +2021-03-02T15:00Z,28417 +2021-03-02T16:00Z,29252 +2021-03-02T17:00Z,28865 +2021-03-02T18:00Z,27249 +2021-03-02T19:00Z,26287 +2021-03-02T20:00Z,25957 +2021-03-02T21:00Z,25588 +2021-03-02T22:00Z,25794 +2021-03-02T23:00Z,26226 +2021-03-03,26984 +2021-03-03T01:00Z,28605 +2021-03-03T02:00Z,30666 +2021-03-03T03:00Z,32558 +2021-03-03T04:00Z,32042 +2021-03-03T05:00Z,30864 +2021-03-03T06:00Z,29389 +2021-03-03T07:00Z,27609 +2021-03-03T08:00Z,25944 +2021-03-03T09:00Z,24937 +2021-03-03T10:00Z,24238 +2021-03-03T11:00Z,23896 +2021-03-03T12:00Z,23866 +2021-03-03T13:00Z,24554 +2021-03-03T14:00Z,26316 +2021-03-03T15:00Z,28445 +2021-03-03T16:00Z,29478 +2021-03-03T17:00Z,29979 +2021-03-03T18:00Z,30551 +2021-03-03T19:00Z,30967 +2021-03-03T20:00Z,30774 +2021-03-03T21:00Z,30336 +2021-03-03T22:00Z,29123 +2021-03-03T23:00Z,28546 +2021-03-04,28930 +2021-03-04T01:00Z,29597 +2021-03-04T02:00Z,31413 +2021-03-04T03:00Z,33438 +2021-03-04T04:00Z,33056 +2021-03-04T05:00Z,32076 +2021-03-04T06:00Z,30698 +2021-03-04T07:00Z,28922 +2021-03-04T08:00Z,27073 +2021-03-04T09:00Z,25834 +2021-03-04T10:00Z,25140 +2021-03-04T11:00Z,24708 +2021-03-04T12:00Z,24728 +2021-03-04T13:00Z,25462 +2021-03-04T14:00Z,27105 +2021-03-04T15:00Z,29251 +2021-03-04T16:00Z,29698 +2021-03-04T17:00Z,29135 +2021-03-04T18:00Z,28119 +2021-03-04T19:00Z,26991 +2021-03-04T20:00Z,26075 +2021-03-04T21:00Z,25545 +2021-03-04T22:00Z,25486 +2021-03-04T23:00Z,25995 +2021-03-05,26658 +2021-03-05T01:00Z,27676 +2021-03-05T02:00Z,30045 +2021-03-05T03:00Z,32171 +2021-03-05T04:00Z,31901 +2021-03-05T05:00Z,31009 +2021-03-05T06:00Z,29817 +2021-03-05T07:00Z,28142 +2021-03-05T08:00Z,26400 +2021-03-05T09:00Z,25260 +2021-03-05T10:00Z,24763 +2021-03-05T11:00Z,24517 +2021-03-05T12:00Z,24500 +2021-03-05T13:00Z,25227 +2021-03-05T14:00Z,26815 +2021-03-05T15:00Z,28572 +2021-03-05T16:00Z,28873 +2021-03-05T17:00Z,28518 +2021-03-05T18:00Z,27528 +2021-03-05T19:00Z,26503 +2021-03-05T20:00Z,25662 +2021-03-05T21:00Z,25427 +2021-03-05T22:00Z,25426 +2021-03-05T23:00Z,25716 +2021-03-06,26417 +2021-03-06T01:00Z,28015 +2021-03-06T02:00Z,30149 +2021-03-06T03:00Z,32176 +2021-03-06T04:00Z,31757 +2021-03-06T05:00Z,30910 +2021-03-06T06:00Z,29843 +2021-03-06T07:00Z,28291 +2021-03-06T08:00Z,26658 +2021-03-06T09:00Z,25618 +2021-03-06T10:00Z,24801 +2021-03-06T11:00Z,24247 +2021-03-06T12:00Z,24311 +2021-03-06T13:00Z,24484 +2021-03-06T14:00Z,25202 +2021-03-06T15:00Z,25583 +2021-03-06T16:00Z,25431 +2021-03-06T17:00Z,25094 +2021-03-06T18:00Z,24540 +2021-03-06T19:00Z,23728 +2021-03-06T20:00Z,23075 +2021-03-06T21:00Z,22671 +2021-03-06T22:00Z,22280 +2021-03-06T23:00Z,22427 +2021-03-07,23550 +2021-03-07T01:00Z,25232 +2021-03-07T02:00Z,27643 +2021-03-07T03:00Z,30177 +2021-03-07T04:00Z,30248 +2021-03-07T05:00Z,29512 +2021-03-07T06:00Z,28547 +2021-03-07T07:00Z,27236 +2021-03-07T08:00Z,25793 +2021-03-07T09:00Z,24725 +2021-03-07T10:00Z,23915 +2021-03-07T11:00Z,23813 +2021-03-07T12:00Z,23613 +2021-03-07T13:00Z,23713 +2021-03-07T14:00Z,24230 +2021-03-07T15:00Z,24281 +2021-03-07T16:00Z,24179 +2021-03-07T17:00Z,24625 +2021-03-07T18:00Z,23829 +2021-03-07T19:00Z,22931 +2021-03-07T20:00Z,21584 +2021-03-07T21:00Z,21387 +2021-03-07T22:00Z,21672 +2021-03-07T23:00Z,22004 +2021-03-08,23562 +2021-03-08T01:00Z,25673 +2021-03-08T02:00Z,28111 +2021-03-08T03:00Z,30508 +2021-03-08T04:00Z,30640 +2021-03-08T05:00Z,29764 +2021-03-08T06:00Z,28762 +2021-03-08T07:00Z,27009 +2021-03-08T08:00Z,25373 +2021-03-08T09:00Z,24305 +2021-03-08T10:00Z,23681 +2021-03-08T11:00Z,23463 +2021-03-08T12:00Z,23854 +2021-03-08T13:00Z,24636 +2021-03-08T14:00Z,26403 +2021-03-08T15:00Z,28227 +2021-03-08T16:00Z,29084 +2021-03-08T17:00Z,29137 +2021-03-08T18:00Z,29073 +2021-03-08T19:00Z,28043 +2021-03-08T20:00Z,27501 +2021-03-08T21:00Z,27342 +2021-03-08T22:00Z,27416 +2021-03-08T23:00Z,27641 +2021-03-09,27939 +2021-03-09T01:00Z,28869 +2021-03-09T02:00Z,31058 +2021-03-09T03:00Z,33302 +2021-03-09T04:00Z,32886 +2021-03-09T05:00Z,31979 +2021-03-09T06:00Z,30744 +2021-03-09T07:00Z,28821 +2021-03-09T08:00Z,27066 +2021-03-09T09:00Z,26122 +2021-03-09T10:00Z,25603 +2021-03-09T11:00Z,25157 +2021-03-09T12:00Z,25144 +2021-03-09T13:00Z,25817 +2021-03-09T14:00Z,27521 +2021-03-09T15:00Z,29190 +2021-03-09T16:00Z,29949 +2021-03-09T17:00Z,29930 +2021-03-09T18:00Z,29128 +2021-03-09T19:00Z,28220 +2021-03-09T20:00Z,27488 +2021-03-09T21:00Z,27502 +2021-03-09T22:00Z,27132 +2021-03-09T23:00Z,27620 +2021-03-10,27648 +2021-03-10T01:00Z,29086 +2021-03-10T02:00Z,31662 +2021-03-10T03:00Z,33932 +2021-03-10T04:00Z,33670 +2021-03-10T05:00Z,32669 +2021-03-10T06:00Z,31408 +2021-03-10T07:00Z,29365 +2021-03-10T08:00Z,27537 +2021-03-10T09:00Z,26757 +2021-03-10T10:00Z,25994 +2021-03-10T11:00Z,25848 +2021-03-10T12:00Z,25771 +2021-03-10T13:00Z,26423 +2021-03-10T14:00Z,28100 +2021-03-10T15:00Z,29511 +2021-03-10T16:00Z,30451 +2021-03-10T17:00Z,30738 +2021-03-10T18:00Z,29966 +2021-03-10T19:00Z,29422 +2021-03-10T20:00Z,28955 +2021-03-10T21:00Z,28853 +2021-03-10T22:00Z,28588 +2021-03-10T23:00Z,28849 +2021-03-11,28893 +2021-03-11T01:00Z,29646 +2021-03-11T02:00Z,31624 +2021-03-11T03:00Z,33740 +2021-03-11T04:00Z,33451 +2021-03-11T05:00Z,32493 +2021-03-11T06:00Z,31169 +2021-03-11T07:00Z,29303 +2021-03-11T08:00Z,27421 +2021-03-11T09:00Z,26053 +2021-03-11T10:00Z,25349 +2021-03-11T11:00Z,24966 +2021-03-11T12:00Z,24882 +2021-03-11T13:00Z,25526 +2021-03-11T14:00Z,27339 +2021-03-11T15:00Z,29439 +2021-03-11T16:00Z,30156 +2021-03-11T17:00Z,29980 +2021-03-11T18:00Z,28713 +2021-03-11T19:00Z,27975 +2021-03-11T20:00Z,27457 +2021-03-11T21:00Z,26993 +2021-03-11T22:00Z,26441 +2021-03-11T23:00Z,26042 +2021-03-12,26600 +2021-03-12T01:00Z,28108 +2021-03-12T02:00Z,30640 +2021-03-12T03:00Z,33053 +2021-03-12T04:00Z,33107 +2021-03-12T05:00Z,32442 +2021-03-12T06:00Z,31171 +2021-03-12T07:00Z,29218 +2021-03-12T08:00Z,27417 +2021-03-12T09:00Z,26224 +2021-03-12T10:00Z,25631 +2021-03-12T11:00Z,25372 +2021-03-12T12:00Z,25392 +2021-03-12T13:00Z,26151 +2021-03-12T14:00Z,27820 +2021-03-12T15:00Z,29405 +2021-03-12T16:00Z,29524 +2021-03-12T17:00Z,28337 +2021-03-12T18:00Z,27649 +2021-03-12T19:00Z,26766 +2021-03-12T20:00Z,26124 +2021-03-12T21:00Z,26012 +2021-03-12T22:00Z,25845 +2021-03-12T23:00Z,26023 +2021-03-13,26423 +2021-03-13T01:00Z,27715 +2021-03-13T02:00Z,29967 +2021-03-13T03:00Z,32094 +2021-03-13T04:00Z,31985 +2021-03-13T05:00Z,31274 +2021-03-13T06:00Z,30254 +2021-03-13T07:00Z,28644 +2021-03-13T08:00Z,27042 +2021-03-13T09:00Z,25891 +2021-03-13T10:00Z,25137 +2021-03-13T11:00Z,24894 +2021-03-13T12:00Z,24789 +2021-03-13T13:00Z,24965 +2021-03-13T14:00Z,25850 +2021-03-13T15:00Z,26393 +2021-03-13T16:00Z,26193 +2021-03-13T17:00Z,25674 +2021-03-13T18:00Z,24912 +2021-03-13T19:00Z,23542 +2021-03-13T20:00Z,22425 +2021-03-13T21:00Z,21663 +2021-03-13T22:00Z,21642 +2021-03-13T23:00Z,22030 +2021-03-14,23207 +2021-03-14T01:00Z,24975 +2021-03-14T02:00Z,27529 +2021-03-14T03:00Z,30272 +2021-03-14T04:00Z,30513 +2021-03-14T05:00Z,29959 +2021-03-14T06:00Z,29167 +2021-03-14T07:00Z,27840 +2021-03-14T08:00Z,26612 +2021-03-14T09:00Z,25636 +2021-03-14T10:00Z,24595 +2021-03-14T11:00Z,24360 +2021-03-14T12:00Z,23837 +2021-03-14T13:00Z,24076 +2021-03-14T14:00Z,24874 +2021-03-14T15:00Z,25180 +2021-03-14T16:00Z,24985 +2021-03-14T17:00Z,24755 +2021-03-14T18:00Z,24479 +2021-03-14T19:00Z,23909 +2021-03-14T20:00Z,23659 +2021-03-14T21:00Z,23225 +2021-03-14T22:00Z,23130 +2021-03-14T23:00Z,23816 +2021-03-15,24772 +2021-03-15T01:00Z,26288 +2021-03-15T02:00Z,28678 +2021-03-15T03:00Z,30530 +2021-03-15T04:00Z,30447 +2021-03-15T05:00Z,29623 +2021-03-15T06:00Z,28148 +2021-03-15T07:00Z,26600 +2021-03-15T08:00Z,25253 +2021-03-15T09:00Z,24388 +2021-03-15T10:00Z,23966 +2021-03-15T11:00Z,23872 +2021-03-15T12:00Z,24629 +2021-03-15T13:00Z,26104 +2021-03-15T14:00Z,28634 +2021-03-15T15:00Z,30641 +2021-03-15T16:00Z,30698 +2021-03-15T17:00Z,31395 +2021-03-15T18:00Z,30976 +2021-03-15T19:00Z,30193 +2021-03-15T20:00Z,29271 +2021-03-15T21:00Z,28889 +2021-03-15T22:00Z,28381 +2021-03-15T23:00Z,28031 +2021-03-16,28251 +2021-03-16T01:00Z,29216 +2021-03-16T02:00Z,31322 +2021-03-16T03:00Z,33642 +2021-03-16T04:00Z,33816 +2021-03-16T05:00Z,32745 +2021-03-16T06:00Z,30781 +2021-03-16T07:00Z,28885 +2021-03-16T08:00Z,27570 +2021-03-16T09:00Z,26629 +2021-03-16T10:00Z,26112 +2021-03-16T11:00Z,26150 +2021-03-16T12:00Z,26858 +2021-03-16T13:00Z,28566 +2021-03-16T14:00Z,31332 +2021-03-16T15:00Z,32809 +2021-03-16T16:00Z,32142 +2021-03-16T17:00Z,30331 +2021-03-16T18:00Z,28319 +2021-03-16T19:00Z,26881 +2021-03-16T20:00Z,26177 +2021-03-16T21:00Z,25534 +2021-03-16T22:00Z,25436 +2021-03-16T23:00Z,25842 +2021-03-17,26041 +2021-03-17T01:00Z,27112 +2021-03-17T02:00Z,29726 +2021-03-17T03:00Z,32281 +2021-03-17T04:00Z,32443 +2021-03-17T05:00Z,31585 +2021-03-17T06:00Z,29793 +2021-03-17T07:00Z,27861 +2021-03-17T08:00Z,27064 +2021-03-17T09:00Z,26465 +2021-03-17T10:00Z,25954 +2021-03-17T11:00Z,25930 +2021-03-17T12:00Z,26564 +2021-03-17T13:00Z,28244 +2021-03-17T14:00Z,30476 +2021-03-17T15:00Z,32204 +2021-03-17T16:00Z,32083 +2021-03-17T17:00Z,30798 +2021-03-17T18:00Z,29352 +2021-03-17T19:00Z,27950 +2021-03-17T20:00Z,27158 +2021-03-17T21:00Z,26957 +2021-03-17T22:00Z,26514 +2021-03-17T23:00Z,26766 +2021-03-18,26776 +2021-03-18T01:00Z,28470 +2021-03-18T02:00Z,30347 +2021-03-18T03:00Z,32198 +2021-03-18T04:00Z,32031 +2021-03-18T05:00Z,31002 +2021-03-18T06:00Z,29222 +2021-03-18T07:00Z,27649 +2021-03-18T08:00Z,26716 +2021-03-18T09:00Z,25798 +2021-03-18T10:00Z,25283 +2021-03-18T11:00Z,25107 +2021-03-18T12:00Z,25580 +2021-03-18T13:00Z,26849 +2021-03-18T14:00Z,29245 +2021-03-18T15:00Z,30706 +2021-03-18T16:00Z,30901 +2021-03-18T17:00Z,29698 +2021-03-18T18:00Z,28616 +2021-03-18T19:00Z,27781 +2021-03-18T20:00Z,27161 +2021-03-18T21:00Z,27162 +2021-03-18T22:00Z,27284 +2021-03-18T23:00Z,27265 +2021-03-19,27985 +2021-03-19T01:00Z,29247 +2021-03-19T02:00Z,30499 +2021-03-19T03:00Z,31935 +2021-03-19T04:00Z,31386 +2021-03-19T05:00Z,30263 +2021-03-19T06:00Z,28384 +2021-03-19T07:00Z,26671 +2021-03-19T08:00Z,25626 +2021-03-19T09:00Z,24783 +2021-03-19T10:00Z,24207 +2021-03-19T11:00Z,24072 +2021-03-19T12:00Z,24543 +2021-03-19T13:00Z,25809 +2021-03-19T14:00Z,28180 +2021-03-19T15:00Z,29845 +2021-03-19T16:00Z,29899 +2021-03-19T17:00Z,29109 +2021-03-19T18:00Z,27816 +2021-03-19T19:00Z,26847 +2021-03-19T20:00Z,26610 +2021-03-19T21:00Z,26324 +2021-03-19T22:00Z,26037 +2021-03-19T23:00Z,26159 +2021-03-20,26978 +2021-03-20T01:00Z,28013 +2021-03-20T02:00Z,29487 +2021-03-20T03:00Z,31200 +2021-03-20T04:00Z,31084 +2021-03-20T05:00Z,30298 +2021-03-20T06:00Z,28950 +2021-03-20T07:00Z,27435 +2021-03-20T08:00Z,26186 +2021-03-20T09:00Z,25317 +2021-03-20T10:00Z,24678 +2021-03-20T11:00Z,24342 +2021-03-20T12:00Z,24456 +2021-03-20T13:00Z,24750 +2021-03-20T14:00Z,25589 +2021-03-20T15:00Z,26147 +2021-03-20T16:00Z,25825 +2021-03-20T17:00Z,25820 +2021-03-20T18:00Z,25260 +2021-03-20T19:00Z,23809 +2021-03-20T20:00Z,22623 +2021-03-20T21:00Z,21909 +2021-03-20T22:00Z,21701 +2021-03-20T23:00Z,22147 +2021-03-21,23301 +2021-03-21T01:00Z,24789 +2021-03-21T02:00Z,26572 +2021-03-21T03:00Z,29052 +2021-03-21T04:00Z,29402 +2021-03-21T05:00Z,28751 +2021-03-21T06:00Z,27464 +2021-03-21T07:00Z,26016 +2021-03-21T08:00Z,24741 +2021-03-21T09:00Z,23877 +2021-03-21T10:00Z,23406 +2021-03-21T11:00Z,23055 +2021-03-21T12:00Z,23144 +2021-03-21T13:00Z,23627 +2021-03-21T14:00Z,24623 +2021-03-21T15:00Z,24736 +2021-03-21T16:00Z,23960 +2021-03-21T17:00Z,23560 +2021-03-21T18:00Z,22518 +2021-03-21T19:00Z,21361 +2021-03-21T20:00Z,20718 +2021-03-21T21:00Z,20364 +2021-03-21T22:00Z,20480 +2021-03-21T23:00Z,21129 +2021-03-22,22583 +2021-03-22T01:00Z,24161 +2021-03-22T02:00Z,26433 +2021-03-22T03:00Z,28973 +2021-03-22T04:00Z,29406 +2021-03-22T05:00Z,28535 +2021-03-22T06:00Z,27053 +2021-03-22T07:00Z,25388 +2021-03-22T08:00Z,24151 +2021-03-22T09:00Z,23361 +2021-03-22T10:00Z,23052 +2021-03-22T11:00Z,23050 +2021-03-22T12:00Z,23836 +2021-03-22T13:00Z,25685 +2021-03-22T14:00Z,28202 +2021-03-22T15:00Z,29709 +2021-03-22T16:00Z,29662 +2021-03-22T17:00Z,28527 +2021-03-22T18:00Z,27136 +2021-03-22T19:00Z,26310 +2021-03-22T20:00Z,25422 +2021-03-22T21:00Z,24888 +2021-03-22T22:00Z,24908 +2021-03-22T23:00Z,24834 +2021-03-23,25550 +2021-03-23T01:00Z,26933 +2021-03-23T02:00Z,28843 +2021-03-23T03:00Z,31085 +2021-03-23T04:00Z,31073 +2021-03-23T05:00Z,29933 +2021-03-23T06:00Z,28151 +2021-03-23T07:00Z,26252 +2021-03-23T08:00Z,24830 +2021-03-23T09:00Z,24031 +2021-03-23T10:00Z,23547 +2021-03-23T11:00Z,23562 +2021-03-23T12:00Z,24103 +2021-03-23T13:00Z,25665 +2021-03-23T14:00Z,28217 +2021-03-23T15:00Z,29735 +2021-03-23T16:00Z,29499 +2021-03-23T17:00Z,28717 +2021-03-23T18:00Z,27742 +2021-03-23T19:00Z,26943 +2021-03-23T20:00Z,28253 +2021-03-23T21:00Z,25226 +2021-03-23T22:00Z,24919 +2021-03-23T23:00Z,25307 +2021-03-24,25899 +2021-03-24T01:00Z,26582 +2021-03-24T02:00Z,28712 +2021-03-24T03:00Z,30986 +2021-03-24T04:00Z,31026 +2021-03-24T05:00Z,30180 +2021-03-24T06:00Z,28363 +2021-03-24T07:00Z,26500 +2021-03-24T08:00Z,25471 +2021-03-24T09:00Z,24827 +2021-03-24T10:00Z,24376 +2021-03-24T11:00Z,24252 +2021-03-24T12:00Z,24814 +2021-03-24T13:00Z,26274 +2021-03-24T14:00Z,28690 +2021-03-24T15:00Z,29869 +2021-03-24T16:00Z,29166 +2021-03-24T17:00Z,27958 +2021-03-24T18:00Z,26482 +2021-03-24T19:00Z,25380 +2021-03-24T20:00Z,24189 +2021-03-24T21:00Z,23806 +2021-03-24T22:00Z,23673 +2021-03-24T23:00Z,24335 +2021-03-25,25312 +2021-03-25T01:00Z,26730 +2021-03-25T02:00Z,28745 +2021-03-25T03:00Z,30711 +2021-03-25T04:00Z,30620 +2021-03-25T05:00Z,29618 +2021-03-25T06:00Z,28057 +2021-03-25T07:00Z,26463 +2021-03-25T08:00Z,25433 +2021-03-25T09:00Z,24900 +2021-03-25T10:00Z,24401 +2021-03-25T11:00Z,24282 +2021-03-25T12:00Z,24462 +2021-03-25T13:00Z,25653 +2021-03-25T14:00Z,28162 +2021-03-25T15:00Z,29776 +2021-03-25T16:00Z,29634 +2021-03-25T17:00Z,28494 +2021-03-25T18:00Z,27492 +2021-03-25T19:00Z,26748 +2021-03-25T20:00Z,26268 +2021-03-25T21:00Z,26140 +2021-03-25T22:00Z,26364 +2021-03-25T23:00Z,26156 +2021-03-26,26602 +2021-03-26T01:00Z,27757 +2021-03-26T02:00Z,29681 +2021-03-26T03:00Z,31641 +2021-03-26T04:00Z,31659 +2021-03-26T05:00Z,30561 +2021-03-26T06:00Z,28793 +2021-03-26T07:00Z,26981 +2021-03-26T08:00Z,25547 +2021-03-26T09:00Z,24676 +2021-03-26T10:00Z,24250 +2021-03-26T11:00Z,24141 +2021-03-26T12:00Z,25013 +2021-03-26T13:00Z,26690 +2021-03-26T14:00Z,28990 +2021-03-26T15:00Z,30480 +2021-03-26T16:00Z,29969 +2021-03-26T17:00Z,28062 +2021-03-26T18:00Z,26264 +2021-03-26T19:00Z,25331 +2021-03-26T20:00Z,24485 +2021-03-26T21:00Z,24093 +2021-03-26T22:00Z,23687 +2021-03-26T23:00Z,24039 +2021-03-27,24796 +2021-03-27T01:00Z,26318 +2021-03-27T02:00Z,28364 +2021-03-27T03:00Z,30372 +2021-03-27T04:00Z,30635 +2021-03-27T05:00Z,29784 +2021-03-27T06:00Z,28299 +2021-03-27T07:00Z,26823 +2021-03-27T08:00Z,25845 +2021-03-27T09:00Z,24884 +2021-03-27T10:00Z,24388 +2021-03-27T11:00Z,24102 +2021-03-27T12:00Z,24484 +2021-03-27T13:00Z,25311 +2021-03-27T14:00Z,26515 +2021-03-27T15:00Z,26484 +2021-03-27T16:00Z,25074 +2021-03-27T17:00Z,24270 +2021-03-27T18:00Z,23285 +2021-03-27T19:00Z,22707 +2021-03-27T20:00Z,22028 +2021-03-27T21:00Z,21395 +2021-03-27T22:00Z,21503 +2021-03-27T23:00Z,22462 +2021-03-28,23920 +2021-03-28T01:00Z,24990 +2021-03-28T02:00Z,27178 +2021-03-28T03:00Z,29095 +2021-03-28T04:00Z,29280 +2021-03-28T05:00Z,28497 +2021-03-28T06:00Z,27105 +2021-03-28T07:00Z,25674 +2021-03-28T08:00Z,24764 +2021-03-28T09:00Z,23979 +2021-03-28T10:00Z,23379 +2021-03-28T11:00Z,23023 +2021-03-28T12:00Z,23289 +2021-03-28T13:00Z,23732 +2021-03-28T14:00Z,24490 +2021-03-28T15:00Z,24344 +2021-03-28T16:00Z,23386 +2021-03-28T17:00Z,22553 +2021-03-28T18:00Z,21730 +2021-03-28T19:00Z,21074 +2021-03-28T20:00Z,21188 +2021-03-28T21:00Z,21160 +2021-03-28T22:00Z,21711 +2021-03-28T23:00Z,22916 +2021-03-29,24656 +2021-03-29T01:00Z,26333 +2021-03-29T02:00Z,28682 +2021-03-29T03:00Z,30217 +2021-03-29T04:00Z,30240 +2021-03-29T05:00Z,29120 +2021-03-29T06:00Z,27400 +2021-03-29T07:00Z,25610 +2021-03-29T08:00Z,24597 +2021-03-29T09:00Z,23890 +2021-03-29T10:00Z,23670 +2021-03-29T11:00Z,23476 +2021-03-29T12:00Z,23623 +2021-03-29T13:00Z,24904 +2021-03-29T14:00Z,27076 +2021-03-29T15:00Z,28124 +2021-03-29T16:00Z,28045 +2021-03-29T17:00Z,28594 +2021-03-29T18:00Z,27200 +2021-03-29T19:00Z,26745 +2021-03-29T20:00Z,26440 +2021-03-29T21:00Z,26515 +2021-03-29T22:00Z,26417 +2021-03-29T23:00Z,26727 +2021-03-30,27615 +2021-03-30T01:00Z,28940 +2021-03-30T02:00Z,30644 +2021-03-30T03:00Z,32247 +2021-03-30T04:00Z,32176 +2021-03-30T05:00Z,30887 +2021-03-30T06:00Z,28956 +2021-03-30T07:00Z,26979 +2021-03-30T08:00Z,25491 +2021-03-30T09:00Z,24572 +2021-03-30T10:00Z,24094 +2021-03-30T11:00Z,23889 +2021-03-30T12:00Z,24311 +2021-03-30T13:00Z,25727 +2021-03-30T14:00Z,27871 +2021-03-30T15:00Z,29004 +2021-03-30T16:00Z,28533 +2021-03-30T17:00Z,27194 +2021-03-30T18:00Z,26463 +2021-03-30T19:00Z,26080 +2021-03-30T20:00Z,25649 +2021-03-30T21:00Z,25600 +2021-03-30T22:00Z,25804 +2021-03-30T23:00Z,26412 +2021-03-31,27651 +2021-03-31T01:00Z,29029 +2021-03-31T02:00Z,30809 +2021-03-31T03:00Z,32095 +2021-03-31T04:00Z,32055 +2021-03-31T05:00Z,30803 +2021-03-31T06:00Z,28762 +2021-03-31T07:00Z,26940 +2021-03-31T08:00Z,25953 +2021-03-31T09:00Z,24993 +2021-03-31T10:00Z,24426 +2021-03-31T11:00Z,24247 +2021-03-31T12:00Z,24530 +2021-03-31T13:00Z,25845 +2021-03-31T14:00Z,28336 +2021-03-31T15:00Z,29164 +2021-03-31T16:00Z,28831 +2021-03-31T17:00Z,27932 +2021-03-31T18:00Z,27117 +2021-03-31T19:00Z,26392 +2021-03-31T20:00Z,26096 +2021-03-31T21:00Z,26352 +2021-03-31T22:00Z,26799 +2021-03-31T23:00Z,27637 +2021-04-01,28837 +2021-04-01T01:00Z,30592 +2021-04-01T02:00Z,32186 +2021-04-01T03:00Z,33198 +2021-04-01T04:00Z,32932 +2021-04-01T05:00Z,31451 +2021-04-01T06:00Z,29354 +2021-04-01T07:00Z,27206 +2021-04-01T08:00Z,25969 +2021-04-01T09:00Z,25033 +2021-04-01T10:00Z,24358 +2021-04-01T11:00Z,23998 +2021-04-01T12:00Z,24355 +2021-04-01T13:00Z,25666 +2021-04-01T14:00Z,27580 +2021-04-01T15:00Z,28487 +2021-04-01T16:00Z,28250 +2021-04-01T17:00Z,27761 +2021-04-01T18:00Z,27765 +2021-04-01T19:00Z,27924 +2021-04-01T20:00Z,27981 +2021-04-01T21:00Z,28283 +2021-04-01T22:00Z,29029 +2021-04-01T23:00Z,29642 +2021-04-02,30449 +2021-04-02T01:00Z,31493 +2021-04-02T02:00Z,32856 +2021-04-02T03:00Z,33534 +2021-04-02T04:00Z,33124 +2021-04-02T05:00Z,31648 +2021-04-02T06:00Z,29577 +2021-04-02T07:00Z,27440 +2021-04-02T08:00Z,25823 +2021-04-02T09:00Z,24739 +2021-04-02T10:00Z,23936 +2021-04-02T11:00Z,23596 +2021-04-02T12:00Z,23867 +2021-04-02T13:00Z,25054 +2021-04-02T14:00Z,26713 +2021-04-02T15:00Z,27440 +2021-04-02T16:00Z,27267 +2021-04-02T17:00Z,27224 +2021-04-02T18:00Z,26826 +2021-04-02T19:00Z,26465 +2021-04-02T20:00Z,26160 +2021-04-02T21:00Z,26514 +2021-04-02T22:00Z,26936 +2021-04-02T23:00Z,27429 +2021-04-03,27521 +2021-04-03T01:00Z,29507 +2021-04-03T02:00Z,30986 +2021-04-03T03:00Z,31890 +2021-04-03T04:00Z,31794 +2021-04-03T05:00Z,30518 +2021-04-03T06:00Z,28664 +2021-04-03T07:00Z,26995 +2021-04-03T08:00Z,25646 +2021-04-03T09:00Z,24631 +2021-04-03T10:00Z,24104 +2021-04-03T11:00Z,23686 +2021-04-03T12:00Z,23625 +2021-04-03T13:00Z,24050 +2021-04-03T14:00Z,24844 +2021-04-03T15:00Z,24978 +2021-04-03T16:00Z,25094 +2021-04-03T17:00Z,24730 +2021-04-03T18:00Z,23707 +2021-04-03T19:00Z,22716 +2021-04-03T20:00Z,22121 +2021-04-03T21:00Z,22104 +2021-04-03T22:00Z,22667 +2021-04-03T23:00Z,23636 +2021-04-04,25279 +2021-04-04T01:00Z,26672 +2021-04-04T02:00Z,28272 +2021-04-04T03:00Z,29791 +2021-04-04T04:00Z,29967 +2021-04-04T05:00Z,29041 +2021-04-04T06:00Z,27490 +2021-04-04T07:00Z,26133 +2021-04-04T08:00Z,24684 +2021-04-04T09:00Z,23729 +2021-04-04T10:00Z,23126 +2021-04-04T11:00Z,22711 +2021-04-04T12:00Z,22509 +2021-04-04T13:00Z,22770 +2021-04-04T14:00Z,23375 +2021-04-04T15:00Z,23440 +2021-04-04T16:00Z,23520 +2021-04-04T17:00Z,22586 +2021-04-04T18:00Z,21426 +2021-04-04T19:00Z,20763 +2021-04-04T20:00Z,20500 +2021-04-04T21:00Z,20489 +2021-04-04T22:00Z,20863 +2021-04-04T23:00Z,22125 +2021-04-05,23987 +2021-04-05T01:00Z,25417 +2021-04-05T02:00Z,26718 +2021-04-05T03:00Z,28361 +2021-04-05T04:00Z,28885 +2021-04-05T05:00Z,28131 +2021-04-05T06:00Z,26800 +2021-04-05T07:00Z,25118 +2021-04-05T08:00Z,24211 +2021-04-05T09:00Z,23448 +2021-04-05T10:00Z,23051 +2021-04-05T11:00Z,22953 +2021-04-05T12:00Z,23541 +2021-04-05T13:00Z,24691 +2021-04-05T14:00Z,26782 +2021-04-05T15:00Z,27886 +2021-04-05T16:00Z,28334 +2021-04-05T17:00Z,27860 +2021-04-05T18:00Z,27136 +2021-04-05T19:00Z,26392 +2021-04-05T20:00Z,25890 +2021-04-05T21:00Z,25610 +2021-04-05T22:00Z,25939 +2021-04-05T23:00Z,26442 +2021-04-06,27473 +2021-04-06T01:00Z,28478 +2021-04-06T02:00Z,30057 +2021-04-06T03:00Z,31573 +2021-04-06T04:00Z,31760 +2021-04-06T05:00Z,30481 +2021-04-06T06:00Z,28399 +2021-04-06T07:00Z,26546 +2021-04-06T08:00Z,25418 +2021-04-06T09:00Z,24451 +2021-04-06T10:00Z,23801 +2021-04-06T11:00Z,23559 +2021-04-06T12:00Z,23940 +2021-04-06T13:00Z,25310 +2021-04-06T14:00Z,27309 +2021-04-06T15:00Z,28429 +2021-04-06T16:00Z,28641 +2021-04-06T17:00Z,27862 +2021-04-06T18:00Z,26374 +2021-04-06T19:00Z,25832 +2021-04-06T20:00Z,25547 +2021-04-06T21:00Z,25487 +2021-04-06T22:00Z,25656 +2021-04-06T23:00Z,26311 +2021-04-07,27613 +2021-04-07T01:00Z,28939 +2021-04-07T02:00Z,30525 +2021-04-07T03:00Z,31707 +2021-04-07T04:00Z,31833 +2021-04-07T05:00Z,30728 +2021-04-07T06:00Z,28743 +2021-04-07T07:00Z,26854 +2021-04-07T08:00Z,25653 +2021-04-07T09:00Z,24713 +2021-04-07T10:00Z,24125 +2021-04-07T11:00Z,23902 +2021-04-07T12:00Z,24369 +2021-04-07T13:00Z,25629 +2021-04-07T14:00Z,27547 +2021-04-07T15:00Z,28370 +2021-04-07T16:00Z,28203 +2021-04-07T17:00Z,27449 +2021-04-07T18:00Z,27147 +2021-04-07T19:00Z,26679 +2021-04-07T20:00Z,26458 +2021-04-07T21:00Z,26536 +2021-04-07T22:00Z,27274 +2021-04-07T23:00Z,28291 +2021-04-08,28600 +2021-04-08T01:00Z,29710 +2021-04-08T02:00Z,31081 +2021-04-08T03:00Z,32407 +2021-04-08T04:00Z,32511 +2021-04-08T05:00Z,31137 +2021-04-08T06:00Z,29106 +2021-04-08T07:00Z,27203 +2021-04-08T08:00Z,25994 +2021-04-08T09:00Z,24998 +2021-04-08T10:00Z,24507 +2021-04-08T11:00Z,24320 +2021-04-08T12:00Z,24749 +2021-04-08T13:00Z,26118 +2021-04-08T14:00Z,28085 +2021-04-08T15:00Z,28775 +2021-04-08T16:00Z,28831 +2021-04-08T17:00Z,28159 +2021-04-08T18:00Z,27119 +2021-04-08T19:00Z,26383 +2021-04-08T20:00Z,26128 +2021-04-08T21:00Z,26259 +2021-04-08T22:00Z,26390 +2021-04-08T23:00Z,27334 +2021-04-09,28077 +2021-04-09T01:00Z,29552 +2021-04-09T02:00Z,31079 +2021-04-09T03:00Z,32433 +2021-04-09T04:00Z,32514 +2021-04-09T05:00Z,31285 +2021-04-09T06:00Z,29286 +2021-04-09T07:00Z,27308 +2021-04-09T08:00Z,26183 +2021-04-09T09:00Z,25148 +2021-04-09T10:00Z,24520 +2021-04-09T11:00Z,24263 +2021-04-09T12:00Z,24667 +2021-04-09T13:00Z,25879 +2021-04-09T14:00Z,27770 +2021-04-09T15:00Z,28528 +2021-04-09T16:00Z,28338 +2021-04-09T17:00Z,27304 +2021-04-09T18:00Z,26295 +2021-04-09T19:00Z,25540 +2021-04-09T20:00Z,25191 +2021-04-09T21:00Z,25314 +2021-04-09T22:00Z,25869 +2021-04-09T23:00Z,26566 +2021-04-10,27636 +2021-04-10T01:00Z,29289 +2021-04-10T02:00Z,30823 +2021-04-10T03:00Z,32101 +2021-04-10T04:00Z,32242 +2021-04-10T05:00Z,31090 +2021-04-10T06:00Z,29405 +2021-04-10T07:00Z,27567 +2021-04-10T08:00Z,26177 +2021-04-10T09:00Z,25153 +2021-04-10T10:00Z,24364 +2021-04-10T11:00Z,23973 +2021-04-10T12:00Z,23972 +2021-04-10T13:00Z,24416 +2021-04-10T14:00Z,25103 +2021-04-10T15:00Z,25231 +2021-04-10T16:00Z,24871 +2021-04-10T17:00Z,24319 +2021-04-10T18:00Z,23737 +2021-04-10T19:00Z,23106 +2021-04-10T20:00Z,22874 +2021-04-10T21:00Z,23081 +2021-04-10T22:00Z,23611 +2021-04-10T23:00Z,24369 +2021-04-11,25537 +2021-04-11T01:00Z,27195 +2021-04-11T02:00Z,29046 +2021-04-11T03:00Z,30533 +2021-04-11T04:00Z,30729 +2021-04-11T05:00Z,29660 +2021-04-11T06:00Z,28033 +2021-04-11T07:00Z,26406 +2021-04-11T08:00Z,25298 +2021-04-11T09:00Z,24350 +2021-04-11T10:00Z,23708 +2021-04-11T11:00Z,23308 +2021-04-11T12:00Z,23223 +2021-04-11T13:00Z,23490 +2021-04-11T14:00Z,23761 +2021-04-11T15:00Z,23468 +2021-04-11T16:00Z,23009 +2021-04-11T17:00Z,22207 +2021-04-11T18:00Z,21472 +2021-04-11T19:00Z,21176 +2021-04-11T20:00Z,21058 +2021-04-11T21:00Z,20924 +2021-04-11T22:00Z,21178 +2021-04-11T23:00Z,22311 +2021-04-12,24041 +2021-04-12T01:00Z,26323 +2021-04-12T02:00Z,28185 +2021-04-12T03:00Z,29521 +2021-04-12T04:00Z,30006 +2021-04-12T05:00Z,28955 +2021-04-12T06:00Z,27158 +2021-04-12T07:00Z,25338 +2021-04-12T08:00Z,24104 +2021-04-12T09:00Z,23385 +2021-04-12T10:00Z,22927 +2021-04-12T11:00Z,22846 +2021-04-12T12:00Z,23362 +2021-04-12T13:00Z,24741 +2021-04-12T14:00Z,26888 +2021-04-12T15:00Z,28195 +2021-04-12T16:00Z,28688 +2021-04-12T17:00Z,28110 +2021-04-12T18:00Z,27153 +2021-04-12T19:00Z,26481 +2021-04-12T20:00Z,25848 +2021-04-12T21:00Z,25644 +2021-04-12T22:00Z,25916 +2021-04-12T23:00Z,26755 +2021-04-13,27702 +2021-04-13T01:00Z,29099 +2021-04-13T02:00Z,30363 +2021-04-13T03:00Z,31710 +2021-04-13T04:00Z,31903 +2021-04-13T05:00Z,30713 +2021-04-13T06:00Z,28573 +2021-04-13T07:00Z,26627 +2021-04-13T08:00Z,25658 +2021-04-13T09:00Z,24898 +2021-04-13T10:00Z,24328 +2021-04-13T11:00Z,24035 +2021-04-13T12:00Z,24506 +2021-04-13T13:00Z,25897 +2021-04-13T14:00Z,27848 +2021-04-13T15:00Z,29031 +2021-04-13T16:00Z,29613 +2021-04-13T17:00Z,29517 +2021-04-13T18:00Z,29300 +2021-04-13T19:00Z,28642 +2021-04-13T20:00Z,28131 +2021-04-13T21:00Z,27899 +2021-04-13T22:00Z,27794 +2021-04-13T23:00Z,27996 +2021-04-14,28278 +2021-04-14T01:00Z,29378 +2021-04-14T02:00Z,30432 +2021-04-14T03:00Z,31596 +2021-04-14T04:00Z,31727 +2021-04-14T05:00Z,30619 +2021-04-14T06:00Z,28759 +2021-04-14T07:00Z,26960 +2021-04-14T08:00Z,25823 +2021-04-14T09:00Z,24884 +2021-04-14T10:00Z,24458 +2021-04-14T11:00Z,24278 +2021-04-14T12:00Z,24779 +2021-04-14T13:00Z,26225 +2021-04-14T14:00Z,27960 +2021-04-14T15:00Z,28775 +2021-04-14T16:00Z,28585 +2021-04-14T17:00Z,27870 +2021-04-14T18:00Z,27220 +2021-04-14T19:00Z,26378 +2021-04-14T20:00Z,25839 +2021-04-14T21:00Z,25505 +2021-04-14T22:00Z,25640 +2021-04-14T23:00Z,26064 +2021-04-15,26813 +2021-04-15T01:00Z,27770 +2021-04-15T02:00Z,29292 +2021-04-15T03:00Z,30968 +2021-04-15T04:00Z,31548 +2021-04-15T05:00Z,30547 +2021-04-15T06:00Z,28616 +2021-04-15T07:00Z,26891 +2021-04-15T08:00Z,25595 +2021-04-15T09:00Z,24648 +2021-04-15T10:00Z,24221 +2021-04-15T11:00Z,24195 +2021-04-15T12:00Z,24726 +2021-04-15T13:00Z,26142 +2021-04-15T14:00Z,28127 +2021-04-15T15:00Z,28885 +2021-04-15T16:00Z,28452 +2021-04-15T17:00Z,27283 +2021-04-15T18:00Z,26430 +2021-04-15T19:00Z,25782 +2021-04-15T20:00Z,25127 +2021-04-15T21:00Z,24924 +2021-04-15T22:00Z,25272 +2021-04-15T23:00Z,25871 +2021-04-16,26818 +2021-04-16T01:00Z,28107 +2021-04-16T02:00Z,29521 +2021-04-16T03:00Z,30992 +2021-04-16T04:00Z,31548 +2021-04-16T05:00Z,30478 +2021-04-16T06:00Z,28686 +2021-04-16T07:00Z,26789 +2021-04-16T08:00Z,25438 +2021-04-16T09:00Z,24518 +2021-04-16T10:00Z,23966 +2021-04-16T11:00Z,23978 +2021-04-16T12:00Z,24315 +2021-04-16T13:00Z,25464 +2021-04-16T14:00Z,27371 +2021-04-16T15:00Z,28344 +2021-04-16T16:00Z,28185 +2021-04-16T17:00Z,27147 +2021-04-16T18:00Z,26067 +2021-04-16T19:00Z,25330 +2021-04-16T20:00Z,25199 +2021-04-16T21:00Z,25203 +2021-04-16T22:00Z,25488 +2021-04-16T23:00Z,26201 +2021-04-17,27541 +2021-04-17T01:00Z,28611 +2021-04-17T02:00Z,29934 +2021-04-17T03:00Z,31441 +2021-04-17T04:00Z,31831 +2021-04-17T05:00Z,30822 +2021-04-17T06:00Z,29221 +2021-04-17T07:00Z,27421 +2021-04-17T08:00Z,26005 +2021-04-17T09:00Z,24926 +2021-04-17T10:00Z,24133 +2021-04-17T11:00Z,23850 +2021-04-17T12:00Z,23862 +2021-04-17T13:00Z,24050 +2021-04-17T14:00Z,24614 +2021-04-17T15:00Z,24906 +2021-04-17T16:00Z,25430 +2021-04-17T17:00Z,24208 +2021-04-17T18:00Z,22949 +2021-04-17T19:00Z,22390 +2021-04-17T20:00Z,22044 +2021-04-17T21:00Z,22089 +2021-04-17T22:00Z,22606 +2021-04-17T23:00Z,23655 +2021-04-18,24938 +2021-04-18T01:00Z,26720 +2021-04-18T02:00Z,28685 +2021-04-18T03:00Z,30123 +2021-04-18T04:00Z,30590 +2021-04-18T05:00Z,29682 +2021-04-18T06:00Z,28196 +2021-04-18T07:00Z,26298 +2021-04-18T08:00Z,24775 +2021-04-18T09:00Z,23731 +2021-04-18T10:00Z,23032 +2021-04-18T11:00Z,22620 +2021-04-18T12:00Z,22795 +2021-04-18T13:00Z,23156 +2021-04-18T14:00Z,23343 +2021-04-18T15:00Z,23186 +2021-04-18T16:00Z,22852 +2021-04-18T17:00Z,22256 +2021-04-18T18:00Z,21986 +2021-04-18T19:00Z,21835 +2021-04-18T20:00Z,22104 +2021-04-18T21:00Z,22686 +2021-04-18T22:00Z,23359 +2021-04-18T23:00Z,24592 +2021-04-19,26503 +2021-04-19T01:00Z,28367 +2021-04-19T02:00Z,30297 +2021-04-19T03:00Z,31301 +2021-04-19T04:00Z,31338 +2021-04-19T05:00Z,29943 +2021-04-19T06:00Z,27917 +2021-04-19T07:00Z,25923 +2021-04-19T08:00Z,24831 +2021-04-19T09:00Z,24209 +2021-04-19T10:00Z,23815 +2021-04-19T11:00Z,23651 +2021-04-19T12:00Z,23907 +2021-04-19T13:00Z,25103 +2021-04-19T14:00Z,26651 +2021-04-19T15:00Z,27684 +2021-04-19T16:00Z,28341 +2021-04-19T17:00Z,28129 +2021-04-19T18:00Z,27668 +2021-04-19T19:00Z,27331 +2021-04-19T20:00Z,27435 +2021-04-19T21:00Z,28098 +2021-04-19T22:00Z,29076 +2021-04-19T23:00Z,30042 +2021-04-20,31325 +2021-04-20T01:00Z,32955 +2021-04-20T02:00Z,34070 +2021-04-20T03:00Z,34664 +2021-04-20T04:00Z,34394 +2021-04-20T05:00Z,32674 +2021-04-20T06:00Z,30218 +2021-04-20T07:00Z,27939 +2021-04-20T08:00Z,26275 +2021-04-20T09:00Z,25253 +2021-04-20T10:00Z,24645 +2021-04-20T11:00Z,24378 +2021-04-20T12:00Z,24759 +2021-04-20T13:00Z,26046 +2021-04-20T14:00Z,27540 +2021-04-20T15:00Z,28300 +2021-04-20T16:00Z,28263 +2021-04-20T17:00Z,27801 +2021-04-20T18:00Z,27060 +2021-04-20T19:00Z,26483 +2021-04-20T20:00Z,26385 +2021-04-20T21:00Z,26751 +2021-04-20T22:00Z,27153 +2021-04-20T23:00Z,27893 +2021-04-21,28826 +2021-04-21T01:00Z,29888 +2021-04-21T02:00Z,31185 +2021-04-21T03:00Z,32213 +2021-04-21T04:00Z,32368 +2021-04-21T05:00Z,31145 +2021-04-21T06:00Z,28968 +2021-04-21T07:00Z,27011 +2021-04-21T08:00Z,25684 +2021-04-21T09:00Z,24692 +2021-04-21T10:00Z,24377 +2021-04-21T11:00Z,24341 +2021-04-21T12:00Z,24821 +2021-04-21T13:00Z,26120 +2021-04-21T14:00Z,27704 +2021-04-21T15:00Z,28644 +2021-04-21T16:00Z,28803 +2021-04-21T17:00Z,28715 +2021-04-21T18:00Z,28289 +2021-04-21T19:00Z,27571 +2021-04-21T20:00Z,27321 +2021-04-21T21:00Z,27184 +2021-04-21T22:00Z,27453 +2021-04-21T23:00Z,27930 +2021-04-22,28806 +2021-04-22T01:00Z,29549 +2021-04-22T02:00Z,30790 +2021-04-22T03:00Z,32073 +2021-04-22T04:00Z,32363 +2021-04-22T05:00Z,31184 +2021-04-22T06:00Z,29176 +2021-04-22T07:00Z,27575 +2021-04-22T08:00Z,26314 +2021-04-22T09:00Z,25487 +2021-04-22T10:00Z,24876 +2021-04-22T11:00Z,24446 +2021-04-22T12:00Z,24681 +2021-04-22T13:00Z,26077 +2021-04-22T14:00Z,27892 +2021-04-22T15:00Z,29351 +2021-04-22T16:00Z,30047 +2021-04-22T17:00Z,29665 +2021-04-22T18:00Z,29297 +2021-04-22T19:00Z,28957 +2021-04-22T20:00Z,28480 +2021-04-22T21:00Z,28312 +2021-04-22T22:00Z,28338 +2021-04-22T23:00Z,28272 +2021-04-23,28814 +2021-04-23T01:00Z,29926 +2021-04-23T02:00Z,30854 +2021-04-23T03:00Z,32075 +2021-04-23T04:00Z,32267 +2021-04-23T05:00Z,31117 +2021-04-23T06:00Z,29198 +2021-04-23T07:00Z,27545 +2021-04-23T08:00Z,26055 +2021-04-23T09:00Z,25061 +2021-04-23T10:00Z,24474 +2021-04-23T11:00Z,24257 +2021-04-23T12:00Z,24769 +2021-04-23T13:00Z,26160 +2021-04-23T14:00Z,27864 +2021-04-23T15:00Z,28735 +2021-04-23T16:00Z,29214 +2021-04-23T17:00Z,29295 +2021-04-23T18:00Z,28756 +2021-04-23T19:00Z,28141 +2021-04-23T20:00Z,27440 +2021-04-23T21:00Z,27434 +2021-04-23T22:00Z,27397 +2021-04-23T23:00Z,27325 +2021-04-24,27904 +2021-04-24T01:00Z,29122 +2021-04-24T02:00Z,29903 +2021-04-24T03:00Z,31200 +2021-04-24T04:00Z,31616 +2021-04-24T05:00Z,30644 +2021-04-24T06:00Z,29017 +2021-04-24T07:00Z,27251 +2021-04-24T08:00Z,25949 +2021-04-24T09:00Z,25023 +2021-04-24T10:00Z,24464 +2021-04-24T11:00Z,24184 +2021-04-24T12:00Z,24056 +2021-04-24T13:00Z,24432 +2021-04-24T14:00Z,24793 +2021-04-24T15:00Z,25151 +2021-04-24T16:00Z,26138 +2021-04-24T17:00Z,26694 +2021-04-24T18:00Z,25977 +2021-04-24T19:00Z,24803 +2021-04-24T20:00Z,23823 +2021-04-24T21:00Z,23134 +2021-04-24T22:00Z,23193 +2021-04-24T23:00Z,24221 +2021-04-25,25304 +2021-04-25T01:00Z,26463 +2021-04-25T02:00Z,27866 +2021-04-25T03:00Z,29241 +2021-04-25T04:00Z,29882 +2021-04-25T05:00Z,28963 +2021-04-25T06:00Z,27638 +2021-04-25T07:00Z,26160 +2021-04-25T08:00Z,24891 +2021-04-25T09:00Z,24162 +2021-04-25T10:00Z,23696 +2021-04-25T11:00Z,23088 +2021-04-25T12:00Z,23051 +2021-04-25T13:00Z,23306 +2021-04-25T14:00Z,23537 +2021-04-25T15:00Z,23444 +2021-04-25T16:00Z,23739 +2021-04-25T17:00Z,23974 +2021-04-25T18:00Z,23876 +2021-04-25T19:00Z,23477 +2021-04-25T20:00Z,23355 +2021-04-25T21:00Z,23336 +2021-04-25T22:00Z,23650 +2021-04-25T23:00Z,24600 +2021-04-26,24746 +2021-04-26T01:00Z,25924 +2021-04-26T02:00Z,27240 +2021-04-26T03:00Z,28777 +2021-04-26T04:00Z,29541 +2021-04-26T05:00Z,28723 +2021-04-26T06:00Z,27159 +2021-04-26T07:00Z,25472 +2021-04-26T08:00Z,24522 +2021-04-26T09:00Z,23837 +2021-04-26T10:00Z,23570 +2021-04-26T11:00Z,23514 +2021-04-26T12:00Z,23976 +2021-04-26T13:00Z,25501 +2021-04-26T14:00Z,27390 +2021-04-26T15:00Z,28650 +2021-04-26T16:00Z,28793 +2021-04-26T17:00Z,28612 +2021-04-26T18:00Z,28166 +2021-04-26T19:00Z,27570 +2021-04-26T20:00Z,27085 +2021-04-26T21:00Z,26251 +2021-04-26T22:00Z,25236 +2021-04-26T23:00Z,25385 +2021-04-27,25703 +2021-04-27T01:00Z,26832 +2021-04-27T02:00Z,28725 +2021-04-27T03:00Z,30788 +2021-04-27T04:00Z,31439 +2021-04-27T05:00Z,30396 +2021-04-27T06:00Z,28622 +2021-04-27T07:00Z,26806 +2021-04-27T08:00Z,26156 +2021-04-27T09:00Z,25401 +2021-04-27T10:00Z,24585 +2021-04-27T11:00Z,24327 +2021-04-27T12:00Z,24963 +2021-04-27T13:00Z,26200 +2021-04-27T14:00Z,27909 +2021-04-27T15:00Z,28560 +2021-04-27T16:00Z,28152 +2021-04-27T17:00Z,26925 +2021-04-27T18:00Z,25563 +2021-04-27T19:00Z,24754 +2021-04-27T20:00Z,24446 +2021-04-27T21:00Z,24443 +2021-04-27T22:00Z,24613 +2021-04-27T23:00Z,25106 +2021-04-28,26050 +2021-04-28T01:00Z,27554 +2021-04-28T02:00Z,29326 +2021-04-28T03:00Z,30960 +2021-04-28T04:00Z,31861 +2021-04-28T05:00Z,30838 +2021-04-28T06:00Z,28886 +2021-04-28T07:00Z,26988 +2021-04-28T08:00Z,25717 +2021-04-28T09:00Z,24856 +2021-04-28T10:00Z,24325 +2021-04-28T11:00Z,24235 +2021-04-28T12:00Z,24692 +2021-04-28T13:00Z,26094 +2021-04-28T14:00Z,27615 +2021-04-28T15:00Z,28350 +2021-04-28T16:00Z,28209 +2021-04-28T17:00Z,27763 +2021-04-28T18:00Z,27129 +2021-04-28T19:00Z,27021 +2021-04-28T20:00Z,26439 +2021-04-28T21:00Z,26816 +2021-04-28T22:00Z,27668 +2021-04-28T23:00Z,28124 +2021-04-29,29271 +2021-04-29T01:00Z,30894 +2021-04-29T02:00Z,32419 +2021-04-29T03:00Z,33385 +2021-04-29T04:00Z,33700 +2021-04-29T05:00Z,32255 +2021-04-29T06:00Z,30388 +2021-04-29T07:00Z,27912 +2021-04-29T08:00Z,26470 +2021-04-29T09:00Z,25370 +2021-04-29T10:00Z,24563 +2021-04-29T11:00Z,24630 +2021-04-29T12:00Z,24927 +2021-04-29T13:00Z,26026 +2021-04-29T14:00Z,27459 +2021-04-29T15:00Z,28317 +2021-04-29T16:00Z,28310 +2021-04-29T17:00Z,28131 +2021-04-29T18:00Z,27998 +2021-04-29T19:00Z,28289 +2021-04-29T20:00Z,29012 +2021-04-29T21:00Z,30090 +2021-04-29T22:00Z,31389 +2021-04-29T23:00Z,32437 +2021-04-30,33399 +2021-04-30T01:00Z,34941 +2021-04-30T02:00Z,36239 +2021-04-30T03:00Z,36454 +2021-04-30T04:00Z,36031 +2021-04-30T05:00Z,34395 +2021-04-30T06:00Z,31714 +2021-04-30T07:00Z,29268 +2021-04-30T08:00Z,27610 +2021-04-30T09:00Z,26552 +2021-04-30T10:00Z,25560 +2021-04-30T11:00Z,25198 +2021-04-30T12:00Z,25363 +2021-04-30T13:00Z,26260 +2021-04-30T14:00Z,27390 +2021-04-30T15:00Z,28711 +2021-04-30T16:00Z,29142 +2021-04-30T17:00Z,29081 +2021-04-30T18:00Z,30192 +2021-04-30T19:00Z,30112 +2021-04-30T20:00Z,30970 +2021-04-30T21:00Z,32485 +2021-04-30T22:00Z,34081 +2021-04-30T23:00Z,35076 +2021-05-01,35885 +2021-05-01T01:00Z,36628 +2021-05-01T02:00Z,36969 +2021-05-01T03:00Z,36490 +2021-05-01T04:00Z,35829 +2021-05-01T05:00Z,34123 +2021-05-01T06:00Z,31949 +2021-05-01T07:00Z,29387 +2021-05-01T08:00Z,27752 +2021-05-01T09:00Z,26285 +2021-05-01T10:00Z,25253 +2021-05-01T11:00Z,24653 +2021-05-01T12:00Z,24496 +2021-05-01T13:00Z,24807 +2021-05-01T14:00Z,24887 +2021-05-01T15:00Z,25159 +2021-05-01T16:00Z,25740 +2021-05-01T17:00Z,25179 +2021-05-01T18:00Z,25383 +2021-05-01T19:00Z,25127 +2021-05-01T20:00Z,25180 +2021-05-01T21:00Z,25412 +2021-05-01T22:00Z,26504 +2021-05-01T23:00Z,27248 +2021-05-02,28461 +2021-05-02T01:00Z,29393 +2021-05-02T02:00Z,30754 +2021-05-02T03:00Z,31345 +2021-05-02T04:00Z,31422 +2021-05-02T05:00Z,30319 +2021-05-02T06:00Z,28774 +2021-05-02T07:00Z,26951 +2021-05-02T08:00Z,25495 +2021-05-02T09:00Z,24515 +2021-05-02T10:00Z,23707 +2021-05-02T11:00Z,23219 +2021-05-02T12:00Z,23170 +2021-05-02T13:00Z,23389 +2021-05-02T14:00Z,23465 +2021-05-02T15:00Z,23292 +2021-05-02T16:00Z,23324 +2021-05-02T17:00Z,23154 +2021-05-02T18:00Z,23024 +2021-05-02T19:00Z,22848 +2021-05-02T20:00Z,22755 +2021-05-02T21:00Z,22816 +2021-05-02T22:00Z,23346 +2021-05-02T23:00Z,24317 +2021-05-03,25630 +2021-05-03T01:00Z,27256 +2021-05-03T02:00Z,28953 +2021-05-03T03:00Z,29952 +2021-05-03T04:00Z,30696 +2021-05-03T05:00Z,29899 +2021-05-03T06:00Z,28045 +2021-05-03T07:00Z,26101 +2021-05-03T08:00Z,24807 +2021-05-03T09:00Z,23918 +2021-05-03T10:00Z,23291 +2021-05-03T11:00Z,23129 +2021-05-03T12:00Z,23631 +2021-05-03T13:00Z,24942 +2021-05-03T14:00Z,26386 +2021-05-03T15:00Z,27580 +2021-05-03T16:00Z,28255 +2021-05-03T17:00Z,28077 +2021-05-03T18:00Z,27605 +2021-05-03T19:00Z,27627 +2021-05-03T20:00Z,27962 +2021-05-03T21:00Z,28415 +2021-05-03T22:00Z,29264 +2021-05-03T23:00Z,30165 +2021-05-04,31337 +2021-05-04T01:00Z,32924 +2021-05-04T02:00Z,34303 +2021-05-04T03:00Z,34765 +2021-05-04T04:00Z,34948 +2021-05-04T05:00Z,33569 +2021-05-04T06:00Z,31008 +2021-05-04T07:00Z,28612 +2021-05-04T08:00Z,27056 +2021-05-04T09:00Z,25863 +2021-05-04T10:00Z,25118 +2021-05-04T11:00Z,24752 +2021-05-04T12:00Z,24962 +2021-05-04T13:00Z,25990 +2021-05-04T14:00Z,27195 +2021-05-04T15:00Z,28244 +2021-05-04T16:00Z,28863 +2021-05-04T17:00Z,28930 +2021-05-04T18:00Z,29064 +2021-05-04T19:00Z,29070 +2021-05-04T20:00Z,29623 +2021-05-04T21:00Z,30527 +2021-05-04T22:00Z,31842 +2021-05-04T23:00Z,33518 +2021-05-05,34856 +2021-05-05T01:00Z,36544 +2021-05-05T02:00Z,37366 +2021-05-05T03:00Z,37419 +2021-05-05T04:00Z,36919 +2021-05-05T05:00Z,35049 +2021-05-05T06:00Z,32230 +2021-05-05T07:00Z,29557 +2021-05-05T08:00Z,27602 +2021-05-05T09:00Z,26261 +2021-05-05T10:00Z,25411 +2021-05-05T11:00Z,24845 +2021-05-05T12:00Z,25114 +2021-05-05T13:00Z,26262 +2021-05-05T14:00Z,27409 +2021-05-05T15:00Z,28420 +2021-05-05T16:00Z,29365 +2021-05-05T17:00Z,29679 +2021-05-05T18:00Z,29917 +2021-05-05T19:00Z,30287 +2021-05-05T20:00Z,31372 +2021-05-05T21:00Z,32371 +2021-05-05T22:00Z,33818 +2021-05-05T23:00Z,35422 +2021-05-06,36747 +2021-05-06T01:00Z,38156 +2021-05-06T02:00Z,38752 +2021-05-06T03:00Z,38234 +2021-05-06T04:00Z,37481 +2021-05-06T05:00Z,35374 +2021-05-06T06:00Z,32518 +2021-05-06T07:00Z,29782 +2021-05-06T08:00Z,28097 +2021-05-06T09:00Z,26853 +2021-05-06T10:00Z,25914 +2021-05-06T11:00Z,25382 +2021-05-06T12:00Z,25549 +2021-05-06T13:00Z,26589 +2021-05-06T14:00Z,27869 +2021-05-06T15:00Z,28849 +2021-05-06T16:00Z,29364 +2021-05-06T17:00Z,28942 +2021-05-06T18:00Z,28576 +2021-05-06T19:00Z,28727 +2021-05-06T20:00Z,28941 +2021-05-06T21:00Z,29802 +2021-05-06T22:00Z,30695 +2021-05-06T23:00Z,31381 +2021-05-07,32435 +2021-05-07T01:00Z,33594 +2021-05-07T02:00Z,34228 +2021-05-07T03:00Z,34358 +2021-05-07T04:00Z,34537 +2021-05-07T05:00Z,33167 +2021-05-07T06:00Z,31031 +2021-05-07T07:00Z,29048 +2021-05-07T08:00Z,27569 +2021-05-07T09:00Z,26351 +2021-05-07T10:00Z,25641 +2021-05-07T11:00Z,25363 +2021-05-07T12:00Z,25784 +2021-05-07T13:00Z,26937 +2021-05-07T14:00Z,28211 +2021-05-07T15:00Z,29101 +2021-05-07T16:00Z,29700 +2021-05-07T17:00Z,29142 +2021-05-07T18:00Z,28132 +2021-05-07T19:00Z,27537 +2021-05-07T20:00Z,27462 +2021-05-07T21:00Z,27812 +2021-05-07T22:00Z,28435 +2021-05-07T23:00Z,29220 +2021-05-08,30278 +2021-05-08T01:00Z,31294 +2021-05-08T02:00Z,32386 +2021-05-08T03:00Z,33172 +2021-05-08T04:00Z,33673 +2021-05-08T05:00Z,32500 +2021-05-08T06:00Z,30682 +2021-05-08T07:00Z,28782 +2021-05-08T08:00Z,27261 +2021-05-08T09:00Z,25960 +2021-05-08T10:00Z,25135 +2021-05-08T11:00Z,25056 +2021-05-08T12:00Z,24804 +2021-05-08T13:00Z,25198 +2021-05-08T14:00Z,25344 +2021-05-08T15:00Z,25736 +2021-05-08T16:00Z,25866 +2021-05-08T17:00Z,25314 +2021-05-08T18:00Z,24729 +2021-05-08T19:00Z,24161 +2021-05-08T20:00Z,23945 +2021-05-08T21:00Z,24405 +2021-05-08T22:00Z,25329 +2021-05-08T23:00Z,26757 +2021-05-09,28180 +2021-05-09T01:00Z,30112 +2021-05-09T02:00Z,31146 +2021-05-09T03:00Z,32105 +2021-05-09T04:00Z,32582 +2021-05-09T05:00Z,31711 +2021-05-09T06:00Z,29992 +2021-05-09T07:00Z,28116 +2021-05-09T08:00Z,26314 +2021-05-09T09:00Z,25168 +2021-05-09T10:00Z,24615 +2021-05-09T11:00Z,24044 +2021-05-09T12:00Z,23790 +2021-05-09T13:00Z,23859 +2021-05-09T14:00Z,23751 +2021-05-09T15:00Z,24331 +2021-05-09T16:00Z,24635 +2021-05-09T17:00Z,24363 +2021-05-09T18:00Z,23954 +2021-05-09T19:00Z,23452 +2021-05-09T20:00Z,22865 +2021-05-09T21:00Z,23362 +2021-05-09T22:00Z,24447 +2021-05-09T23:00Z,26096 +2021-05-10,27762 +2021-05-10T01:00Z,29216 +2021-05-10T02:00Z,30281 +2021-05-10T03:00Z,31068 +2021-05-10T04:00Z,31674 +2021-05-10T05:00Z,30937 +2021-05-10T06:00Z,28861 +2021-05-10T07:00Z,26979 +2021-05-10T08:00Z,25557 +2021-05-10T09:00Z,24559 +2021-05-10T10:00Z,24058 +2021-05-10T11:00Z,23753 +2021-05-10T12:00Z,24101 +2021-05-10T13:00Z,25417 +2021-05-10T14:00Z,26827 +2021-05-10T15:00Z,28217 +2021-05-10T16:00Z,29077 +2021-05-10T17:00Z,29223 +2021-05-10T18:00Z,29021 +2021-05-10T19:00Z,29082 +2021-05-10T20:00Z,29234 +2021-05-10T21:00Z,29595 +2021-05-10T22:00Z,30375 +2021-05-10T23:00Z,31456 +2021-05-11,32815 +2021-05-11T01:00Z,33878 +2021-05-11T02:00Z,34970 +2021-05-11T03:00Z,35529 +2021-05-11T04:00Z,35662 +2021-05-11T05:00Z,34225 +2021-05-11T06:00Z,31506 +2021-05-11T07:00Z,28992 +2021-05-11T08:00Z,27286 +2021-05-11T09:00Z,26097 +2021-05-11T10:00Z,25292 +2021-05-11T11:00Z,24840 +2021-05-11T12:00Z,25128 +2021-05-11T13:00Z,26227 +2021-05-11T14:00Z,27402 +2021-05-11T15:00Z,28711 +2021-05-11T16:00Z,29250 +2021-05-11T17:00Z,29037 +2021-05-11T18:00Z,28724 +2021-05-11T19:00Z,28450 +2021-05-11T20:00Z,28756 +2021-05-11T21:00Z,29849 +2021-05-11T22:00Z,31024 +2021-05-11T23:00Z,32534 +2021-05-12,34268 +2021-05-12T01:00Z,35880 +2021-05-12T02:00Z,36631 +2021-05-12T03:00Z,36582 +2021-05-12T04:00Z,36300 +2021-05-12T05:00Z,34615 +2021-05-12T06:00Z,32006 +2021-05-12T07:00Z,29382 +2021-05-12T08:00Z,27559 +2021-05-12T09:00Z,26295 +2021-05-12T10:00Z,25522 +2021-05-12T11:00Z,25207 +2021-05-12T12:00Z,25259 +2021-05-12T13:00Z,26288 +2021-05-12T14:00Z,27584 +2021-05-12T15:00Z,28794 +2021-05-12T16:00Z,29389 +2021-05-12T17:00Z,29138 +2021-05-12T18:00Z,29152 +2021-05-12T19:00Z,29564 +2021-05-12T20:00Z,30254 +2021-05-12T21:00Z,31079 +2021-05-12T22:00Z,32432 +2021-05-12T23:00Z,34133 +2021-05-13,35536 +2021-05-13T01:00Z,36745 +2021-05-13T02:00Z,37612 +2021-05-13T03:00Z,37634 +2021-05-13T04:00Z,37416 +2021-05-13T05:00Z,35395 +2021-05-13T06:00Z,32631 +2021-05-13T07:00Z,29948 +2021-05-13T08:00Z,28040 +2021-05-13T09:00Z,26755 +2021-05-13T10:00Z,25827 +2021-05-13T11:00Z,25320 +2021-05-13T12:00Z,25609 +2021-05-13T13:00Z,26709 +2021-05-13T14:00Z,28000 +2021-05-13T15:00Z,29110 +2021-05-13T16:00Z,30103 +2021-05-13T17:00Z,30370 +2021-05-13T18:00Z,29946 +2021-05-13T19:00Z,29918 +2021-05-13T20:00Z,30277 +2021-05-13T21:00Z,30681 +2021-05-13T22:00Z,31130 +2021-05-13T23:00Z,32408 +2021-05-14,33432 +2021-05-14T01:00Z,34794 +2021-05-14T02:00Z,35639 +2021-05-14T03:00Z,35780 +2021-05-14T04:00Z,35728 +2021-05-14T05:00Z,34270 +2021-05-14T06:00Z,31656 +2021-05-14T07:00Z,29098 +2021-05-14T08:00Z,27430 +2021-05-14T09:00Z,26299 +2021-05-14T10:00Z,25571 +2021-05-14T11:00Z,25178 +2021-05-14T12:00Z,25379 +2021-05-14T13:00Z,26456 +2021-05-14T14:00Z,27650 +2021-05-14T15:00Z,29066 +2021-05-14T16:00Z,30124 +2021-05-14T17:00Z,30120 +2021-05-14T18:00Z,29474 +2021-05-14T19:00Z,28916 +2021-05-14T20:00Z,28563 +2021-05-14T21:00Z,28986 +2021-05-14T22:00Z,29599 +2021-05-14T23:00Z,30525 +2021-05-15,31694 +2021-05-15T01:00Z,33696 +2021-05-15T02:00Z,33403 +2021-05-15T03:00Z,33608 +2021-05-15T04:00Z,33748 +2021-05-15T05:00Z,32542 +2021-05-15T06:00Z,30681 +2021-05-15T07:00Z,28634 +2021-05-15T08:00Z,27009 +2021-05-15T09:00Z,25715 +2021-05-15T10:00Z,24852 +2021-05-15T11:00Z,24603 +2021-05-15T12:00Z,24510 +2021-05-15T13:00Z,24855 +2021-05-15T14:00Z,25332 +2021-05-15T15:00Z,26167 +2021-05-15T16:00Z,26506 +2021-05-15T17:00Z,26690 +2021-05-15T18:00Z,26300 +2021-05-15T19:00Z,25359 +2021-05-15T20:00Z,24400 +2021-05-15T21:00Z,24042 +2021-05-15T22:00Z,24595 +2021-05-15T23:00Z,25650 +2021-05-16,26658 +2021-05-16T01:00Z,27760 +2021-05-16T02:00Z,28624 +2021-05-16T03:00Z,29631 +2021-05-16T04:00Z,30422 +2021-05-16T05:00Z,29701 +2021-05-16T06:00Z,28216 +2021-05-16T07:00Z,26513 +2021-05-16T08:00Z,25314 +2021-05-16T09:00Z,24411 +2021-05-16T10:00Z,23685 +2021-05-16T11:00Z,23236 +2021-05-16T12:00Z,23123 +2021-05-16T13:00Z,23223 +2021-05-16T14:00Z,23056 +2021-05-16T15:00Z,23084 +2021-05-16T16:00Z,23419 +2021-05-16T17:00Z,23893 +2021-05-16T18:00Z,23879 +2021-05-16T19:00Z,23753 +2021-05-16T20:00Z,23724 +2021-05-16T21:00Z,23738 +2021-05-16T22:00Z,23821 +2021-05-16T23:00Z,24626 +2021-05-17,25941 +2021-05-17T01:00Z,27106 +2021-05-17T02:00Z,28236 +2021-05-17T03:00Z,29548 +2021-05-17T04:00Z,30264 +2021-05-17T05:00Z,29564 +2021-05-17T06:00Z,27750 +2021-05-17T07:00Z,26005 +2021-05-17T08:00Z,24922 +2021-05-17T09:00Z,24539 +2021-05-17T10:00Z,24323 +2021-05-17T11:00Z,24169 +2021-05-17T12:00Z,24697 +2021-05-17T13:00Z,26079 +2021-05-17T14:00Z,27629 +2021-05-17T15:00Z,29058 +2021-05-17T16:00Z,29922 +2021-05-17T17:00Z,29827 +2021-05-17T18:00Z,29684 +2021-05-17T19:00Z,29445 +2021-05-17T20:00Z,29282 +2021-05-17T21:00Z,29309 +2021-05-17T22:00Z,29623 +2021-05-17T23:00Z,30179 +2021-05-18,30880 +2021-05-18T01:00Z,31209 +2021-05-18T02:00Z,31989 +2021-05-18T03:00Z,32844 +2021-05-18T04:00Z,33465 +2021-05-18T05:00Z,32477 +2021-05-18T06:00Z,30386 +2021-05-18T07:00Z,28217 +2021-05-18T08:00Z,27097 +2021-05-18T09:00Z,26168 +2021-05-18T10:00Z,25479 +2021-05-18T11:00Z,25492 +2021-05-18T12:00Z,25551 +2021-05-18T13:00Z,26789 +2021-05-18T14:00Z,28061 +2021-05-18T15:00Z,29310 +2021-05-18T16:00Z,29866 +2021-05-18T17:00Z,29684 +2021-05-18T18:00Z,29339 +2021-05-18T19:00Z,28727 +2021-05-18T20:00Z,28691 +2021-05-18T21:00Z,28947 +2021-05-18T22:00Z,29641 +2021-05-18T23:00Z,30351 +2021-05-19,31693 +2021-05-19T01:00Z,32787 +2021-05-19T02:00Z,33908 +2021-05-19T03:00Z,34264 +2021-05-19T04:00Z,34761 +2021-05-19T05:00Z,33575 +2021-05-19T06:00Z,31221 +2021-05-19T07:00Z,28882 +2021-05-19T08:00Z,27255 +2021-05-19T09:00Z,26052 +2021-05-19T10:00Z,25345 +2021-05-19T11:00Z,25055 +2021-05-19T12:00Z,25436 +2021-05-19T13:00Z,26469 +2021-05-19T14:00Z,27533 +2021-05-19T15:00Z,28421 +2021-05-19T16:00Z,29171 +2021-05-19T17:00Z,29292 +2021-05-19T18:00Z,28654 +2021-05-19T19:00Z,27966 +2021-05-19T20:00Z,27867 +2021-05-19T21:00Z,28034 +2021-05-19T22:00Z,28718 +2021-05-19T23:00Z,29487 +2021-05-20,30486 +2021-05-20T01:00Z,31524 +2021-05-20T02:00Z,32562 +2021-05-20T03:00Z,33298 +2021-05-20T04:00Z,33917 +2021-05-20T05:00Z,32876 +2021-05-20T06:00Z,30707 +2021-05-20T07:00Z,28493 +2021-05-20T08:00Z,26922 +2021-05-20T09:00Z,25949 +2021-05-20T10:00Z,25202 +2021-05-20T11:00Z,24889 +2021-05-20T12:00Z,25204 +2021-05-20T13:00Z,26361 +2021-05-20T14:00Z,27569 +2021-05-20T15:00Z,28848 +2021-05-20T16:00Z,29133 +2021-05-20T17:00Z,28670 +2021-05-20T18:00Z,27940 +2021-05-20T19:00Z,27290 +2021-05-20T20:00Z,27068 +2021-05-20T21:00Z,27384 +2021-05-20T22:00Z,27783 +2021-05-20T23:00Z,27988 +2021-05-21,28429 +2021-05-21T01:00Z,29252 +2021-05-21T02:00Z,30230 +2021-05-21T03:00Z,31331 +2021-05-21T04:00Z,32439 +2021-05-21T05:00Z,31704 +2021-05-21T06:00Z,29590 +2021-05-21T07:00Z,27530 +2021-05-21T08:00Z,26130 +2021-05-21T09:00Z,26068 +2021-05-21T10:00Z,24830 +2021-05-21T11:00Z,24603 +2021-05-21T12:00Z,25018 +2021-05-21T13:00Z,26151 +2021-05-21T14:00Z,27466 +2021-05-21T15:00Z,28085 +2021-05-21T16:00Z,28435 +2021-05-21T17:00Z,27948 +2021-05-21T18:00Z,27267 +2021-05-21T19:00Z,26724 +2021-05-21T20:00Z,26336 +2021-05-21T21:00Z,26300 +2021-05-21T22:00Z,26411 +2021-05-21T23:00Z,26923 +2021-05-22,27609 +2021-05-22T01:00Z,28495 +2021-05-22T02:00Z,29625 +2021-05-22T03:00Z,30803 +2021-05-22T04:00Z,31712 +2021-05-22T05:00Z,31204 +2021-05-22T06:00Z,29543 +2021-05-22T07:00Z,27715 +2021-05-22T08:00Z,26447 +2021-05-22T09:00Z,25365 +2021-05-22T10:00Z,24625 +2021-05-22T11:00Z,24240 +2021-05-22T12:00Z,24298 +2021-05-22T13:00Z,24687 +2021-05-22T14:00Z,24790 +2021-05-22T15:00Z,25385 +2021-05-22T16:00Z,25446 +2021-05-22T17:00Z,25115 +2021-05-22T18:00Z,24031 +2021-05-22T19:00Z,22969 +2021-05-22T20:00Z,22511 +2021-05-22T21:00Z,22366 +2021-05-22T22:00Z,22913 +2021-05-22T23:00Z,23151 +2021-05-23,24260 +2021-05-23T01:00Z,25961 +2021-05-23T02:00Z,27844 +2021-05-23T03:00Z,29055 +2021-05-23T04:00Z,30270 +2021-05-23T05:00Z,29845 +2021-05-23T06:00Z,28354 +2021-05-23T07:00Z,26769 +2021-05-23T08:00Z,25530 +2021-05-23T09:00Z,24586 +2021-05-23T10:00Z,23991 +2021-05-23T11:00Z,23596 +2021-05-23T12:00Z,23566 +2021-05-23T13:00Z,23628 +2021-05-23T14:00Z,23114 +2021-05-23T15:00Z,22822 +2021-05-23T16:00Z,22892 +2021-05-23T17:00Z,22310 +2021-05-23T18:00Z,21810 +2021-05-23T19:00Z,21475 +2021-05-23T20:00Z,21575 +2021-05-23T21:00Z,21764 +2021-05-23T22:00Z,22168 +2021-05-23T23:00Z,23077 +2021-05-24,24808 +2021-05-24T01:00Z,26890 +2021-05-24T02:00Z,28832 +2021-05-24T03:00Z,30067 +2021-05-24T04:00Z,31093 +2021-05-24T05:00Z,30610 +2021-05-24T06:00Z,28718 +2021-05-24T07:00Z,26735 +2021-05-24T08:00Z,25408 +2021-05-24T09:00Z,24465 +2021-05-24T10:00Z,23835 +2021-05-24T11:00Z,23668 +2021-05-24T12:00Z,24177 +2021-05-24T13:00Z,25373 +2021-05-24T14:00Z,26538 +2021-05-24T15:00Z,27662 +2021-05-24T16:00Z,28049 +2021-05-24T17:00Z,27756 +2021-05-24T18:00Z,28071 +2021-05-24T19:00Z,28492 +2021-05-24T20:00Z,28848 +2021-05-24T21:00Z,29687 +2021-05-24T22:00Z,30352 +2021-05-24T23:00Z,31700 +2021-05-25,33486 +2021-05-25T01:00Z,35502 +2021-05-25T02:00Z,36490 +2021-05-25T03:00Z,36610 +2021-05-25T04:00Z,36372 +2021-05-25T05:00Z,34996 +2021-05-25T06:00Z,32287 +2021-05-25T07:00Z,29897 +2021-05-25T08:00Z,28001 +2021-05-25T09:00Z,26717 +2021-05-25T10:00Z,25987 +2021-05-25T11:00Z,25507 +2021-05-25T12:00Z,25734 +2021-05-25T13:00Z,26673 +2021-05-25T14:00Z,27692 +2021-05-25T15:00Z,28803 +2021-05-25T16:00Z,29047 +2021-05-25T17:00Z,29209 +2021-05-25T18:00Z,29706 +2021-05-25T19:00Z,30409 +2021-05-25T20:00Z,33213 +2021-05-25T21:00Z,31825 +2021-05-25T22:00Z,32932 +2021-05-25T23:00Z,34119 +2021-05-26,35467 +2021-05-26T01:00Z,36470 +2021-05-26T02:00Z,36827 +2021-05-26T03:00Z,36769 +2021-05-26T04:00Z,36892 +2021-05-26T05:00Z,35551 +2021-05-26T06:00Z,32874 +2021-05-26T07:00Z,30403 +2021-05-26T08:00Z,28605 +2021-05-26T09:00Z,27350 +2021-05-26T10:00Z,26741 +2021-05-26T11:00Z,26366 +2021-05-26T12:00Z,26572 +2021-05-26T13:00Z,27259 +2021-05-26T14:00Z,28296 +2021-05-26T15:00Z,29280 +2021-05-26T16:00Z,29868 +2021-05-26T17:00Z,29811 +2021-05-26T18:00Z,29627 +2021-05-26T19:00Z,30086 +2021-05-26T20:00Z,30434 +2021-05-26T21:00Z,31160 +2021-05-26T22:00Z,31775 +2021-05-26T23:00Z,33176 +2021-05-27,34418 +2021-05-27T01:00Z,35683 +2021-05-27T02:00Z,36567 +2021-05-27T03:00Z,36533 +2021-05-27T04:00Z,36175 +2021-05-27T05:00Z,34868 +2021-05-27T06:00Z,32245 +2021-05-27T07:00Z,29893 +2021-05-27T08:00Z,28091 +2021-05-27T09:00Z,26778 +2021-05-27T10:00Z,25973 +2021-05-27T11:00Z,25939 +2021-05-27T12:00Z,26517 +2021-05-27T13:00Z,27139 +2021-05-27T14:00Z,28171 +2021-05-27T15:00Z,29772 +2021-05-27T16:00Z,30225 +2021-05-27T17:00Z,29393 +2021-05-27T18:00Z,28808 +2021-05-27T19:00Z,28769 +2021-05-27T20:00Z,29267 +2021-05-27T21:00Z,30241 +2021-05-27T22:00Z,31089 +2021-05-27T23:00Z,32297 +2021-05-28,33865 +2021-05-28T01:00Z,35235 +2021-05-28T02:00Z,35661 +2021-05-28T03:00Z,35798 +2021-05-28T04:00Z,35982 +2021-05-28T05:00Z,34970 +2021-05-28T06:00Z,32550 +2021-05-28T07:00Z,30323 +2021-05-28T08:00Z,28516 +2021-05-28T09:00Z,27201 +2021-05-28T10:00Z,26567 +2021-05-28T11:00Z,26273 +2021-05-28T12:00Z,26427 +2021-05-28T13:00Z,27302 +2021-05-28T14:00Z,28597 +2021-05-28T15:00Z,29911 +2021-05-28T16:00Z,30162 +2021-05-28T17:00Z,30091 +2021-05-28T18:00Z,29852 +2021-05-28T19:00Z,30049 +2021-05-28T20:00Z,30127 +2021-05-28T21:00Z,31071 +2021-05-28T22:00Z,31930 +2021-05-28T23:00Z,33235 +2021-05-29,34515 +2021-05-29T01:00Z,35890 +2021-05-29T02:00Z,36212 +2021-05-29T03:00Z,35896 +2021-05-29T04:00Z,35779 +2021-05-29T05:00Z,34707 +2021-05-29T06:00Z,32563 +2021-05-29T07:00Z,30229 +2021-05-29T08:00Z,28460 +2021-05-29T09:00Z,27291 +2021-05-29T10:00Z,26241 +2021-05-29T11:00Z,25576 +2021-05-29T12:00Z,25398 +2021-05-29T13:00Z,25560 +2021-05-29T14:00Z,25689 +2021-05-29T15:00Z,26215 +2021-05-29T16:00Z,26734 +2021-05-29T17:00Z,26751 +2021-05-29T18:00Z,26388 +2021-05-29T19:00Z,25798 +2021-05-29T20:00Z,25639 +2021-05-29T21:00Z,25757 +2021-05-29T22:00Z,26498 +2021-05-29T23:00Z,27892 +2021-05-30,29583 +2021-05-30T01:00Z,31048 +2021-05-30T02:00Z,31987 +2021-05-30T03:00Z,32418 +2021-05-30T04:00Z,32758 +2021-05-30T05:00Z,32153 +2021-05-30T06:00Z,30390 +2021-05-30T07:00Z,28406 +2021-05-30T08:00Z,26860 +2021-05-30T09:00Z,25628 +2021-05-30T10:00Z,24792 +2021-05-30T11:00Z,24267 +2021-05-30T12:00Z,24078 +2021-05-30T13:00Z,24107 +2021-05-30T14:00Z,24075 +2021-05-30T15:00Z,24445 +2021-05-30T16:00Z,24702 +2021-05-30T17:00Z,24508 +2021-05-30T18:00Z,24089 +2021-05-30T19:00Z,23892 +2021-05-30T20:00Z,24085 +2021-05-30T21:00Z,25005 +2021-05-30T22:00Z,26337 +2021-05-30T23:00Z,28282 +2021-05-31,30142 +2021-05-31T01:00Z,32312 +2021-05-31T02:00Z,33866 +2021-05-31T03:00Z,34331 +2021-05-31T04:00Z,34254 +2021-05-31T05:00Z,33318 +2021-05-31T06:00Z,31302 +2021-05-31T07:00Z,29104 +2021-05-31T08:00Z,27551 +2021-05-31T09:00Z,26114 +2021-05-31T10:00Z,25334 +2021-05-31T11:00Z,24792 +2021-05-31T12:00Z,24659 +2021-05-31T13:00Z,24919 +2021-05-31T14:00Z,25163 +2021-05-31T15:00Z,26478 +2021-05-31T16:00Z,27402 +2021-05-31T17:00Z,27570 +2021-05-31T18:00Z,27855 +2021-05-31T19:00Z,28637 +2021-05-31T20:00Z,29434 +2021-05-31T21:00Z,30981 +2021-05-31T22:00Z,32616 +2021-05-31T23:00Z,34791 +2021-06-01,36725 +2021-06-01T01:00Z,38453 +2021-06-01T02:00Z,39500 +2021-06-01T03:00Z,39375 +2021-06-01T04:00Z,38809 +2021-06-01T05:00Z,37149 +2021-06-01T06:00Z,34216 +2021-06-01T07:00Z,31225 +2021-06-01T08:00Z,29367 +2021-06-01T09:00Z,27829 +2021-06-01T10:00Z,26798 +2021-06-01T11:00Z,26340 +2021-06-01T12:00Z,26323 +2021-06-01T13:00Z,27194 +2021-06-01T14:00Z,28333 +2021-06-01T15:00Z,29832 +2021-06-01T16:00Z,30869 +2021-06-01T17:00Z,31465 +2021-06-01T18:00Z,32492 +2021-06-01T19:00Z,33637 +2021-06-01T20:00Z,34783 +2021-06-01T21:00Z,36512 +2021-06-01T22:00Z,38531 +2021-06-01T23:00Z,40336 +2021-06-02,41478 +2021-06-02T01:00Z,42088 +2021-06-02T02:00Z,42116 +2021-06-02T03:00Z,41270 +2021-06-02T04:00Z,40462 +2021-06-02T05:00Z,38540 +2021-06-02T06:00Z,35527 +2021-06-02T07:00Z,32490 +2021-06-02T08:00Z,30230 +2021-06-02T09:00Z,28761 +2021-06-02T10:00Z,27832 +2021-06-02T11:00Z,27223 +2021-06-02T12:00Z,27141 +2021-06-02T13:00Z,27975 +2021-06-02T14:00Z,29016 +2021-06-02T15:00Z,30223 +2021-06-02T16:00Z,31527 +2021-06-02T17:00Z,31766 +2021-06-02T18:00Z,32053 +2021-06-02T19:00Z,32861 +2021-06-02T20:00Z,33924 +2021-06-02T21:00Z,35618 +2021-06-02T22:00Z,37399 +2021-06-02T23:00Z,38955 +2021-06-03,40402 +2021-06-03T01:00Z,41386 +2021-06-03T02:00Z,41802 +2021-06-03T03:00Z,41007 +2021-06-03T04:00Z,40012 +2021-06-03T05:00Z,38279 +2021-06-03T06:00Z,35201 +2021-06-03T07:00Z,32340 +2021-06-03T08:00Z,30569 +2021-06-03T09:00Z,28953 +2021-06-03T10:00Z,27744 +2021-06-03T11:00Z,27043 +2021-06-03T12:00Z,27219 +2021-06-03T13:00Z,28131 +2021-06-03T14:00Z,29235 +2021-06-03T15:00Z,30875 +2021-06-03T16:00Z,31730 +2021-06-03T17:00Z,32083 +2021-06-03T18:00Z,32607 +2021-06-03T19:00Z,33315 +2021-06-03T20:00Z,34044 +2021-06-03T21:00Z,35634 +2021-06-03T22:00Z,37535 +2021-06-03T23:00Z,39913 +2021-06-04,41168 +2021-06-04T01:00Z,42274 +2021-06-04T02:00Z,42707 +2021-06-04T03:00Z,41974 +2021-06-04T04:00Z,40881 +2021-06-04T05:00Z,39139 +2021-06-04T06:00Z,36275 +2021-06-04T07:00Z,33574 +2021-06-04T08:00Z,31641 +2021-06-04T09:00Z,30010 +2021-06-04T10:00Z,28380 +2021-06-04T11:00Z,27532 +2021-06-04T12:00Z,27563 +2021-06-04T13:00Z,28272 +2021-06-04T14:00Z,29484 +2021-06-04T15:00Z,31079 +2021-06-04T16:00Z,31723 +2021-06-04T17:00Z,32630 +2021-06-04T18:00Z,33031 +2021-06-04T19:00Z,33760 +2021-06-04T20:00Z,34602 +2021-06-04T21:00Z,36088 +2021-06-04T22:00Z,37168 +2021-06-04T23:00Z,38435 +2021-06-05,39754 +2021-06-05T01:00Z,40808 +2021-06-05T02:00Z,41240 +2021-06-05T03:00Z,40487 +2021-06-05T04:00Z,39396 +2021-06-05T05:00Z,37909 +2021-06-05T06:00Z,35201 +2021-06-05T07:00Z,32565 +2021-06-05T08:00Z,30580 +2021-06-05T09:00Z,29061 +2021-06-05T10:00Z,27872 +2021-06-05T11:00Z,27158 +2021-06-05T12:00Z,26784 +2021-06-05T13:00Z,26847 +2021-06-05T14:00Z,27183 +2021-06-05T15:00Z,27603 +2021-06-05T16:00Z,27846 +2021-06-05T17:00Z,27876 +2021-06-05T18:00Z,28115 +2021-06-05T19:00Z,28814 +2021-06-05T20:00Z,29529 +2021-06-05T21:00Z,30610 +2021-06-05T22:00Z,32012 +2021-06-05T23:00Z,33569 +2021-06-06,35370 +2021-06-06T01:00Z,36938 +2021-06-06T02:00Z,37974 +2021-06-06T03:00Z,37813 +2021-06-06T04:00Z,37224 +2021-06-06T05:00Z,36037 +2021-06-06T06:00Z,33722 +2021-06-06T07:00Z,31300 +2021-06-06T08:00Z,29366 +2021-06-06T09:00Z,27741 +2021-06-06T10:00Z,26737 +2021-06-06T11:00Z,25966 +2021-06-06T12:00Z,25475 +2021-06-06T13:00Z,25435 +2021-06-06T14:00Z,25415 +2021-06-06T15:00Z,25814 +2021-06-06T16:00Z,26378 +2021-06-06T17:00Z,26150 +2021-06-06T18:00Z,25964 +2021-06-06T19:00Z,26206 +2021-06-06T20:00Z,26443 +2021-06-06T21:00Z,27585 +2021-06-06T22:00Z,28929 +2021-06-06T23:00Z,30233 +2021-06-07,31862 +2021-06-07T01:00Z,33911 +2021-06-07T02:00Z,34979 +2021-06-07T03:00Z,35138 +2021-06-07T04:00Z,34825 +2021-06-07T05:00Z,33918 +2021-06-07T06:00Z,31726 +2021-06-07T07:00Z,29412 +2021-06-07T08:00Z,27564 +2021-06-07T09:00Z,26512 +2021-06-07T10:00Z,25914 +2021-06-07T11:00Z,25579 +2021-06-07T12:00Z,25844 +2021-06-07T13:00Z,26979 +2021-06-07T14:00Z,28234 +2021-06-07T15:00Z,29724 +2021-06-07T16:00Z,31036 +2021-06-07T17:00Z,31251 +2021-06-07T18:00Z,31573 +2021-06-07T19:00Z,31601 +2021-06-07T20:00Z,31622 +2021-06-07T21:00Z,30814 +2021-06-07T22:00Z,30477 +2021-06-07T23:00Z,30858 +2021-06-08,31465 +2021-06-08T01:00Z,32398 +2021-06-08T02:00Z,33157 +2021-06-08T03:00Z,33379 +2021-06-08T04:00Z,33878 +2021-06-08T05:00Z,33314 +2021-06-08T06:00Z,31231 +2021-06-08T07:00Z,29257 +2021-06-08T08:00Z,27908 +2021-06-08T09:00Z,26867 +2021-06-08T10:00Z,26141 +2021-06-08T11:00Z,25810 +2021-06-08T12:00Z,25880 +2021-06-08T13:00Z,26792 +2021-06-08T14:00Z,27780 +2021-06-08T15:00Z,28767 +2021-06-08T16:00Z,29531 +2021-06-08T17:00Z,29543 +2021-06-08T18:00Z,28927 +2021-06-08T19:00Z,28273 +2021-06-08T20:00Z,28365 +2021-06-08T21:00Z,28456 +2021-06-08T22:00Z,29084 +2021-06-08T23:00Z,29878 +2021-06-09,30635 +2021-06-09T01:00Z,31540 +2021-06-09T02:00Z,32809 +2021-06-09T03:00Z,33475 +2021-06-09T04:00Z,34122 +2021-06-09T05:00Z,33511 +2021-06-09T06:00Z,31638 +2021-06-09T07:00Z,29371 +2021-06-09T08:00Z,27824 +2021-06-09T09:00Z,26740 +2021-06-09T10:00Z,25953 +2021-06-09T11:00Z,25505 +2021-06-09T12:00Z,25618 +2021-06-09T13:00Z,26559 +2021-06-09T14:00Z,27354 +2021-06-09T15:00Z,28572 +2021-06-09T16:00Z,28905 +2021-06-09T17:00Z,29199 +2021-06-09T18:00Z,28881 +2021-06-09T19:00Z,28668 +2021-06-09T20:00Z,28595 +2021-06-09T21:00Z,28908 +2021-06-09T22:00Z,28994 +2021-06-09T23:00Z,29561 +2021-06-10,30269 +2021-06-10T01:00Z,31303 +2021-06-10T02:00Z,32308 +2021-06-10T03:00Z,32827 +2021-06-10T04:00Z,33479 +2021-06-10T05:00Z,33096 +2021-06-10T06:00Z,31235 +2021-06-10T07:00Z,29246 +2021-06-10T08:00Z,27575 +2021-06-10T09:00Z,26375 +2021-06-10T10:00Z,25603 +2021-06-10T11:00Z,25498 +2021-06-10T12:00Z,25508 +2021-06-10T13:00Z,26435 +2021-06-10T14:00Z,27475 +2021-06-10T15:00Z,28493 +2021-06-10T16:00Z,28438 +2021-06-10T17:00Z,27972 +2021-06-10T18:00Z,27654 +2021-06-10T19:00Z,27279 +2021-06-10T20:00Z,27434 +2021-06-10T21:00Z,27786 +2021-06-10T22:00Z,28623 +2021-06-10T23:00Z,29415 +2021-06-11,30174 +2021-06-11T01:00Z,31354 +2021-06-11T02:00Z,32530 +2021-06-11T03:00Z,33371 +2021-06-11T04:00Z,33971 +2021-06-11T05:00Z,33620 +2021-06-11T06:00Z,31729 +2021-06-11T07:00Z,29568 +2021-06-11T08:00Z,27865 +2021-06-11T09:00Z,26760 +2021-06-11T10:00Z,25901 +2021-06-11T11:00Z,25430 +2021-06-11T12:00Z,25564 +2021-06-11T13:00Z,26457 +2021-06-11T14:00Z,27347 +2021-06-11T15:00Z,28457 +2021-06-11T16:00Z,28418 +2021-06-11T17:00Z,28378 +2021-06-11T18:00Z,28031 +2021-06-11T19:00Z,28354 +2021-06-11T20:00Z,28640 +2021-06-11T21:00Z,29106 +2021-06-11T22:00Z,30059 +2021-06-11T23:00Z,31172 +2021-06-12,32707 +2021-06-12T01:00Z,34276 +2021-06-12T02:00Z,35364 +2021-06-12T03:00Z,35514 +2021-06-12T04:00Z,35442 +2021-06-12T05:00Z,34788 +2021-06-12T06:00Z,32809 +2021-06-12T07:00Z,30628 +2021-06-12T08:00Z,28765 +2021-06-12T09:00Z,27324 +2021-06-12T10:00Z,26296 +2021-06-12T11:00Z,25651 +2021-06-12T12:00Z,25503 +2021-06-12T13:00Z,25633 +2021-06-12T14:00Z,25741 +2021-06-12T15:00Z,26423 +2021-06-12T16:00Z,26832 +2021-06-12T17:00Z,27046 +2021-06-12T18:00Z,27619 +2021-06-12T19:00Z,28276 +2021-06-12T20:00Z,28576 +2021-06-12T21:00Z,29888 +2021-06-12T22:00Z,31672 +2021-06-12T23:00Z,33778 +2021-06-13,35730 +2021-06-13T01:00Z,37502 +2021-06-13T02:00Z,38775 +2021-06-13T03:00Z,38581 +2021-06-13T04:00Z,37786 +2021-06-13T05:00Z,36586 +2021-06-13T06:00Z,34043 +2021-06-13T07:00Z,31626 +2021-06-13T08:00Z,29499 +2021-06-13T09:00Z,27869 +2021-06-13T10:00Z,26674 +2021-06-13T11:00Z,25833 +2021-06-13T12:00Z,25464 +2021-06-13T13:00Z,25273 +2021-06-13T14:00Z,24959 +2021-06-13T15:00Z,25197 +2021-06-13T16:00Z,25739 +2021-06-13T17:00Z,26266 +2021-06-13T18:00Z,26928 +2021-06-13T19:00Z,27428 +2021-06-13T20:00Z,28268 +2021-06-13T21:00Z,30053 +2021-06-13T22:00Z,31808 +2021-06-13T23:00Z,34207 +2021-06-14,36345 +2021-06-14T01:00Z,38443 +2021-06-14T02:00Z,39953 +2021-06-14T03:00Z,39649 +2021-06-14T04:00Z,38649 +2021-06-14T05:00Z,37428 +2021-06-14T06:00Z,34679 +2021-06-14T07:00Z,31811 +2021-06-14T08:00Z,29607 +2021-06-14T09:00Z,28019 +2021-06-14T10:00Z,27031 +2021-06-14T11:00Z,26848 +2021-06-14T12:00Z,27158 +2021-06-14T13:00Z,27760 +2021-06-14T14:00Z,28961 +2021-06-14T15:00Z,31126 +2021-06-14T16:00Z,32484 +2021-06-14T17:00Z,33192 +2021-06-14T18:00Z,34019 +2021-06-14T19:00Z,35039 +2021-06-14T20:00Z,36447 +2021-06-14T21:00Z,37779 +2021-06-14T22:00Z,39807 +2021-06-14T23:00Z,41577 +2021-06-15,43150 +2021-06-15T01:00Z,44272 +2021-06-15T02:00Z,44800 +2021-06-15T03:00Z,43820 +2021-06-15T04:00Z,42568 +2021-06-15T05:00Z,40833 +2021-06-15T06:00Z,37499 +2021-06-15T07:00Z,34178 +2021-06-15T08:00Z,31985 +2021-06-15T09:00Z,30132 +2021-06-15T10:00Z,29031 +2021-06-15T11:00Z,28531 +2021-06-15T12:00Z,28391 +2021-06-15T13:00Z,29347 +2021-06-15T14:00Z,29997 +2021-06-15T15:00Z,31422 +2021-06-15T16:00Z,32628 +2021-06-15T17:00Z,33587 +2021-06-15T18:00Z,34884 +2021-06-15T19:00Z,36464 +2021-06-15T20:00Z,38521 +2021-06-15T21:00Z,40729 +2021-06-15T22:00Z,42587 +2021-06-15T23:00Z,44502 +2021-06-16,46305 +2021-06-16T01:00Z,47676 +2021-06-16T02:00Z,48383 +2021-06-16T03:00Z,47471 +2021-06-16T04:00Z,46265 +2021-06-16T05:00Z,44072 +2021-06-16T06:00Z,40381 +2021-06-16T07:00Z,36686 +2021-06-16T08:00Z,33822 +2021-06-16T09:00Z,31664 +2021-06-16T10:00Z,30194 +2021-06-16T11:00Z,29310 +2021-06-16T12:00Z,29149 +2021-06-16T13:00Z,30049 +2021-06-16T14:00Z,31122 +2021-06-16T15:00Z,33019 +2021-06-16T16:00Z,34763 +2021-06-16T17:00Z,35750 +2021-06-16T18:00Z,37186 +2021-06-16T19:00Z,38918 +2021-06-16T20:00Z,41124 +2021-06-16T21:00Z,43044 +2021-06-16T22:00Z,45073 +2021-06-16T23:00Z,47021 +2021-06-17,48310 +2021-06-17T01:00Z,48760 +2021-06-17T02:00Z,48498 +2021-06-17T03:00Z,46940 +2021-06-17T04:00Z,45566 +2021-06-17T05:00Z,43548 +2021-06-17T06:00Z,40131 +2021-06-17T07:00Z,36639 +2021-06-17T08:00Z,33855 +2021-06-17T09:00Z,31771 +2021-06-17T10:00Z,30511 +2021-06-17T11:00Z,29974 +2021-06-17T12:00Z,29531 +2021-06-17T13:00Z,30345 +2021-06-17T14:00Z,31747 +2021-06-17T15:00Z,33926 +2021-06-17T16:00Z,35470 +2021-06-17T17:00Z,36566 +2021-06-17T18:00Z,38270 +2021-06-17T19:00Z,40415 +2021-06-17T20:00Z,42545 +2021-06-17T21:00Z,45162 +2021-06-17T22:00Z,47617 +2021-06-17T23:00Z,49843 +2021-06-18,51401 +2021-06-18T01:00Z,51602 +2021-06-18T02:00Z,51444 +2021-06-18T03:00Z,50014 +2021-06-18T04:00Z,48091 +2021-06-18T05:00Z,46161 +2021-06-18T06:00Z,42606 +2021-06-18T07:00Z,39115 +2021-06-18T08:00Z,36341 +2021-06-18T09:00Z,33873 +2021-06-18T10:00Z,32503 +2021-06-18T11:00Z,31842 +2021-06-18T12:00Z,31080 +2021-06-18T13:00Z,31620 +2021-06-18T14:00Z,32460 +2021-06-18T15:00Z,34062 +2021-06-18T16:00Z,35824 +2021-06-18T17:00Z,37162 +2021-06-18T18:00Z,38488 +2021-06-18T19:00Z,40602 +2021-06-18T20:00Z,42815 +2021-06-18T21:00Z,45047 +2021-06-18T22:00Z,47287 +2021-06-18T23:00Z,49088 +2021-06-19,50438 +2021-06-19T01:00Z,50861 +2021-06-19T02:00Z,50164 +2021-06-19T03:00Z,48664 +2021-06-19T04:00Z,46685 +2021-06-19T05:00Z,44579 +2021-06-19T06:00Z,41562 +2021-06-19T07:00Z,38301 +2021-06-19T08:00Z,35359 +2021-06-19T09:00Z,32898 +2021-06-19T10:00Z,31385 +2021-06-19T11:00Z,30108 +2021-06-19T12:00Z,29568 +2021-06-19T13:00Z,29361 +2021-06-19T14:00Z,29422 +2021-06-19T15:00Z,30660 +2021-06-19T16:00Z,31741 +2021-06-19T17:00Z,32682 +2021-06-19T18:00Z,33937 +2021-06-19T19:00Z,35531 +2021-06-19T20:00Z,37148 +2021-06-19T21:00Z,39170 +2021-06-19T22:00Z,41412 +2021-06-19T23:00Z,43284 +2021-06-20,44696 +2021-06-20T01:00Z,45793 +2021-06-20T02:00Z,46198 +2021-06-20T03:00Z,44964 +2021-06-20T04:00Z,43335 +2021-06-20T05:00Z,41428 +2021-06-20T06:00Z,38514 +2021-06-20T07:00Z,35787 +2021-06-20T08:00Z,33320 +2021-06-20T09:00Z,31099 +2021-06-20T10:00Z,29480 +2021-06-20T11:00Z,28436 +2021-06-20T12:00Z,27765 +2021-06-20T13:00Z,27394 +2021-06-20T14:00Z,27356 +2021-06-20T15:00Z,28392 +2021-06-20T16:00Z,29310 +2021-06-20T17:00Z,30132 +2021-06-20T18:00Z,31104 +2021-06-20T19:00Z,32157 +2021-06-20T20:00Z,33162 +2021-06-20T21:00Z,34809 +2021-06-20T22:00Z,36668 +2021-06-20T23:00Z,38386 +2021-06-21,40131 +2021-06-21T01:00Z,41772 +2021-06-21T02:00Z,42491 +2021-06-21T03:00Z,41517 +2021-06-21T04:00Z,40189 +2021-06-21T05:00Z,38877 +2021-06-21T06:00Z,35919 +2021-06-21T07:00Z,33013 +2021-06-21T08:00Z,30795 +2021-06-21T09:00Z,29096 +2021-06-21T10:00Z,27739 +2021-06-21T11:00Z,27201 +2021-06-21T12:00Z,27129 +2021-06-21T13:00Z,28402 +2021-06-21T14:00Z,29432 +2021-06-21T15:00Z,31141 +2021-06-21T16:00Z,31874 +2021-06-21T17:00Z,32248 +2021-06-21T18:00Z,33595 +2021-06-21T19:00Z,34402 +2021-06-21T20:00Z,35369 +2021-06-21T21:00Z,37036 +2021-06-21T22:00Z,38758 +2021-06-21T23:00Z,40605 +2021-06-22,42172 +2021-06-22T01:00Z,43153 +2021-06-22T02:00Z,43311 +2021-06-22T03:00Z,42249 +2021-06-22T04:00Z,40876 +2021-06-22T05:00Z,39227 +2021-06-22T06:00Z,36475 +2021-06-22T07:00Z,33575 +2021-06-22T08:00Z,31511 +2021-06-22T09:00Z,29709 +2021-06-22T10:00Z,28658 +2021-06-22T11:00Z,27950 +2021-06-22T12:00Z,27760 +2021-06-22T13:00Z,28607 +2021-06-22T14:00Z,29663 +2021-06-22T15:00Z,31119 +2021-06-22T16:00Z,32488 +2021-06-22T17:00Z,33130 +2021-06-22T18:00Z,33342 +2021-06-22T19:00Z,34064 +2021-06-22T20:00Z,34964 +2021-06-22T21:00Z,36274 +2021-06-22T22:00Z,38156 +2021-06-22T23:00Z,39559 +2021-06-23,40403 +2021-06-23T01:00Z,41223 +2021-06-23T02:00Z,41401 +2021-06-23T03:00Z,40714 +2021-06-23T04:00Z,40072 +2021-06-23T05:00Z,39013 +2021-06-23T06:00Z,36586 +2021-06-23T07:00Z,33765 +2021-06-23T08:00Z,31763 +2021-06-23T09:00Z,30341 +2021-06-23T10:00Z,29025 +2021-06-23T11:00Z,28474 +2021-06-23T12:00Z,28460 +2021-06-23T13:00Z,29256 +2021-06-23T14:00Z,30274 +2021-06-23T15:00Z,31972 +2021-06-23T16:00Z,33256 +2021-06-23T17:00Z,33715 +2021-06-23T18:00Z,34509 +2021-06-23T19:00Z,34737 +2021-06-23T20:00Z,35411 +2021-06-23T21:00Z,36919 +2021-06-23T22:00Z,37976 +2021-06-23T23:00Z,39451 +2021-06-24,40800 +2021-06-24T01:00Z,41128 +2021-06-24T02:00Z,41337 +2021-06-24T03:00Z,40755 +2021-06-24T04:00Z,40024 +2021-06-24T05:00Z,38756 +2021-06-24T06:00Z,35980 +2021-06-24T07:00Z,33132 +2021-06-24T08:00Z,30998 +2021-06-24T09:00Z,29338 +2021-06-24T10:00Z,28518 +2021-06-24T11:00Z,28019 +2021-06-24T12:00Z,28170 +2021-06-24T13:00Z,29003 +2021-06-24T14:00Z,29919 +2021-06-24T15:00Z,31450 +2021-06-24T16:00Z,32435 +2021-06-24T17:00Z,32536 +2021-06-24T18:00Z,32671 +2021-06-24T19:00Z,33087 +2021-06-24T20:00Z,33912 +2021-06-24T21:00Z,34885 +2021-06-24T22:00Z,36390 +2021-06-24T23:00Z,38302 +2021-06-25,39296 +2021-06-25T01:00Z,40079 +2021-06-25T02:00Z,40479 +2021-06-25T03:00Z,39947 +2021-06-25T04:00Z,39339 +2021-06-25T05:00Z,38014 +2021-06-25T06:00Z,35377 +2021-06-25T07:00Z,32697 +2021-06-25T08:00Z,30538 +2021-06-25T09:00Z,29091 +2021-06-25T10:00Z,28072 +2021-06-25T11:00Z,28030 +2021-06-25T12:00Z,27940 +2021-06-25T13:00Z,28332 +2021-06-25T14:00Z,29243 +2021-06-25T15:00Z,30880 +2021-06-25T16:00Z,32056 +2021-06-25T17:00Z,31928 +2021-06-25T18:00Z,32089 +2021-06-25T19:00Z,32726 +2021-06-25T20:00Z,33788 +2021-06-25T21:00Z,34917 +2021-06-25T22:00Z,36408 +2021-06-25T23:00Z,38054 +2021-06-26,39932 +2021-06-26T01:00Z,41730 +2021-06-26T02:00Z,42494 +2021-06-26T03:00Z,41699 +2021-06-26T04:00Z,40614 +2021-06-26T05:00Z,39249 +2021-06-26T06:00Z,36996 +2021-06-26T07:00Z,34139 +2021-06-26T08:00Z,31698 +2021-06-26T09:00Z,29967 +2021-06-26T10:00Z,28724 +2021-06-26T11:00Z,27813 +2021-06-26T12:00Z,27469 +2021-06-26T13:00Z,27757 +2021-06-26T14:00Z,27729 +2021-06-26T15:00Z,29234 +2021-06-26T16:00Z,29808 +2021-06-26T17:00Z,30194 +2021-06-26T18:00Z,31020 +2021-06-26T19:00Z,31683 +2021-06-26T20:00Z,33088 +2021-06-26T21:00Z,34944 +2021-06-26T22:00Z,36830 +2021-06-26T23:00Z,39207 +2021-06-27,41400 +2021-06-27T01:00Z,43360 +2021-06-27T02:00Z,44458 +2021-06-27T03:00Z,43823 +2021-06-27T04:00Z,42343 +2021-06-27T05:00Z,40734 +2021-06-27T06:00Z,38211 +2021-06-27T07:00Z,35399 +2021-06-27T08:00Z,32994 +2021-06-27T09:00Z,30857 +2021-06-27T10:00Z,29519 +2021-06-27T11:00Z,28516 +2021-06-27T12:00Z,28191 +2021-06-27T13:00Z,28049 +2021-06-27T14:00Z,27721 +2021-06-27T15:00Z,28882 +2021-06-27T16:00Z,29104 +2021-06-27T17:00Z,30316 +2021-06-27T18:00Z,31372 +2021-06-27T19:00Z,32946 +2021-06-27T20:00Z,34699 +2021-06-27T21:00Z,36815 +2021-06-27T22:00Z,38220 +2021-06-27T23:00Z,40204 +2021-06-28,42119 +2021-06-28T01:00Z,43739 +2021-06-28T02:00Z,44367 +2021-06-28T03:00Z,43353 +2021-06-28T04:00Z,41723 +2021-06-28T05:00Z,40036 +2021-06-28T06:00Z,37119 +2021-06-28T07:00Z,34346 +2021-06-28T08:00Z,32203 +2021-06-28T09:00Z,30597 +2021-06-28T10:00Z,29590 +2021-06-28T11:00Z,28882 +2021-06-28T12:00Z,28941 +2021-06-28T13:00Z,29592 +2021-06-28T14:00Z,30456 +2021-06-28T15:00Z,32127 +2021-06-28T16:00Z,33867 +2021-06-28T17:00Z,34810 +2021-06-28T18:00Z,35684 +2021-06-28T19:00Z,37617 +2021-06-28T20:00Z,39348 +2021-06-28T21:00Z,41416 +2021-06-28T22:00Z,43487 +2021-06-28T23:00Z,45237 +2021-06-29,46361 +2021-06-29T01:00Z,46834 +2021-06-29T02:00Z,46374 +2021-06-29T03:00Z,44835 +2021-06-29T04:00Z,43459 +2021-06-29T05:00Z,41646 +2021-06-29T06:00Z,38516 +2021-06-29T07:00Z,35449 +2021-06-29T08:00Z,33470 +2021-06-29T09:00Z,31787 +2021-06-29T10:00Z,30424 +2021-06-29T11:00Z,29723 +2021-06-29T12:00Z,29647 +2021-06-29T13:00Z,30283 +2021-06-29T14:00Z,30834 +2021-06-29T15:00Z,32262 +2021-06-29T16:00Z,33648 +2021-06-29T17:00Z,34347 +2021-06-29T18:00Z,35099 +2021-06-29T19:00Z,37053 +2021-06-29T20:00Z,38015 +2021-06-29T21:00Z,39724 +2021-06-29T22:00Z,41732 +2021-06-29T23:00Z,43473 +2021-06-30,44767 +2021-06-30T01:00Z,45544 +2021-06-30T02:00Z,45510 +2021-06-30T03:00Z,44443 +2021-06-30T04:00Z,43521 +2021-06-30T05:00Z,41973 +2021-06-30T06:00Z,39073 +2021-06-30T07:00Z,36082 +2021-06-30T08:00Z,33864 +2021-06-30T09:00Z,31736 +2021-06-30T10:00Z,30414 +2021-06-30T11:00Z,29688 +2021-06-30T12:00Z,29484 +2021-06-30T13:00Z,30295 +2021-06-30T14:00Z,31280 +2021-06-30T15:00Z,33272 +2021-06-30T16:00Z,34433 +2021-06-30T17:00Z,35115 +2021-06-30T18:00Z,36041 +2021-06-30T19:00Z,37353 +2021-06-30T20:00Z,38466 +2021-06-30T21:00Z,40384 +2021-06-30T22:00Z,42301 +2021-06-30T23:00Z,44097 +2021-07-01,45387 +2021-07-01T01:00Z,46383 +2021-07-01T02:00Z,46310 +2021-07-01T03:00Z,44843 +2021-07-01T04:00Z,43356 +2021-07-01T05:00Z,41534 +2021-07-01T06:00Z,38479 +2021-07-01T07:00Z,35262 +2021-07-01T08:00Z,33129 +2021-07-01T09:00Z,31309 +2021-07-01T10:00Z,30094 +2021-07-01T11:00Z,29421 +2021-07-01T12:00Z,29440 +2021-07-01T13:00Z,30072 +2021-07-01T14:00Z,31007 +2021-07-01T15:00Z,32770 +2021-07-01T16:00Z,33952 +2021-07-01T17:00Z,34632 +2021-07-01T18:00Z,35203 +2021-07-01T19:00Z,36858 +2021-07-01T20:00Z,38606 +2021-07-01T21:00Z,40081 +2021-07-01T22:00Z,42204 +2021-07-01T23:00Z,44381 +2021-07-02,46116 +2021-07-02T01:00Z,47233 +2021-07-02T02:00Z,47239 +2021-07-02T03:00Z,45819 +2021-07-02T04:00Z,44105 +2021-07-02T05:00Z,42361 +2021-07-02T06:00Z,39223 +2021-07-02T07:00Z,36350 +2021-07-02T08:00Z,33636 +2021-07-02T09:00Z,31712 +2021-07-02T10:00Z,30313 +2021-07-02T11:00Z,29474 +2021-07-02T12:00Z,29273 +2021-07-02T13:00Z,29892 +2021-07-02T14:00Z,30922 +2021-07-02T15:00Z,32702 +2021-07-02T16:00Z,33603 +2021-07-02T17:00Z,34144 +2021-07-02T18:00Z,35411 +2021-07-02T19:00Z,37039 +2021-07-02T20:00Z,38428 +2021-07-02T21:00Z,40215 +2021-07-02T22:00Z,42263 +2021-07-02T23:00Z,44269 +2021-07-03,45565 +2021-07-03T01:00Z,46210 +2021-07-03T02:00Z,46077 +2021-07-03T03:00Z,44682 +2021-07-03T04:00Z,43083 +2021-07-03T05:00Z,41409 +2021-07-03T06:00Z,38467 +2021-07-03T07:00Z,35586 +2021-07-03T08:00Z,33372 +2021-07-03T09:00Z,31532 +2021-07-03T10:00Z,30279 +2021-07-03T11:00Z,29372 +2021-07-03T12:00Z,28869 +2021-07-03T13:00Z,28769 +2021-07-03T14:00Z,28613 +2021-07-03T15:00Z,29866 +2021-07-03T16:00Z,30578 +2021-07-03T17:00Z,31112 +2021-07-03T18:00Z,31682 +2021-07-03T19:00Z,32555 +2021-07-03T20:00Z,34130 +2021-07-03T21:00Z,36418 +2021-07-03T22:00Z,38556 +2021-07-03T23:00Z,40289 +2021-07-04,41572 +2021-07-04T01:00Z,42653 +2021-07-04T02:00Z,43082 +2021-07-04T03:00Z,42042 +2021-07-04T04:00Z,40677 +2021-07-04T05:00Z,39145 +2021-07-04T06:00Z,36622 +2021-07-04T07:00Z,34531 +2021-07-04T08:00Z,31868 +2021-07-04T09:00Z,29921 +2021-07-04T10:00Z,28886 +2021-07-04T11:00Z,28019 +2021-07-04T12:00Z,27205 +2021-07-04T13:00Z,27108 +2021-07-04T14:00Z,26725 +2021-07-04T15:00Z,27104 +2021-07-04T16:00Z,27293 +2021-07-04T17:00Z,27590 +2021-07-04T18:00Z,28239 +2021-07-04T19:00Z,29269 +2021-07-04T20:00Z,31044 +2021-07-04T21:00Z,32561 +2021-07-04T22:00Z,34407 +2021-07-04T23:00Z,36257 +2021-07-05,37352 +2021-07-05T01:00Z,38687 +2021-07-05T02:00Z,39577 +2021-07-05T03:00Z,38909 +2021-07-05T04:00Z,37601 +2021-07-05T05:00Z,36292 +2021-07-05T06:00Z,34554 +2021-07-05T07:00Z,32479 +2021-07-05T08:00Z,30367 +2021-07-05T09:00Z,28732 +2021-07-05T10:00Z,27657 +2021-07-05T11:00Z,26989 +2021-07-05T12:00Z,26744 +2021-07-05T13:00Z,26951 +2021-07-05T14:00Z,27299 +2021-07-05T15:00Z,28319 +2021-07-05T16:00Z,28557 +2021-07-05T17:00Z,28901 +2021-07-05T18:00Z,29479 +2021-07-05T19:00Z,33967 +2021-07-05T20:00Z,32198 +2021-07-05T21:00Z,34071 +2021-07-05T22:00Z,36293 +2021-07-05T23:00Z,38415 +2021-07-06,40529 +2021-07-06T01:00Z,42422 +2021-07-06T02:00Z,43294 +2021-07-06T03:00Z,42594 +2021-07-06T04:00Z,41218 +2021-07-06T05:00Z,39500 +2021-07-06T06:00Z,36515 +2021-07-06T07:00Z,33376 +2021-07-06T08:00Z,31031 +2021-07-06T09:00Z,29345 +2021-07-06T10:00Z,28576 +2021-07-06T11:00Z,28286 +2021-07-06T12:00Z,28144 +2021-07-06T13:00Z,28823 +2021-07-06T14:00Z,30001 +2021-07-06T15:00Z,31859 +2021-07-06T16:00Z,33165 +2021-07-06T17:00Z,33732 +2021-07-06T18:00Z,33903 +2021-07-06T19:00Z,34778 +2021-07-06T20:00Z,35957 +2021-07-06T21:00Z,37149 +2021-07-06T22:00Z,39099 +2021-07-06T23:00Z,41429 +2021-07-07,43417 +2021-07-07T01:00Z,44749 +2021-07-07T02:00Z,45087 +2021-07-07T03:00Z,44186 +2021-07-07T04:00Z,42800 +2021-07-07T05:00Z,40997 +2021-07-07T06:00Z,37949 +2021-07-07T07:00Z,34752 +2021-07-07T08:00Z,32718 +2021-07-07T09:00Z,31115 +2021-07-07T10:00Z,29757 +2021-07-07T11:00Z,29280 +2021-07-07T12:00Z,29136 +2021-07-07T13:00Z,29780 +2021-07-07T14:00Z,30916 +2021-07-07T15:00Z,32439 +2021-07-07T16:00Z,33780 +2021-07-07T17:00Z,34717 +2021-07-07T18:00Z,35542 +2021-07-07T19:00Z,36560 +2021-07-07T20:00Z,38151 +2021-07-07T21:00Z,39769 +2021-07-07T22:00Z,41643 +2021-07-07T23:00Z,43544 +2021-07-08,45332 +2021-07-08T01:00Z,46381 +2021-07-08T02:00Z,46641 +2021-07-08T03:00Z,45431 +2021-07-08T04:00Z,43936 +2021-07-08T05:00Z,42207 +2021-07-08T06:00Z,39039 +2021-07-08T07:00Z,35422 +2021-07-08T08:00Z,32849 +2021-07-08T09:00Z,31192 +2021-07-08T10:00Z,30336 +2021-07-08T11:00Z,29437 +2021-07-08T12:00Z,29214 +2021-07-08T13:00Z,30166 +2021-07-08T14:00Z,31341 +2021-07-08T15:00Z,33501 +2021-07-08T16:00Z,34902 +2021-07-08T17:00Z,35999 +2021-07-08T18:00Z,37516 +2021-07-08T19:00Z,39542 +2021-07-08T20:00Z,41264 +2021-07-08T21:00Z,43556 +2021-07-08T22:00Z,45827 +2021-07-08T23:00Z,48305 +2021-07-09,49779 +2021-07-09T01:00Z,50462 +2021-07-09T02:00Z,50338 +2021-07-09T03:00Z,49214 +2021-07-09T04:00Z,47787 +2021-07-09T05:00Z,45797 +2021-07-09T06:00Z,42247 +2021-07-09T07:00Z,38503 +2021-07-09T08:00Z,36070 +2021-07-09T09:00Z,33877 +2021-07-09T10:00Z,32348 +2021-07-09T11:00Z,31541 +2021-07-09T12:00Z,31347 +2021-07-09T13:00Z,31893 +2021-07-09T14:00Z,32877 +2021-07-09T15:00Z,34716 +2021-07-09T16:00Z,36647 +2021-07-09T17:00Z,38140 +2021-07-09T18:00Z,40507 +2021-07-09T19:00Z,43199 +2021-07-09T20:00Z,45447 +2021-07-09T21:00Z,47851 +2021-07-09T22:00Z,50043 +2021-07-09T23:00Z,51992 +2021-07-10,53225 +2021-07-10T01:00Z,53390 +2021-07-10T02:00Z,52074 +2021-07-10T03:00Z,50260 +2021-07-10T04:00Z,48244 +2021-07-10T05:00Z,46566 +2021-07-10T06:00Z,43465 +2021-07-10T07:00Z,39910 +2021-07-10T08:00Z,36991 +2021-07-10T09:00Z,34832 +2021-07-10T10:00Z,33029 +2021-07-10T11:00Z,31902 +2021-07-10T12:00Z,31245 +2021-07-10T13:00Z,31358 +2021-07-10T14:00Z,30912 +2021-07-10T15:00Z,32155 +2021-07-10T16:00Z,33858 +2021-07-10T17:00Z,35290 +2021-07-10T18:00Z,36884 +2021-07-10T19:00Z,39110 +2021-07-10T20:00Z,41779 +2021-07-10T21:00Z,44102 +2021-07-10T22:00Z,46195 +2021-07-10T23:00Z,47833 +2021-07-11,49050 +2021-07-11T01:00Z,50039 +2021-07-11T02:00Z,49957 +2021-07-11T03:00Z,48670 +2021-07-11T04:00Z,47050 +2021-07-11T05:00Z,45119 +2021-07-11T06:00Z,42024 +2021-07-11T07:00Z,39152 +2021-07-11T08:00Z,36312 +2021-07-11T09:00Z,33990 +2021-07-11T10:00Z,32225 +2021-07-11T11:00Z,30890 +2021-07-11T12:00Z,29944 +2021-07-11T13:00Z,29505 +2021-07-11T14:00Z,28887 +2021-07-11T15:00Z,30226 +2021-07-11T16:00Z,31708 +2021-07-11T17:00Z,32919 +2021-07-11T18:00Z,34531 +2021-07-11T19:00Z,36246 +2021-07-11T20:00Z,37467 +2021-07-11T21:00Z,39365 +2021-07-11T22:00Z,41355 +2021-07-11T23:00Z,43378 +2021-07-12,44875 +2021-07-12T01:00Z,46277 +2021-07-12T02:00Z,46681 +2021-07-12T03:00Z,45408 +2021-07-12T04:00Z,43988 +2021-07-12T05:00Z,42056 +2021-07-12T06:00Z,38907 +2021-07-12T07:00Z,35657 +2021-07-12T08:00Z,32932 +2021-07-12T09:00Z,30977 +2021-07-12T10:00Z,29821 +2021-07-12T11:00Z,29133 +2021-07-12T12:00Z,29109 +2021-07-12T13:00Z,29762 +2021-07-12T14:00Z,31392 +2021-07-12T15:00Z,33415 +2021-07-12T16:00Z,34561 +2021-07-12T17:00Z,35831 +2021-07-12T18:00Z,37158 +2021-07-12T19:00Z,38448 +2021-07-12T20:00Z,39996 +2021-07-12T21:00Z,41878 +2021-07-12T22:00Z,43792 +2021-07-12T23:00Z,45659 +2021-07-13,46904 +2021-07-13T01:00Z,47633 +2021-07-13T02:00Z,47412 +2021-07-13T03:00Z,45995 +2021-07-13T04:00Z,44512 +2021-07-13T05:00Z,42572 +2021-07-13T06:00Z,39412 +2021-07-13T07:00Z,36224 +2021-07-13T08:00Z,34066 +2021-07-13T09:00Z,32395 +2021-07-13T10:00Z,30973 +2021-07-13T11:00Z,30310 +2021-07-13T12:00Z,30390 +2021-07-13T13:00Z,31062 +2021-07-13T14:00Z,31922 +2021-07-13T15:00Z,33818 +2021-07-13T16:00Z,35082 +2021-07-13T17:00Z,36319 +2021-07-13T18:00Z,37542 +2021-07-13T19:00Z,38693 +2021-07-13T20:00Z,40010 +2021-07-13T21:00Z,41562 +2021-07-13T22:00Z,43168 +2021-07-13T23:00Z,44976 +2021-07-14,46214 +2021-07-14T01:00Z,47096 +2021-07-14T02:00Z,46874 +2021-07-14T03:00Z,45444 +2021-07-14T04:00Z,44244 +2021-07-14T05:00Z,42459 +2021-07-14T06:00Z,39779 +2021-07-14T07:00Z,36665 +2021-07-14T08:00Z,34340 +2021-07-14T09:00Z,32728 +2021-07-14T10:00Z,31301 +2021-07-14T11:00Z,30721 +2021-07-14T12:00Z,30770 +2021-07-14T13:00Z,31493 +2021-07-14T14:00Z,32142 +2021-07-14T15:00Z,33758 +2021-07-14T16:00Z,35193 +2021-07-14T17:00Z,36694 +2021-07-14T18:00Z,37081 +2021-07-14T19:00Z,38009 +2021-07-14T20:00Z,39632 +2021-07-14T21:00Z,41603 +2021-07-14T22:00Z,43111 +2021-07-14T23:00Z,44822 +2021-07-15,45828 +2021-07-15T01:00Z,46874 +2021-07-15T02:00Z,46920 +2021-07-15T03:00Z,45640 +2021-07-15T04:00Z,44184 +2021-07-15T05:00Z,42597 +2021-07-15T06:00Z,39452 +2021-07-15T07:00Z,36377 +2021-07-15T08:00Z,34166 +2021-07-15T09:00Z,32272 +2021-07-15T10:00Z,31084 +2021-07-15T11:00Z,30486 +2021-07-15T12:00Z,30451 +2021-07-15T13:00Z,31171 +2021-07-15T14:00Z,31978 +2021-07-15T15:00Z,33736 +2021-07-15T16:00Z,34976 +2021-07-15T17:00Z,35691 +2021-07-15T18:00Z,36605 +2021-07-15T19:00Z,37716 +2021-07-15T20:00Z,38916 +2021-07-15T21:00Z,40582 +2021-07-15T22:00Z,42604 +2021-07-15T23:00Z,44472 +2021-07-16,45562 +2021-07-16T01:00Z,46403 +2021-07-16T02:00Z,45871 +2021-07-16T03:00Z,44521 +2021-07-16T04:00Z,43198 +2021-07-16T05:00Z,41703 +2021-07-16T06:00Z,38788 +2021-07-16T07:00Z,35586 +2021-07-16T08:00Z,33138 +2021-07-16T09:00Z,31262 +2021-07-16T10:00Z,30012 +2021-07-16T11:00Z,29384 +2021-07-16T12:00Z,29333 +2021-07-16T13:00Z,30258 +2021-07-16T14:00Z,31170 +2021-07-16T15:00Z,32723 +2021-07-16T16:00Z,33943 +2021-07-16T17:00Z,34683 +2021-07-16T18:00Z,35642 +2021-07-16T19:00Z,36596 +2021-07-16T20:00Z,37882 +2021-07-16T21:00Z,39797 +2021-07-16T22:00Z,41593 +2021-07-16T23:00Z,43285 +2021-07-17,44493 +2021-07-17T01:00Z,45446 +2021-07-17T02:00Z,45414 +2021-07-17T03:00Z,44265 +2021-07-17T04:00Z,43152 +2021-07-17T05:00Z,41748 +2021-07-17T06:00Z,38656 +2021-07-17T07:00Z,35582 +2021-07-17T08:00Z,33077 +2021-07-17T09:00Z,31741 +2021-07-17T10:00Z,30477 +2021-07-17T11:00Z,29486 +2021-07-17T12:00Z,29047 +2021-07-17T13:00Z,29048 +2021-07-17T14:00Z,29050 +2021-07-17T15:00Z,30525 +2021-07-17T16:00Z,31547 +2021-07-17T17:00Z,32280 +2021-07-17T18:00Z,33411 +2021-07-17T19:00Z,34955 +2021-07-17T20:00Z,36631 +2021-07-17T21:00Z,38196 +2021-07-17T22:00Z,40473 +2021-07-17T23:00Z,42335 +2021-07-18,44090 +2021-07-18T01:00Z,45174 +2021-07-18T02:00Z,45230 +2021-07-18T03:00Z,44172 +2021-07-18T04:00Z,42894 +2021-07-18T05:00Z,41260 +2021-07-18T06:00Z,38603 +2021-07-18T07:00Z,36194 +2021-07-18T08:00Z,33898 +2021-07-18T09:00Z,31824 +2021-07-18T10:00Z,30507 +2021-07-18T11:00Z,29751 +2021-07-18T12:00Z,29317 +2021-07-18T13:00Z,29356 +2021-07-18T14:00Z,29075 +2021-07-18T15:00Z,29680 +2021-07-18T16:00Z,30276 +2021-07-18T17:00Z,31637 +2021-07-18T18:00Z,32819 +2021-07-18T19:00Z,34576 +2021-07-18T20:00Z,36969 +2021-07-18T21:00Z,38981 +2021-07-18T22:00Z,41341 +2021-07-18T23:00Z,43516 +2021-07-19,45192 +2021-07-19T01:00Z,46476 +2021-07-19T02:00Z,46686 +2021-07-19T03:00Z,45691 +2021-07-19T04:00Z,44344 +2021-07-19T05:00Z,42683 +2021-07-19T06:00Z,39970 +2021-07-19T07:00Z,36730 +2021-07-19T08:00Z,34175 +2021-07-19T09:00Z,32680 +2021-07-19T10:00Z,31605 +2021-07-19T11:00Z,31139 +2021-07-19T12:00Z,30990 +2021-07-19T13:00Z,31614 +2021-07-19T14:00Z,32544 +2021-07-19T15:00Z,34693 +2021-07-19T16:00Z,36584 +2021-07-19T17:00Z,38076 +2021-07-19T18:00Z,39565 +2021-07-19T19:00Z,41574 +2021-07-19T20:00Z,43719 +2021-07-19T21:00Z,46340 +2021-07-19T22:00Z,48893 +2021-07-19T23:00Z,50839 +2021-07-20,51756 +2021-07-20T01:00Z,52149 +2021-07-20T02:00Z,51583 +2021-07-20T03:00Z,49766 +2021-07-20T04:00Z,47738 +2021-07-20T05:00Z,45246 +2021-07-20T06:00Z,41577 +2021-07-20T07:00Z,38128 +2021-07-20T08:00Z,35430 +2021-07-20T09:00Z,33433 +2021-07-20T10:00Z,32090 +2021-07-20T11:00Z,31346 +2021-07-20T12:00Z,31229 +2021-07-20T13:00Z,31782 +2021-07-20T14:00Z,32617 +2021-07-20T15:00Z,34650 +2021-07-20T16:00Z,36247 +2021-07-20T17:00Z,37506 +2021-07-20T18:00Z,38873 +2021-07-20T19:00Z,40646 +2021-07-20T20:00Z,42363 +2021-07-20T21:00Z,44348 +2021-07-20T22:00Z,46271 +2021-07-20T23:00Z,48359 +2021-07-21,49918 +2021-07-21T01:00Z,50815 +2021-07-21T02:00Z,50698 +2021-07-21T03:00Z,48956 +2021-07-21T04:00Z,47171 +2021-07-21T05:00Z,44959 +2021-07-21T06:00Z,41361 +2021-07-21T07:00Z,38017 +2021-07-21T08:00Z,35563 +2021-07-21T09:00Z,33732 +2021-07-21T10:00Z,32432 +2021-07-21T11:00Z,31810 +2021-07-21T12:00Z,31729 +2021-07-21T13:00Z,32343 +2021-07-21T14:00Z,32995 +2021-07-21T15:00Z,34419 +2021-07-21T16:00Z,35978 +2021-07-21T17:00Z,37194 +2021-07-21T18:00Z,38950 +2021-07-21T19:00Z,40487 +2021-07-21T20:00Z,42540 +2021-07-21T21:00Z,44922 +2021-07-21T22:00Z,46970 +2021-07-21T23:00Z,48950 +2021-07-22,50627 +2021-07-22T01:00Z,51367 +2021-07-22T02:00Z,51125 +2021-07-22T03:00Z,49369 +2021-07-22T04:00Z,47545 +2021-07-22T05:00Z,45433 +2021-07-22T06:00Z,41731 +2021-07-22T07:00Z,38368 +2021-07-22T08:00Z,35613 +2021-07-22T09:00Z,34020 +2021-07-22T10:00Z,32487 +2021-07-22T11:00Z,31826 +2021-07-22T12:00Z,31428 +2021-07-22T13:00Z,32084 +2021-07-22T14:00Z,32985 +2021-07-22T15:00Z,34601 +2021-07-22T16:00Z,36560 +2021-07-22T17:00Z,37719 +2021-07-22T18:00Z,38606 +2021-07-22T19:00Z,40215 +2021-07-22T20:00Z,41912 +2021-07-22T21:00Z,43987 +2021-07-22T22:00Z,45880 +2021-07-22T23:00Z,47984 +2021-07-23,49172 +2021-07-23T01:00Z,49771 +2021-07-23T02:00Z,48777 +2021-07-23T03:00Z,47073 +2021-07-23T04:00Z,45821 +2021-07-23T05:00Z,43893 +2021-07-23T06:00Z,40868 +2021-07-23T07:00Z,37492 +2021-07-23T08:00Z,35119 +2021-07-23T09:00Z,33171 +2021-07-23T10:00Z,31679 +2021-07-23T11:00Z,30960 +2021-07-23T12:00Z,30981 +2021-07-23T13:00Z,31767 +2021-07-23T14:00Z,32734 +2021-07-23T15:00Z,34283 +2021-07-23T16:00Z,36015 +2021-07-23T17:00Z,37137 +2021-07-23T18:00Z,38063 +2021-07-23T19:00Z,39288 +2021-07-23T20:00Z,41086 +2021-07-23T21:00Z,43354 +2021-07-23T22:00Z,45588 +2021-07-23T23:00Z,47416 +2021-07-24,48696 +2021-07-24T01:00Z,49468 +2021-07-24T02:00Z,48791 +2021-07-24T03:00Z,47038 +2021-07-24T04:00Z,45368 +2021-07-24T05:00Z,43273 +2021-07-24T06:00Z,40238 +2021-07-24T07:00Z,37229 +2021-07-24T08:00Z,34477 +2021-07-24T09:00Z,32838 +2021-07-24T10:00Z,31625 +2021-07-24T11:00Z,30502 +2021-07-24T12:00Z,30043 +2021-07-24T13:00Z,30118 +2021-07-24T14:00Z,30167 +2021-07-24T15:00Z,30969 +2021-07-24T16:00Z,31738 +2021-07-24T17:00Z,32615 +2021-07-24T18:00Z,33409 +2021-07-24T19:00Z,34952 +2021-07-24T20:00Z,36285 +2021-07-24T21:00Z,37736 +2021-07-24T22:00Z,39557 +2021-07-24T23:00Z,41067 +2021-07-25,42538 +2021-07-25T01:00Z,43551 +2021-07-25T02:00Z,43757 +2021-07-25T03:00Z,42843 +2021-07-25T04:00Z,41870 +2021-07-25T05:00Z,40391 +2021-07-25T06:00Z,37972 +2021-07-25T07:00Z,35142 +2021-07-25T08:00Z,33040 +2021-07-25T09:00Z,31146 +2021-07-25T10:00Z,29802 +2021-07-25T11:00Z,28783 +2021-07-25T12:00Z,28294 +2021-07-25T13:00Z,28138 +2021-07-25T14:00Z,27911 +2021-07-25T15:00Z,28966 +2021-07-25T16:00Z,29767 +2021-07-25T17:00Z,30463 +2021-07-25T18:00Z,31578 +2021-07-25T19:00Z,32787 +2021-07-25T20:00Z,33756 +2021-07-25T21:00Z,35706 +2021-07-25T22:00Z,38111 +2021-07-25T23:00Z,39869 +2021-07-26,41296 +2021-07-26T01:00Z,42292 +2021-07-26T02:00Z,42624 +2021-07-26T03:00Z,41664 +2021-07-26T04:00Z,41073 +2021-07-26T05:00Z,39666 +2021-07-26T06:00Z,36913 +2021-07-26T07:00Z,33977 +2021-07-26T08:00Z,31884 +2021-07-26T09:00Z,30346 +2021-07-26T10:00Z,29445 +2021-07-26T11:00Z,29225 +2021-07-26T12:00Z,29142 +2021-07-26T13:00Z,29886 +2021-07-26T14:00Z,31263 +2021-07-26T15:00Z,32889 +2021-07-26T16:00Z,34608 +2021-07-26T17:00Z,35934 +2021-07-26T18:00Z,36483 +2021-07-26T19:00Z,36963 +2021-07-26T20:00Z,37765 +2021-07-26T21:00Z,38370 +2021-07-26T22:00Z,39312 +2021-07-26T23:00Z,40278 +2021-07-27,41195 +2021-07-27T01:00Z,41899 +2021-07-27T02:00Z,41941 +2021-07-27T03:00Z,41058 +2021-07-27T04:00Z,40686 +2021-07-27T05:00Z,39443 +2021-07-27T06:00Z,36920 +2021-07-27T07:00Z,34219 +2021-07-27T08:00Z,32505 +2021-07-27T09:00Z,31146 +2021-07-27T10:00Z,30322 +2021-07-27T11:00Z,30040 +2021-07-27T12:00Z,29864 +2021-07-27T13:00Z,30563 +2021-07-27T14:00Z,31879 +2021-07-27T15:00Z,33656 +2021-07-27T16:00Z,34840 +2021-07-27T17:00Z,35717 +2021-07-27T18:00Z,36500 +2021-07-27T19:00Z,38065 +2021-07-27T20:00Z,39432 +2021-07-27T21:00Z,40958 +2021-07-27T22:00Z,43176 +2021-07-27T23:00Z,45380 +2021-07-28,47034 +2021-07-28T01:00Z,48129 +2021-07-28T02:00Z,47998 +2021-07-28T03:00Z,46538 +2021-07-28T04:00Z,45152 +2021-07-28T05:00Z,43178 +2021-07-28T06:00Z,39863 +2021-07-28T07:00Z,36376 +2021-07-28T08:00Z,34033 +2021-07-28T09:00Z,32137 +2021-07-28T10:00Z,31016 +2021-07-28T11:00Z,30334 +2021-07-28T12:00Z,30189 +2021-07-28T13:00Z,30984 +2021-07-28T14:00Z,31875 +2021-07-28T15:00Z,33676 +2021-07-28T16:00Z,35753 +2021-07-28T17:00Z,36494 +2021-07-28T18:00Z,37765 +2021-07-28T19:00Z,39466 +2021-07-28T20:00Z,41169 +2021-07-28T21:00Z,43535 +2021-07-28T22:00Z,45828 +2021-07-28T23:00Z,48280 +2021-07-29,49897 +2021-07-29T01:00Z,50617 +2021-07-29T02:00Z,50260 +2021-07-29T03:00Z,48505 +2021-07-29T04:00Z,46783 +2021-07-29T05:00Z,44557 +2021-07-29T06:00Z,41126 +2021-07-29T07:00Z,37607 +2021-07-29T08:00Z,35093 +2021-07-29T09:00Z,33380 +2021-07-29T10:00Z,32247 +2021-07-29T11:00Z,31193 +2021-07-29T12:00Z,30965 +2021-07-29T13:00Z,31730 +2021-07-29T14:00Z,32202 +2021-07-29T15:00Z,33687 +2021-07-29T16:00Z,35674 +2021-07-29T17:00Z,36795 +2021-07-29T18:00Z,38184 +2021-07-29T19:00Z,40186 +2021-07-29T20:00Z,42509 +2021-07-29T21:00Z,45284 +2021-07-29T22:00Z,47540 +2021-07-29T23:00Z,49734 +2021-07-30,50817 +2021-07-30T01:00Z,51558 +2021-07-30T02:00Z,50910 +2021-07-30T03:00Z,49299 +2021-07-30T04:00Z,47598 +2021-07-30T05:00Z,45295 +2021-07-30T06:00Z,41625 +2021-07-30T07:00Z,38035 +2021-07-30T08:00Z,35591 +2021-07-30T09:00Z,33860 +2021-07-30T10:00Z,32600 +2021-07-30T11:00Z,31481 +2021-07-30T12:00Z,31249 +2021-07-30T13:00Z,32035 +2021-07-30T14:00Z,32266 +2021-07-30T15:00Z,33375 +2021-07-30T16:00Z,35315 +2021-07-30T17:00Z,36297 +2021-07-30T18:00Z,37703 +2021-07-30T19:00Z,39496 +2021-07-30T20:00Z,41845 +2021-07-30T21:00Z,44578 +2021-07-30T22:00Z,46992 +2021-07-30T23:00Z,49201 +2021-07-31,50185 +2021-07-31T01:00Z,50071 +2021-07-31T02:00Z,49027 +2021-07-31T03:00Z,47205 +2021-07-31T04:00Z,45696 +2021-07-31T05:00Z,43480 +2021-07-31T06:00Z,40347 +2021-07-31T07:00Z,37516 +2021-07-31T08:00Z,35375 +2021-07-31T09:00Z,33156 +2021-07-31T10:00Z,31909 +2021-07-31T11:00Z,30950 +2021-07-31T12:00Z,30494 +2021-07-31T13:00Z,30113 +2021-07-31T14:00Z,29931 +2021-07-31T15:00Z,30965 +2021-07-31T16:00Z,32402 +2021-07-31T17:00Z,33376 +2021-07-31T18:00Z,34496 +2021-07-31T19:00Z,35533 +2021-07-31T20:00Z,37148 +2021-07-31T21:00Z,38649 +2021-07-31T22:00Z,40624 +2021-07-31T23:00Z,42534 +2021-08-01,44134 +2021-08-01T01:00Z,45413 +2021-08-01T02:00Z,45734 +2021-08-01T03:00Z,44524 +2021-08-01T04:00Z,43014 +2021-08-01T05:00Z,41074 +2021-08-01T06:00Z,38120 +2021-08-01T07:00Z,35373 +2021-08-01T08:00Z,32977 +2021-08-01T09:00Z,31206 +2021-08-01T10:00Z,29771 +2021-08-01T11:00Z,28623 +2021-08-01T12:00Z,28030 +2021-08-01T13:00Z,28060 +2021-08-01T14:00Z,27546 +2021-08-01T15:00Z,27914 +2021-08-01T16:00Z,28921 +2021-08-01T17:00Z,29757 +2021-08-01T18:00Z,30993 +2021-08-01T19:00Z,32823 +2021-08-01T20:00Z,34505 +2021-08-01T21:00Z,36626 +2021-08-01T22:00Z,39072 +2021-08-01T23:00Z,41167 +2021-08-02,43106 +2021-08-02T01:00Z,44930 +2021-08-02T02:00Z,45523 +2021-08-02T03:00Z,44265 +2021-08-02T04:00Z,42603 +2021-08-02T05:00Z,40407 +2021-08-02T06:00Z,37213 +2021-08-02T07:00Z,33985 +2021-08-02T08:00Z,31799 +2021-08-02T09:00Z,30662 +2021-08-02T10:00Z,29400 +2021-08-02T11:00Z,28744 +2021-08-02T12:00Z,28221 +2021-08-02T13:00Z,29110 +2021-08-02T14:00Z,30780 +2021-08-02T15:00Z,32857 +2021-08-02T16:00Z,34323 +2021-08-02T17:00Z,35059 +2021-08-02T18:00Z,35972 +2021-08-02T19:00Z,37731 +2021-08-02T20:00Z,39940 +2021-08-02T21:00Z,42360 +2021-08-02T22:00Z,44708 +2021-08-02T23:00Z,47195 +2021-08-03,48892 +2021-08-03T01:00Z,50120 +2021-08-03T02:00Z,49894 +2021-08-03T03:00Z,48092 +2021-08-03T04:00Z,46182 +2021-08-03T05:00Z,43668 +2021-08-03T06:00Z,39783 +2021-08-03T07:00Z,36332 +2021-08-03T08:00Z,33568 +2021-08-03T09:00Z,31615 +2021-08-03T10:00Z,30760 +2021-08-03T11:00Z,30380 +2021-08-03T12:00Z,30202 +2021-08-03T13:00Z,30456 +2021-08-03T14:00Z,31507 +2021-08-03T15:00Z,33238 +2021-08-03T16:00Z,35141 +2021-08-03T17:00Z,35843 +2021-08-03T18:00Z,36643 +2021-08-03T19:00Z,38210 +2021-08-03T20:00Z,40014 +2021-08-03T21:00Z,42913 +2021-08-03T22:00Z,45940 +2021-08-03T23:00Z,48504 +2021-08-04,50020 +2021-08-04T01:00Z,51206 +2021-08-04T02:00Z,51104 +2021-08-04T03:00Z,49464 +2021-08-04T04:00Z,47412 +2021-08-04T05:00Z,44702 +2021-08-04T06:00Z,41413 +2021-08-04T07:00Z,37470 +2021-08-04T08:00Z,35082 +2021-08-04T09:00Z,33004 +2021-08-04T10:00Z,31722 +2021-08-04T11:00Z,31033 +2021-08-04T12:00Z,30703 +2021-08-04T13:00Z,31211 +2021-08-04T14:00Z,32331 +2021-08-04T15:00Z,33636 +2021-08-04T16:00Z,34613 +2021-08-04T17:00Z,35642 +2021-08-04T18:00Z,37128 +2021-08-04T19:00Z,38837 +2021-08-04T20:00Z,40907 +2021-08-04T21:00Z,43648 +2021-08-04T22:00Z,45901 +2021-08-04T23:00Z,47960 +2021-08-05,49487 +2021-08-05T01:00Z,50348 +2021-08-05T02:00Z,50015 +2021-08-05T03:00Z,48268 +2021-08-05T04:00Z,46445 +2021-08-05T05:00Z,43914 +2021-08-05T06:00Z,40592 +2021-08-05T07:00Z,37175 +2021-08-05T08:00Z,34342 +2021-08-05T09:00Z,32837 +2021-08-05T10:00Z,31318 +2021-08-05T11:00Z,30859 +2021-08-05T12:00Z,30886 +2021-08-05T13:00Z,31331 +2021-08-05T14:00Z,32238 +2021-08-05T15:00Z,33492 +2021-08-05T16:00Z,35072 +2021-08-05T17:00Z,36053 +2021-08-05T18:00Z,37154 +2021-08-05T19:00Z,38570 +2021-08-05T20:00Z,39876 +2021-08-05T21:00Z,41486 +2021-08-05T22:00Z,43314 +2021-08-05T23:00Z,44747 +2021-08-06,46379 +2021-08-06T01:00Z,47579 +2021-08-06T02:00Z,47674 +2021-08-06T03:00Z,46172 +2021-08-06T04:00Z,44508 +2021-08-06T05:00Z,42481 +2021-08-06T06:00Z,39117 +2021-08-06T07:00Z,35890 +2021-08-06T08:00Z,34082 +2021-08-06T09:00Z,32662 +2021-08-06T10:00Z,31252 +2021-08-06T11:00Z,30491 +2021-08-06T12:00Z,30636 +2021-08-06T13:00Z,31485 +2021-08-06T14:00Z,32469 +2021-08-06T15:00Z,33586 +2021-08-06T16:00Z,34896 +2021-08-06T17:00Z,35937 +2021-08-06T18:00Z,36580 +2021-08-06T19:00Z,37072 +2021-08-06T20:00Z,38256 +2021-08-06T21:00Z,40105 +2021-08-06T22:00Z,42018 +2021-08-06T23:00Z,43750 +2021-08-07,45060 +2021-08-07T01:00Z,46114 +2021-08-07T02:00Z,45762 +2021-08-07T03:00Z,44395 +2021-08-07T04:00Z,43090 +2021-08-07T05:00Z,41065 +2021-08-07T06:00Z,38291 +2021-08-07T07:00Z,35331 +2021-08-07T08:00Z,33130 +2021-08-07T09:00Z,31255 +2021-08-07T10:00Z,29843 +2021-08-07T11:00Z,28901 +2021-08-07T12:00Z,28633 +2021-08-07T13:00Z,28313 +2021-08-07T14:00Z,28451 +2021-08-07T15:00Z,29115 +2021-08-07T16:00Z,30640 +2021-08-07T17:00Z,31495 +2021-08-07T18:00Z,32253 +2021-08-07T19:00Z,33165 +2021-08-07T20:00Z,34206 +2021-08-07T21:00Z,36079 +2021-08-07T22:00Z,38376 +2021-08-07T23:00Z,40486 +2021-08-08,42282 +2021-08-08T01:00Z,43282 +2021-08-08T02:00Z,43221 +2021-08-08T03:00Z,41765 +2021-08-08T04:00Z,40544 +2021-08-08T05:00Z,38945 +2021-08-08T06:00Z,36545 +2021-08-08T07:00Z,33901 +2021-08-08T08:00Z,31644 +2021-08-08T09:00Z,30218 +2021-08-08T10:00Z,29030 +2021-08-08T11:00Z,28201 +2021-08-08T12:00Z,27745 +2021-08-08T13:00Z,27647 +2021-08-08T14:00Z,27395 +2021-08-08T15:00Z,27464 +2021-08-08T16:00Z,28567 +2021-08-08T17:00Z,29245 +2021-08-08T18:00Z,29428 +2021-08-08T19:00Z,30457 +2021-08-08T20:00Z,32097 +2021-08-08T21:00Z,34141 +2021-08-08T22:00Z,36905 +2021-08-08T23:00Z,39823 +2021-08-09,41931 +2021-08-09T01:00Z,43655 +2021-08-09T02:00Z,44138 +2021-08-09T03:00Z,42947 +2021-08-09T04:00Z,41652 +2021-08-09T05:00Z,39695 +2021-08-09T06:00Z,36593 +2021-08-09T07:00Z,33653 +2021-08-09T08:00Z,31926 +2021-08-09T09:00Z,30406 +2021-08-09T10:00Z,29267 +2021-08-09T11:00Z,28637 +2021-08-09T12:00Z,28977 +2021-08-09T13:00Z,29910 +2021-08-09T14:00Z,30922 +2021-08-09T15:00Z,32809 +2021-08-09T16:00Z,34096 +2021-08-09T17:00Z,34676 +2021-08-09T18:00Z,35381 +2021-08-09T19:00Z,36872 +2021-08-09T20:00Z,38787 +2021-08-09T21:00Z,40911 +2021-08-09T22:00Z,43697 +2021-08-09T23:00Z,45873 +2021-08-10,47352 +2021-08-10T01:00Z,48444 +2021-08-10T02:00Z,48305 +2021-08-10T03:00Z,46489 +2021-08-10T04:00Z,44824 +2021-08-10T05:00Z,42408 +2021-08-10T06:00Z,38792 +2021-08-10T07:00Z,35396 +2021-08-10T08:00Z,33132 +2021-08-10T09:00Z,31921 +2021-08-10T10:00Z,30315 +2021-08-10T11:00Z,30098 +2021-08-10T12:00Z,29939 +2021-08-10T13:00Z,30932 +2021-08-10T14:00Z,32376 +2021-08-10T15:00Z,33519 +2021-08-10T16:00Z,35207 +2021-08-10T17:00Z,36100 +2021-08-10T18:00Z,37253 +2021-08-10T19:00Z,38858 +2021-08-10T20:00Z,41015 +2021-08-10T21:00Z,43431 +2021-08-10T22:00Z,45921 +2021-08-10T23:00Z,48752 +2021-08-11,50659 +2021-08-11T01:00Z,51632 +2021-08-11T02:00Z,51270 +2021-08-11T03:00Z,49393 +2021-08-11T04:00Z,47699 +2021-08-11T05:00Z,44943 +2021-08-11T06:00Z,41154 +2021-08-11T07:00Z,37475 +2021-08-11T08:00Z,34901 +2021-08-11T09:00Z,33425 +2021-08-11T10:00Z,32207 +2021-08-11T11:00Z,31373 +2021-08-11T12:00Z,31570 +2021-08-11T13:00Z,32481 +2021-08-11T14:00Z,33546 +2021-08-11T15:00Z,34821 +2021-08-11T16:00Z,36880 +2021-08-11T17:00Z,37977 +2021-08-11T18:00Z,39946 +2021-08-11T19:00Z,42095 +2021-08-11T20:00Z,44327 +2021-08-11T21:00Z,46816 +2021-08-11T22:00Z,48703 +2021-08-11T23:00Z,49998 +2021-08-12,50588 +2021-08-12T01:00Z,50523 +2021-08-12T02:00Z,49254 +2021-08-12T03:00Z,47665 +2021-08-12T04:00Z,46305 +2021-08-12T05:00Z,43812 +2021-08-12T06:00Z,40388 +2021-08-12T07:00Z,36973 +2021-08-12T08:00Z,34970 +2021-08-12T09:00Z,33093 +2021-08-12T10:00Z,32254 +2021-08-12T11:00Z,31413 +2021-08-12T12:00Z,31541 +2021-08-12T13:00Z,32183 +2021-08-12T14:00Z,33611 +2021-08-12T15:00Z,35107 +2021-08-12T16:00Z,37124 +2021-08-12T17:00Z,37829 +2021-08-12T18:00Z,39667 +2021-08-12T19:00Z,41565 +2021-08-12T20:00Z,43695 +2021-08-12T21:00Z,46111 +2021-08-12T22:00Z,48003 +2021-08-12T23:00Z,50118 +2021-08-13,51653 +2021-08-13T01:00Z,52032 +2021-08-13T02:00Z,50903 +2021-08-13T03:00Z,48879 +2021-08-13T04:00Z,47049 +2021-08-13T05:00Z,44735 +2021-08-13T06:00Z,41180 +2021-08-13T07:00Z,37926 +2021-08-13T08:00Z,35094 +2021-08-13T09:00Z,32998 +2021-08-13T10:00Z,31229 +2021-08-13T11:00Z,30465 +2021-08-13T12:00Z,30346 +2021-08-13T13:00Z,31252 +2021-08-13T14:00Z,32585 +2021-08-13T15:00Z,33500 +2021-08-13T16:00Z,35206 +2021-08-13T17:00Z,36223 +2021-08-13T18:00Z,37663 +2021-08-13T19:00Z,39442 +2021-08-13T20:00Z,40662 +2021-08-13T21:00Z,42895 +2021-08-13T22:00Z,45093 +2021-08-13T23:00Z,47093 +2021-08-14,48420 +2021-08-14T01:00Z,48963 +2021-08-14T02:00Z,48091 +2021-08-14T03:00Z,46033 +2021-08-14T04:00Z,44577 +2021-08-14T05:00Z,42633 +2021-08-14T06:00Z,39814 +2021-08-14T07:00Z,36890 +2021-08-14T08:00Z,34551 +2021-08-14T09:00Z,32502 +2021-08-14T10:00Z,30987 +2021-08-14T11:00Z,30233 +2021-08-14T12:00Z,29814 +2021-08-14T13:00Z,30093 +2021-08-14T14:00Z,30894 +2021-08-14T15:00Z,31573 +2021-08-14T16:00Z,32650 +2021-08-14T17:00Z,33600 +2021-08-14T18:00Z,34634 +2021-08-14T19:00Z,36808 +2021-08-14T20:00Z,39195 +2021-08-14T21:00Z,41817 +2021-08-14T22:00Z,43535 +2021-08-14T23:00Z,45092 +2021-08-15,46455 +2021-08-15T01:00Z,46510 +2021-08-15T02:00Z,46110 +2021-08-15T03:00Z,44865 +2021-08-15T04:00Z,43647 +2021-08-15T05:00Z,41579 +2021-08-15T06:00Z,38754 +2021-08-15T07:00Z,36006 +2021-08-15T08:00Z,33761 +2021-08-15T09:00Z,31658 +2021-08-15T10:00Z,30140 +2021-08-15T11:00Z,29387 +2021-08-15T12:00Z,28816 +2021-08-15T13:00Z,28632 +2021-08-15T14:00Z,28414 +2021-08-15T15:00Z,29452 +2021-08-15T16:00Z,30652 +2021-08-15T17:00Z,31741 +2021-08-15T18:00Z,33064 +2021-08-15T19:00Z,34951 +2021-08-15T20:00Z,36422 +2021-08-15T21:00Z,39341 +2021-08-15T22:00Z,42204 +2021-08-15T23:00Z,45088 +2021-08-16,47010 +2021-08-16T01:00Z,48255 +2021-08-16T02:00Z,48335 +2021-08-16T03:00Z,46989 +2021-08-16T04:00Z,45710 +2021-08-16T05:00Z,43242 +2021-08-16T06:00Z,39800 +2021-08-16T07:00Z,36452 +2021-08-16T08:00Z,34274 +2021-08-16T09:00Z,32513 +2021-08-16T10:00Z,31128 +2021-08-16T11:00Z,30359 +2021-08-16T12:00Z,30494 +2021-08-16T13:00Z,31305 +2021-08-16T14:00Z,33169 +2021-08-16T15:00Z,35428 +2021-08-16T16:00Z,37454 +2021-08-16T17:00Z,39023 +2021-08-16T18:00Z,39969 +2021-08-16T19:00Z,41984 +2021-08-16T20:00Z,44207 +2021-08-16T21:00Z,46925 +2021-08-16T22:00Z,49465 +2021-08-16T23:00Z,51329 +2021-08-17,52624 +2021-08-17T01:00Z,52947 +2021-08-17T02:00Z,51926 +2021-08-17T03:00Z,50000 +2021-08-17T04:00Z,47989 +2021-08-17T05:00Z,45234 +2021-08-17T06:00Z,41333 +2021-08-17T07:00Z,37673 +2021-08-17T08:00Z,35405 +2021-08-17T09:00Z,33435 +2021-08-17T10:00Z,32466 +2021-08-17T11:00Z,31361 +2021-08-17T12:00Z,31245 +2021-08-17T13:00Z,32338 +2021-08-17T14:00Z,33948 +2021-08-17T15:00Z,35383 +2021-08-17T16:00Z,37033 +2021-08-17T17:00Z,38281 +2021-08-17T18:00Z,39118 +2021-08-17T19:00Z,40313 +2021-08-17T20:00Z,41742 +2021-08-17T21:00Z,43196 +2021-08-17T22:00Z,45091 +2021-08-17T23:00Z,46718 +2021-08-18,47820 +2021-08-18T01:00Z,48091 +2021-08-18T02:00Z,47409 +2021-08-18T03:00Z,45834 +2021-08-18T04:00Z,44342 +2021-08-18T05:00Z,41859 +2021-08-18T06:00Z,38372 +2021-08-18T07:00Z,35355 +2021-08-18T08:00Z,33054 +2021-08-18T09:00Z,31313 +2021-08-18T10:00Z,30335 +2021-08-18T11:00Z,29892 +2021-08-18T12:00Z,29952 +2021-08-18T13:00Z,30742 +2021-08-18T14:00Z,32718 +2021-08-18T15:00Z,33899 +2021-08-18T16:00Z,35592 +2021-08-18T17:00Z,36352 +2021-08-18T18:00Z,36673 +2021-08-18T19:00Z,36688 +2021-08-18T20:00Z,36719 +2021-08-18T21:00Z,37087 +2021-08-18T22:00Z,38063 +2021-08-18T23:00Z,39043 +2021-08-19,39924 +2021-08-19T01:00Z,40144 +2021-08-19T02:00Z,40191 +2021-08-19T03:00Z,40085 +2021-08-19T04:00Z,39823 +2021-08-19T05:00Z,38420 +2021-08-19T06:00Z,35696 +2021-08-19T07:00Z,33093 +2021-08-19T08:00Z,31143 +2021-08-19T09:00Z,29837 +2021-08-19T10:00Z,29030 +2021-08-19T11:00Z,28391 +2021-08-19T12:00Z,28631 +2021-08-19T13:00Z,29832 +2021-08-19T14:00Z,31696 +2021-08-19T15:00Z,32981 +2021-08-19T16:00Z,34319 +2021-08-19T17:00Z,35211 +2021-08-19T18:00Z,35499 +2021-08-19T19:00Z,35803 +2021-08-19T20:00Z,36152 +2021-08-19T21:00Z,36857 +2021-08-19T22:00Z,38508 +2021-08-19T23:00Z,40349 +2021-08-20,41438 +2021-08-20T01:00Z,41969 +2021-08-20T02:00Z,41594 +2021-08-20T03:00Z,40769 +2021-08-20T04:00Z,40255 +2021-08-20T05:00Z,38503 +2021-08-20T06:00Z,35699 +2021-08-20T07:00Z,32968 +2021-08-20T08:00Z,30931 +2021-08-20T09:00Z,29635 +2021-08-20T10:00Z,28554 +2021-08-20T11:00Z,27890 +2021-08-20T12:00Z,28127 +2021-08-20T13:00Z,29333 +2021-08-20T14:00Z,31317 +2021-08-20T15:00Z,32799 +2021-08-20T16:00Z,33912 +2021-08-20T17:00Z,34093 +2021-08-20T18:00Z,34115 +2021-08-20T19:00Z,34376 +2021-08-20T20:00Z,34686 +2021-08-20T21:00Z,35716 +2021-08-20T22:00Z,37414 +2021-08-20T23:00Z,39225 +2021-08-21,40533 +2021-08-21T01:00Z,41051 +2021-08-21T02:00Z,40694 +2021-08-21T03:00Z,39970 +2021-08-21T04:00Z,39309 +2021-08-21T05:00Z,37633 +2021-08-21T06:00Z,35230 +2021-08-21T07:00Z,32764 +2021-08-21T08:00Z,30873 +2021-08-21T09:00Z,29155 +2021-08-21T10:00Z,28024 +2021-08-21T11:00Z,27380 +2021-08-21T12:00Z,27227 +2021-08-21T13:00Z,27520 +2021-08-21T14:00Z,28273 +2021-08-21T15:00Z,28979 +2021-08-21T16:00Z,29911 +2021-08-21T17:00Z,30305 +2021-08-21T18:00Z,30228 +2021-08-21T19:00Z,30282 +2021-08-21T20:00Z,29986 +2021-08-21T21:00Z,29894 +2021-08-21T22:00Z,30498 +2021-08-21T23:00Z,31458 +2021-08-22,33304 +2021-08-22T01:00Z,34498 +2021-08-22T02:00Z,35635 +2021-08-22T03:00Z,35966 +2021-08-22T04:00Z,35752 +2021-08-22T05:00Z,34405 +2021-08-22T06:00Z,32316 +2021-08-22T07:00Z,30269 +2021-08-22T08:00Z,28813 +2021-08-22T09:00Z,27502 +2021-08-22T10:00Z,26512 +2021-08-22T11:00Z,25901 +2021-08-22T12:00Z,25643 +2021-08-22T13:00Z,25727 +2021-08-22T14:00Z,25915 +2021-08-22T15:00Z,26538 +2021-08-22T16:00Z,27706 +2021-08-22T17:00Z,28151 +2021-08-22T18:00Z,28161 +2021-08-22T19:00Z,27818 +2021-08-22T20:00Z,28147 +2021-08-22T21:00Z,28716 +2021-08-22T22:00Z,30035 +2021-08-22T23:00Z,32063 +2021-08-23,33908 +2021-08-23T01:00Z,35911 +2021-08-23T02:00Z,36997 +2021-08-23T03:00Z,36894 +2021-08-23T04:00Z,36676 +2021-08-23T05:00Z,35116 +2021-08-23T06:00Z,32593 +2021-08-23T07:00Z,30121 +2021-08-23T08:00Z,28286 +2021-08-23T09:00Z,27023 +2021-08-23T10:00Z,26150 +2021-08-23T11:00Z,25830 +2021-08-23T12:00Z,26229 +2021-08-23T13:00Z,27530 +2021-08-23T14:00Z,29470 +2021-08-23T15:00Z,30667 +2021-08-23T16:00Z,31753 +2021-08-23T17:00Z,32861 +2021-08-23T18:00Z,33234 +2021-08-23T19:00Z,33075 +2021-08-23T20:00Z,33400 +2021-08-23T21:00Z,34294 +2021-08-23T22:00Z,35778 +2021-08-23T23:00Z,37735 +2021-08-24,39527 +2021-08-24T01:00Z,40732 +2021-08-24T02:00Z,40914 +2021-08-24T03:00Z,40384 +2021-08-24T04:00Z,39751 +2021-08-24T05:00Z,37775 +2021-08-24T06:00Z,34643 +2021-08-24T07:00Z,31948 +2021-08-24T08:00Z,29740 +2021-08-24T09:00Z,28240 +2021-08-24T10:00Z,27217 +2021-08-24T11:00Z,26723 +2021-08-24T12:00Z,26969 +2021-08-24T13:00Z,28137 +2021-08-24T14:00Z,30025 +2021-08-24T15:00Z,30899 +2021-08-24T16:00Z,31921 +2021-08-24T17:00Z,32311 +2021-08-24T18:00Z,32999 +2021-08-24T19:00Z,33412 +2021-08-24T20:00Z,34125 +2021-08-24T21:00Z,35213 +2021-08-24T22:00Z,37231 +2021-08-24T23:00Z,39272 +2021-08-25,40992 +2021-08-25T01:00Z,42111 +2021-08-25T02:00Z,42107 +2021-08-25T03:00Z,41312 +2021-08-25T04:00Z,40499 +2021-08-25T05:00Z,38424 +2021-08-25T06:00Z,35237 +2021-08-25T07:00Z,32278 +2021-08-25T08:00Z,30454 +2021-08-25T09:00Z,28927 +2021-08-25T10:00Z,27956 +2021-08-25T11:00Z,27784 +2021-08-25T12:00Z,27552 +2021-08-25T13:00Z,28643 +2021-08-25T14:00Z,30275 +2021-08-25T15:00Z,31334 +2021-08-25T16:00Z,32516 +2021-08-25T17:00Z,33415 +2021-08-25T18:00Z,33883 +2021-08-25T19:00Z,34318 +2021-08-25T20:00Z,35529 +2021-08-25T21:00Z,37733 +2021-08-25T22:00Z,40395 +2021-08-25T23:00Z,42754 +2021-08-26,44997 +2021-08-26T01:00Z,45973 +2021-08-26T02:00Z,45837 +2021-08-26T03:00Z,44525 +2021-08-26T04:00Z,43197 +2021-08-26T05:00Z,40697 +2021-08-26T06:00Z,37181 +2021-08-26T07:00Z,34003 +2021-08-26T08:00Z,31737 +2021-08-26T09:00Z,29994 +2021-08-26T10:00Z,28959 +2021-08-26T11:00Z,28051 +2021-08-26T12:00Z,28054 +2021-08-26T13:00Z,29080 +2021-08-26T14:00Z,31018 +2021-08-26T15:00Z,32332 +2021-08-26T16:00Z,33712 +2021-08-26T17:00Z,34804 +2021-08-26T18:00Z,35335 +2021-08-26T19:00Z,36623 +2021-08-26T20:00Z,38744 +2021-08-26T21:00Z,41519 +2021-08-26T22:00Z,44319 +2021-08-26T23:00Z,46867 +2021-08-27,49208 +2021-08-27T01:00Z,50124 +2021-08-27T02:00Z,49518 +2021-08-27T03:00Z,47709 +2021-08-27T04:00Z,45845 +2021-08-27T05:00Z,42836 +2021-08-27T06:00Z,38939 +2021-08-27T07:00Z,35354 +2021-08-27T08:00Z,32831 +2021-08-27T09:00Z,30825 +2021-08-27T10:00Z,29245 +2021-08-27T11:00Z,28414 +2021-08-27T12:00Z,28658 +2021-08-27T13:00Z,29571 +2021-08-27T14:00Z,31058 +2021-08-27T15:00Z,31849 +2021-08-27T16:00Z,33916 +2021-08-27T17:00Z,34861 +2021-08-27T18:00Z,36377 +2021-08-27T19:00Z,38173 +2021-08-27T20:00Z,40534 +2021-08-27T21:00Z,43482 +2021-08-27T22:00Z,46600 +2021-08-27T23:00Z,49509 +2021-08-28,51601 +2021-08-28T01:00Z,52263 +2021-08-28T02:00Z,51397 +2021-08-28T03:00Z,49291 +2021-08-28T04:00Z,47045 +2021-08-28T05:00Z,44001 +2021-08-28T06:00Z,40233 +2021-08-28T07:00Z,36711 +2021-08-28T08:00Z,34141 +2021-08-28T09:00Z,31878 +2021-08-28T10:00Z,30460 +2021-08-28T11:00Z,29232 +2021-08-28T12:00Z,28636 +2021-08-28T13:00Z,28734 +2021-08-28T14:00Z,29051 +2021-08-28T15:00Z,29542 +2021-08-28T16:00Z,31383 +2021-08-28T17:00Z,32553 +2021-08-28T18:00Z,34127 +2021-08-28T19:00Z,36263 +2021-08-28T20:00Z,38289 +2021-08-28T21:00Z,40797 +2021-08-28T22:00Z,43701 +2021-08-28T23:00Z,46364 +2021-08-29,48320 +2021-08-29T01:00Z,49234 +2021-08-29T02:00Z,48555 +2021-08-29T03:00Z,46550 +2021-08-29T04:00Z,44417 +2021-08-29T05:00Z,41773 +2021-08-29T06:00Z,38906 +2021-08-29T07:00Z,35396 +2021-08-29T08:00Z,32776 +2021-08-29T09:00Z,30906 +2021-08-29T10:00Z,29432 +2021-08-29T11:00Z,29103 +2021-08-29T12:00Z,28444 +2021-08-29T13:00Z,28454 +2021-08-29T14:00Z,28287 +2021-08-29T15:00Z,28546 +2021-08-29T16:00Z,29969 +2021-08-29T17:00Z,30478 +2021-08-29T18:00Z,32485 +2021-08-29T19:00Z,34502 +2021-08-29T20:00Z,36612 +2021-08-29T21:00Z,39380 +2021-08-29T22:00Z,42687 +2021-08-29T23:00Z,44963 +2021-08-30,46754 +2021-08-30T01:00Z,47820 +2021-08-30T02:00Z,47660 +2021-08-30T03:00Z,46244 +2021-08-30T04:00Z,44484 +2021-08-30T05:00Z,41717 +2021-08-30T06:00Z,38147 +2021-08-30T07:00Z,34813 +2021-08-30T08:00Z,32525 +2021-08-30T09:00Z,31143 +2021-08-30T10:00Z,30097 +2021-08-30T11:00Z,29604 +2021-08-30T12:00Z,29574 +2021-08-30T13:00Z,30105 +2021-08-30T14:00Z,32244 +2021-08-30T15:00Z,34237 +2021-08-30T16:00Z,34676 +2021-08-30T17:00Z,36498 +2021-08-30T18:00Z,37559 +2021-08-30T19:00Z,38951 +2021-08-30T20:00Z,40922 +2021-08-30T21:00Z,43104 +2021-08-30T22:00Z,45425 +2021-08-30T23:00Z,47632 +2021-08-31,49023 +2021-08-31T01:00Z,49879 +2021-08-31T02:00Z,48739 +2021-08-31T03:00Z,46748 +2021-08-31T04:00Z,44728 +2021-08-31T05:00Z,41747 +2021-08-31T06:00Z,38153 +2021-08-31T07:00Z,34937 +2021-08-31T08:00Z,32596 +2021-08-31T09:00Z,30668 +2021-08-31T10:00Z,29463 +2021-08-31T11:00Z,28909 +2021-08-31T12:00Z,29052 +2021-08-31T13:00Z,30323 +2021-08-31T14:00Z,32197 +2021-08-31T15:00Z,33690 +2021-08-31T16:00Z,35051 +2021-08-31T17:00Z,35856 +2021-08-31T18:00Z,36483 +2021-08-31T19:00Z,37003 +2021-08-31T20:00Z,37386 +2021-08-31T21:00Z,38555 +2021-08-31T22:00Z,39903 +2021-08-31T23:00Z,41493 +2021-09-01,42368 +2021-09-01T01:00Z,43285 +2021-09-01T02:00Z,42690 +2021-09-01T03:00Z,41817 +2021-09-01T04:00Z,40527 +2021-09-01T05:00Z,38342 +2021-09-01T06:00Z,35290 +2021-09-01T07:00Z,32426 +2021-09-01T08:00Z,30414 +2021-09-01T09:00Z,28999 +2021-09-01T10:00Z,27872 +2021-09-01T11:00Z,27582 +2021-09-01T12:00Z,27684 +2021-09-01T13:00Z,28956 +2021-09-01T14:00Z,30988 +2021-09-01T15:00Z,32447 +2021-09-01T16:00Z,33241 +2021-09-01T17:00Z,33757 +2021-09-01T18:00Z,34264 +2021-09-01T19:00Z,34417 +2021-09-01T20:00Z,34487 +2021-09-01T21:00Z,34617 +2021-09-01T22:00Z,35573 +2021-09-01T23:00Z,37017 +2021-09-02,37882 +2021-09-02T01:00Z,38987 +2021-09-02T02:00Z,39431 +2021-09-02T03:00Z,39242 +2021-09-02T04:00Z,38755 +2021-09-02T05:00Z,36905 +2021-09-02T06:00Z,34213 +2021-09-02T07:00Z,31635 +2021-09-02T08:00Z,29793 +2021-09-02T09:00Z,28557 +2021-09-02T10:00Z,27802 +2021-09-02T11:00Z,27504 +2021-09-02T12:00Z,27423 +2021-09-02T13:00Z,28720 +2021-09-02T14:00Z,30771 +2021-09-02T15:00Z,32174 +2021-09-02T16:00Z,33281 +2021-09-02T17:00Z,34198 +2021-09-02T18:00Z,34017 +2021-09-02T19:00Z,33683 +2021-09-02T20:00Z,33827 +2021-09-02T21:00Z,34733 +2021-09-02T22:00Z,35553 +2021-09-02T23:00Z,38298 +2021-09-03,39269 +2021-09-03T01:00Z,40041 +2021-09-03T02:00Z,39718 +2021-09-03T03:00Z,39304 +2021-09-03T04:00Z,38497 +2021-09-03T05:00Z,36887 +2021-09-03T06:00Z,34126 +2021-09-03T07:00Z,31480 +2021-09-03T08:00Z,29532 +2021-09-03T09:00Z,28284 +2021-09-03T10:00Z,27300 +2021-09-03T11:00Z,26831 +2021-09-03T12:00Z,26949 +2021-09-03T13:00Z,28040 +2021-09-03T14:00Z,29826 +2021-09-03T15:00Z,31177 +2021-09-03T16:00Z,32625 +2021-09-03T17:00Z,33045 +2021-09-03T18:00Z,33174 +2021-09-03T19:00Z,33522 +2021-09-03T20:00Z,34791 +2021-09-03T21:00Z,35542 +2021-09-03T22:00Z,36983 +2021-09-03T23:00Z,39058 +2021-09-04,41098 +2021-09-04T01:00Z,42354 +2021-09-04T02:00Z,42174 +2021-09-04T03:00Z,41038 +2021-09-04T04:00Z,39617 +2021-09-04T05:00Z,37531 +2021-09-04T06:00Z,34656 +2021-09-04T07:00Z,32117 +2021-09-04T08:00Z,30075 +2021-09-04T09:00Z,28357 +2021-09-04T10:00Z,27181 +2021-09-04T11:00Z,26467 +2021-09-04T12:00Z,28574 +2021-09-04T13:00Z,26408 +2021-09-04T14:00Z,26718 +2021-09-04T15:00Z,27036 +2021-09-04T16:00Z,28899 +2021-09-04T17:00Z,29678 +2021-09-04T18:00Z,30152 +2021-09-04T19:00Z,31227 +2021-09-04T20:00Z,32805 +2021-09-04T21:00Z,34570 +2021-09-04T22:00Z,37040 +2021-09-04T23:00Z,39845 +2021-09-05,42421 +2021-09-05T01:00Z,44229 +2021-09-05T02:00Z,44401 +2021-09-05T03:00Z,42819 +2021-09-05T04:00Z,40844 +2021-09-05T05:00Z,38364 +2021-09-05T06:00Z,35345 +2021-09-05T07:00Z,32577 +2021-09-05T08:00Z,30318 +2021-09-05T09:00Z,28560 +2021-09-05T10:00Z,27316 +2021-09-05T11:00Z,26298 +2021-09-05T12:00Z,25789 +2021-09-05T13:00Z,25774 +2021-09-05T14:00Z,25914 +2021-09-05T15:00Z,26452 +2021-09-05T16:00Z,27417 +2021-09-05T17:00Z,28079 +2021-09-05T18:00Z,29417 +2021-09-05T19:00Z,31568 +2021-09-05T20:00Z,33923 +2021-09-05T21:00Z,36441 +2021-09-05T22:00Z,39715 +2021-09-05T23:00Z,42812 +2021-09-06,45232 +2021-09-06T01:00Z,46926 +2021-09-06T02:00Z,46751 +2021-09-06T03:00Z,45066 +2021-09-06T04:00Z,42963 +2021-09-06T05:00Z,40299 +2021-09-06T06:00Z,37158 +2021-09-06T07:00Z,34165 +2021-09-06T08:00Z,31789 +2021-09-06T09:00Z,29938 +2021-09-06T10:00Z,28652 +2021-09-06T11:00Z,27890 +2021-09-06T12:00Z,27473 +2021-09-06T13:00Z,27757 +2021-09-06T14:00Z,28244 +2021-09-06T15:00Z,28925 +2021-09-06T16:00Z,30471 +2021-09-06T17:00Z,31463 +2021-09-06T18:00Z,32982 +2021-09-06T19:00Z,35080 +2021-09-06T20:00Z,37315 +2021-09-06T21:00Z,40128 +2021-09-06T22:00Z,43221 +2021-09-06T23:00Z,46041 +2021-09-07,48086 +2021-09-07T01:00Z,49359 +2021-09-07T02:00Z,48668 +2021-09-07T03:00Z,47007 +2021-09-07T04:00Z,44935 +2021-09-07T05:00Z,42003 +2021-09-07T06:00Z,38203 +2021-09-07T07:00Z,35005 +2021-09-07T08:00Z,32643 +2021-09-07T09:00Z,30876 +2021-09-07T10:00Z,29759 +2021-09-07T11:00Z,29047 +2021-09-07T12:00Z,29170 +2021-09-07T13:00Z,30432 +2021-09-07T14:00Z,32463 +2021-09-07T15:00Z,34092 +2021-09-07T16:00Z,35855 +2021-09-07T17:00Z,36884 +2021-09-07T18:00Z,38310 +2021-09-07T19:00Z,39845 +2021-09-07T20:00Z,41999 +2021-09-07T21:00Z,44862 +2021-09-07T22:00Z,47925 +2021-09-07T23:00Z,50741 +2021-09-08,52526 +2021-09-08T01:00Z,52891 +2021-09-08T02:00Z,51596 +2021-09-08T03:00Z,49688 +2021-09-08T04:00Z,47390 +2021-09-08T05:00Z,44453 +2021-09-08T06:00Z,40516 +2021-09-08T07:00Z,36953 +2021-09-08T08:00Z,34505 +2021-09-08T09:00Z,32727 +2021-09-08T10:00Z,31550 +2021-09-08T11:00Z,30663 +2021-09-08T12:00Z,30428 +2021-09-08T13:00Z,31347 +2021-09-08T14:00Z,32931 +2021-09-08T15:00Z,34176 +2021-09-08T16:00Z,35674 +2021-09-08T17:00Z,36648 +2021-09-08T18:00Z,38135 +2021-09-08T19:00Z,40038 +2021-09-08T20:00Z,42821 +2021-09-08T21:00Z,45792 +2021-09-08T22:00Z,49006 +2021-09-08T23:00Z,52026 +2021-09-09,53947 +2021-09-09T01:00Z,54543 +2021-09-09T02:00Z,53248 +2021-09-09T03:00Z,51056 +2021-09-09T04:00Z,48541 +2021-09-09T05:00Z,45114 +2021-09-09T06:00Z,41114 +2021-09-09T07:00Z,37398 +2021-09-09T08:00Z,35057 +2021-09-09T09:00Z,33077 +2021-09-09T10:00Z,31901 +2021-09-09T11:00Z,30972 +2021-09-09T12:00Z,31249 +2021-09-09T13:00Z,32208 +2021-09-09T14:00Z,34118 +2021-09-09T15:00Z,35502 +2021-09-09T16:00Z,37353 +2021-09-09T17:00Z,38756 +2021-09-09T18:00Z,40483 +2021-09-09T19:00Z,42150 +2021-09-09T20:00Z,44817 +2021-09-09T21:00Z,47688 +2021-09-09T22:00Z,50726 +2021-09-09T23:00Z,53066 +2021-09-10,53825 +2021-09-10T01:00Z,53780 +2021-09-10T02:00Z,51851 +2021-09-10T03:00Z,50034 +2021-09-10T04:00Z,47699 +2021-09-10T05:00Z,44823 +2021-09-10T06:00Z,41203 +2021-09-10T07:00Z,37710 +2021-09-10T08:00Z,34967 +2021-09-10T09:00Z,33193 +2021-09-10T10:00Z,31886 +2021-09-10T11:00Z,31162 +2021-09-10T12:00Z,31042 +2021-09-10T13:00Z,32092 +2021-09-10T14:00Z,34160 +2021-09-10T15:00Z,35466 +2021-09-10T16:00Z,37581 +2021-09-10T17:00Z,38477 +2021-09-10T18:00Z,39722 +2021-09-10T19:00Z,41110 +2021-09-10T20:00Z,42026 +2021-09-10T21:00Z,44495 +2021-09-10T22:00Z,46587 +2021-09-10T23:00Z,48487 +2021-09-11,49747 +2021-09-11T01:00Z,49920 +2021-09-11T02:00Z,48563 +2021-09-11T03:00Z,46737 +2021-09-11T04:00Z,44748 +2021-09-11T05:00Z,42224 +2021-09-11T06:00Z,39097 +2021-09-11T07:00Z,36218 +2021-09-11T08:00Z,34058 +2021-09-11T09:00Z,32059 +2021-09-11T10:00Z,30694 +2021-09-11T11:00Z,29753 +2021-09-11T12:00Z,29395 +2021-09-11T13:00Z,29742 +2021-09-11T14:00Z,30087 +2021-09-11T15:00Z,30291 +2021-09-11T16:00Z,31501 +2021-09-11T17:00Z,32528 +2021-09-11T18:00Z,33980 +2021-09-11T19:00Z,35519 +2021-09-11T20:00Z,37989 +2021-09-11T21:00Z,40446 +2021-09-11T22:00Z,42908 +2021-09-11T23:00Z,44872 +2021-09-12,46507 +2021-09-12T01:00Z,47604 +2021-09-12T02:00Z,47140 +2021-09-12T03:00Z,45385 +2021-09-12T04:00Z,43296 +2021-09-12T05:00Z,40726 +2021-09-12T06:00Z,37546 +2021-09-12T07:00Z,34755 +2021-09-12T08:00Z,32330 +2021-09-12T09:00Z,30665 +2021-09-12T10:00Z,29526 +2021-09-12T11:00Z,28592 +2021-09-12T12:00Z,27977 +2021-09-12T13:00Z,27856 +2021-09-12T14:00Z,27916 +2021-09-12T15:00Z,28049 +2021-09-12T16:00Z,28817 +2021-09-12T17:00Z,29721 +2021-09-12T18:00Z,31306 +2021-09-12T19:00Z,32657 +2021-09-12T20:00Z,34809 +2021-09-12T21:00Z,37700 +2021-09-12T22:00Z,40885 +2021-09-12T23:00Z,42999 +2021-09-13,44850 +2021-09-13T01:00Z,46457 +2021-09-13T02:00Z,46220 +2021-09-13T03:00Z,44594 +2021-09-13T04:00Z,42405 +2021-09-13T05:00Z,39510 +2021-09-13T06:00Z,36059 +2021-09-13T07:00Z,32768 +2021-09-13T08:00Z,31127 +2021-09-13T09:00Z,29790 +2021-09-13T10:00Z,28424 +2021-09-13T11:00Z,27795 +2021-09-13T12:00Z,27881 +2021-09-13T13:00Z,29208 +2021-09-13T14:00Z,31323 +2021-09-13T15:00Z,32446 +2021-09-13T16:00Z,33393 +2021-09-13T17:00Z,33884 +2021-09-13T18:00Z,35084 +2021-09-13T19:00Z,36848 +2021-09-13T20:00Z,39203 +2021-09-13T21:00Z,41593 +2021-09-13T22:00Z,43913 +2021-09-13T23:00Z,46696 +2021-09-14,48552 +2021-09-14T01:00Z,49396 +2021-09-14T02:00Z,48117 +2021-09-14T03:00Z,46188 +2021-09-14T04:00Z,43617 +2021-09-14T05:00Z,40348 +2021-09-14T06:00Z,36756 +2021-09-14T07:00Z,33524 +2021-09-14T08:00Z,31010 +2021-09-14T09:00Z,29376 +2021-09-14T10:00Z,28147 +2021-09-14T11:00Z,27382 +2021-09-14T12:00Z,27533 +2021-09-14T13:00Z,28703 +2021-09-14T14:00Z,30785 +2021-09-14T15:00Z,31904 +2021-09-14T16:00Z,33036 +2021-09-14T17:00Z,33272 +2021-09-14T18:00Z,33990 +2021-09-14T19:00Z,35078 +2021-09-14T20:00Z,36558 +2021-09-14T21:00Z,38944 +2021-09-14T22:00Z,41553 +2021-09-14T23:00Z,44199 +2021-09-15,46030 +2021-09-15T01:00Z,46877 +2021-09-15T02:00Z,45965 +2021-09-15T03:00Z,44255 +2021-09-15T04:00Z,42017 +2021-09-15T05:00Z,39228 +2021-09-15T06:00Z,35807 +2021-09-15T07:00Z,32830 +2021-09-15T08:00Z,30628 +2021-09-15T09:00Z,29080 +2021-09-15T10:00Z,27914 +2021-09-15T11:00Z,27354 +2021-09-15T12:00Z,27451 +2021-09-15T13:00Z,28624 +2021-09-15T14:00Z,30727 +2021-09-15T15:00Z,31922 +2021-09-15T16:00Z,32797 +2021-09-15T17:00Z,32756 +2021-09-15T18:00Z,32815 +2021-09-15T19:00Z,33578 +2021-09-15T20:00Z,34380 +2021-09-15T21:00Z,35787 +2021-09-15T22:00Z,38243 +2021-09-15T23:00Z,40296 +2021-09-16,42020 +2021-09-16T01:00Z,42973 +2021-09-16T02:00Z,42502 +2021-09-16T03:00Z,41497 +2021-09-16T04:00Z,39643 +2021-09-16T05:00Z,37327 +2021-09-16T06:00Z,34385 +2021-09-16T07:00Z,31473 +2021-09-16T08:00Z,29539 +2021-09-16T09:00Z,28334 +2021-09-16T10:00Z,27548 +2021-09-16T11:00Z,27143 +2021-09-16T12:00Z,27033 +2021-09-16T13:00Z,28079 +2021-09-16T14:00Z,30173 +2021-09-16T15:00Z,31321 +2021-09-16T16:00Z,31961 +2021-09-16T17:00Z,31983 +2021-09-16T18:00Z,31867 +2021-09-16T19:00Z,31801 +2021-09-16T20:00Z,33105 +2021-09-16T21:00Z,32964 +2021-09-16T22:00Z,34091 +2021-09-16T23:00Z,35896 +2021-09-17,37704 +2021-09-17T01:00Z,39205 +2021-09-17T02:00Z,39413 +2021-09-17T03:00Z,39073 +2021-09-17T04:00Z,37692 +2021-09-17T05:00Z,35760 +2021-09-17T06:00Z,32956 +2021-09-17T07:00Z,30497 +2021-09-17T08:00Z,28851 +2021-09-17T09:00Z,27569 +2021-09-17T10:00Z,26643 +2021-09-17T11:00Z,26227 +2021-09-17T12:00Z,26455 +2021-09-17T13:00Z,27634 +2021-09-17T14:00Z,29732 +2021-09-17T15:00Z,30867 +2021-09-17T16:00Z,31716 +2021-09-17T17:00Z,31338 +2021-09-17T18:00Z,30978 +2021-09-17T19:00Z,31258 +2021-09-17T20:00Z,31828 +2021-09-17T21:00Z,32732 +2021-09-17T22:00Z,33661 +2021-09-17T23:00Z,35706 +2021-09-18,37455 +2021-09-18T01:00Z,38611 +2021-09-18T02:00Z,38500 +2021-09-18T03:00Z,38241 +2021-09-18T04:00Z,36765 +2021-09-18T05:00Z,35019 +2021-09-18T06:00Z,32811 +2021-09-18T07:00Z,30635 +2021-09-18T08:00Z,28950 +2021-09-18T09:00Z,27587 +2021-09-18T10:00Z,26718 +2021-09-18T11:00Z,26170 +2021-09-18T12:00Z,26037 +2021-09-18T13:00Z,26425 +2021-09-18T14:00Z,27231 +2021-09-18T15:00Z,27429 +2021-09-18T16:00Z,27588 +2021-09-18T17:00Z,27827 +2021-09-18T18:00Z,27974 +2021-09-18T19:00Z,27553 +2021-09-18T20:00Z,28167 +2021-09-18T21:00Z,28953 +2021-09-18T22:00Z,29973 +2021-09-18T23:00Z,31599 +2021-09-19,32992 +2021-09-19T01:00Z,34354 +2021-09-19T02:00Z,35121 +2021-09-19T03:00Z,35195 +2021-09-19T04:00Z,34248 +2021-09-19T05:00Z,32991 +2021-09-19T06:00Z,31145 +2021-09-19T07:00Z,29167 +2021-09-19T08:00Z,27713 +2021-09-19T09:00Z,26432 +2021-09-19T10:00Z,25526 +2021-09-19T11:00Z,24989 +2021-09-19T12:00Z,24722 +2021-09-19T13:00Z,24910 +2021-09-19T14:00Z,25279 +2021-09-19T15:00Z,25151 +2021-09-19T16:00Z,26043 +2021-09-19T17:00Z,26120 +2021-09-19T18:00Z,26306 +2021-09-19T19:00Z,26313 +2021-09-19T20:00Z,26590 +2021-09-19T21:00Z,27529 +2021-09-19T22:00Z,29084 +2021-09-19T23:00Z,30387 +2021-09-20,32235 +2021-09-20T01:00Z,33743 +2021-09-20T02:00Z,34811 +2021-09-20T03:00Z,35268 +2021-09-20T04:00Z,34368 +2021-09-20T05:00Z,32909 +2021-09-20T06:00Z,30651 +2021-09-20T07:00Z,28509 +2021-09-20T08:00Z,27105 +2021-09-20T09:00Z,26001 +2021-09-20T10:00Z,25503 +2021-09-20T11:00Z,25095 +2021-09-20T12:00Z,25304 +2021-09-20T13:00Z,26645 +2021-09-20T14:00Z,28974 +2021-09-20T15:00Z,30044 +2021-09-20T16:00Z,30743 +2021-09-20T17:00Z,30688 +2021-09-20T18:00Z,30926 +2021-09-20T19:00Z,32004 +2021-09-20T20:00Z,33100 +2021-09-20T21:00Z,34361 +2021-09-20T22:00Z,36149 +2021-09-20T23:00Z,38582 +2021-09-21,40854 +2021-09-21T01:00Z,42400 +2021-09-21T02:00Z,42134 +2021-09-21T03:00Z,41524 +2021-09-21T04:00Z,39817 +2021-09-21T05:00Z,37493 +2021-09-21T06:00Z,34424 +2021-09-21T07:00Z,31764 +2021-09-21T08:00Z,29769 +2021-09-21T09:00Z,28523 +2021-09-21T10:00Z,27694 +2021-09-21T11:00Z,27065 +2021-09-21T12:00Z,27113 +2021-09-21T13:00Z,28226 +2021-09-21T14:00Z,30515 +2021-09-21T15:00Z,31371 +2021-09-21T16:00Z,32464 +2021-09-21T17:00Z,33527 +2021-09-21T18:00Z,34766 +2021-09-21T19:00Z,36381 +2021-09-21T20:00Z,38823 +2021-09-21T21:00Z,41486 +2021-09-21T22:00Z,44523 +2021-09-21T23:00Z,47734 +2021-09-22,49826 +2021-09-22T01:00Z,50550 +2021-09-22T02:00Z,49076 +2021-09-22T03:00Z,47442 +2021-09-22T04:00Z,44895 +2021-09-22T05:00Z,41811 +2021-09-22T06:00Z,38070 +2021-09-22T07:00Z,34767 +2021-09-22T08:00Z,32383 +2021-09-22T09:00Z,30575 +2021-09-22T10:00Z,29306 +2021-09-22T11:00Z,28641 +2021-09-22T12:00Z,28740 +2021-09-22T13:00Z,29807 +2021-09-22T14:00Z,31938 +2021-09-22T15:00Z,33038 +2021-09-22T16:00Z,34286 +2021-09-22T17:00Z,35612 +2021-09-22T18:00Z,37028 +2021-09-22T19:00Z,39013 +2021-09-22T20:00Z,41680 +2021-09-22T21:00Z,44566 +2021-09-22T22:00Z,47189 +2021-09-22T23:00Z,49343 +2021-09-23,50009 +2021-09-23T01:00Z,50027 +2021-09-23T02:00Z,48380 +2021-09-23T03:00Z,46739 +2021-09-23T04:00Z,44259 +2021-09-23T05:00Z,41318 +2021-09-23T06:00Z,37810 +2021-09-23T07:00Z,34470 +2021-09-23T08:00Z,31879 +2021-09-23T09:00Z,30035 +2021-09-23T10:00Z,28826 +2021-09-23T11:00Z,28380 +2021-09-23T12:00Z,28196 +2021-09-23T13:00Z,29310 +2021-09-23T14:00Z,31380 +2021-09-23T15:00Z,32429 +2021-09-23T16:00Z,33687 +2021-09-23T17:00Z,34499 +2021-09-23T18:00Z,35407 +2021-09-23T19:00Z,36591 +2021-09-23T20:00Z,38139 +2021-09-23T21:00Z,40536 +2021-09-23T22:00Z,42443 +2021-09-23T23:00Z,43880 +2021-09-24,44789 +2021-09-24T01:00Z,44788 +2021-09-24T02:00Z,43677 +2021-09-24T03:00Z,42213 +2021-09-24T04:00Z,40765 +2021-09-24T05:00Z,38330 +2021-09-24T06:00Z,35250 +2021-09-24T07:00Z,32492 +2021-09-24T08:00Z,30578 +2021-09-24T09:00Z,29068 +2021-09-24T10:00Z,28018 +2021-09-24T11:00Z,27536 +2021-09-24T12:00Z,27603 +2021-09-24T13:00Z,28805 +2021-09-24T14:00Z,30718 +2021-09-24T15:00Z,32003 +2021-09-24T16:00Z,32780 +2021-09-24T17:00Z,33174 +2021-09-24T18:00Z,34024 +2021-09-24T19:00Z,34718 +2021-09-24T20:00Z,36231 +2021-09-24T21:00Z,38251 +2021-09-24T22:00Z,40204 +2021-09-24T23:00Z,41429 +2021-09-25,41882 +2021-09-25T01:00Z,41662 +2021-09-25T02:00Z,40740 +2021-09-25T03:00Z,40001 +2021-09-25T04:00Z,38249 +2021-09-25T05:00Z,36378 +2021-09-25T06:00Z,33856 +2021-09-25T07:00Z,31410 +2021-09-25T08:00Z,29633 +2021-09-25T09:00Z,28154 +2021-09-25T10:00Z,27196 +2021-09-25T11:00Z,26501 +2021-09-25T12:00Z,26243 +2021-09-25T13:00Z,26728 +2021-09-25T14:00Z,27529 +2021-09-25T15:00Z,27844 +2021-09-25T16:00Z,28610 +2021-09-25T17:00Z,29035 +2021-09-25T18:00Z,29246 +2021-09-25T19:00Z,29631 +2021-09-25T20:00Z,30622 +2021-09-25T21:00Z,32008 +2021-09-25T22:00Z,33844 +2021-09-25T23:00Z,35312 +2021-09-26,36592 +2021-09-26T01:00Z,37342 +2021-09-26T02:00Z,37150 +2021-09-26T03:00Z,36633 +2021-09-26T04:00Z,35093 +2021-09-26T05:00Z,33482 +2021-09-26T06:00Z,31534 +2021-09-26T07:00Z,29518 +2021-09-26T08:00Z,27979 +2021-09-26T09:00Z,26786 +2021-09-26T10:00Z,25849 +2021-09-26T11:00Z,25207 +2021-09-26T12:00Z,24949 +2021-09-26T13:00Z,25251 +2021-09-26T14:00Z,25729 +2021-09-26T15:00Z,25843 +2021-09-26T16:00Z,26603 +2021-09-26T17:00Z,27395 +2021-09-26T18:00Z,28049 +2021-09-26T19:00Z,27714 +2021-09-26T20:00Z,27481 +2021-09-26T21:00Z,27725 +2021-09-26T22:00Z,28482 +2021-09-26T23:00Z,29997 +2021-09-27,31403 +2021-09-27T01:00Z,32891 +2021-09-27T02:00Z,33645 +2021-09-27T03:00Z,34074 +2021-09-27T04:00Z,32979 +2021-09-27T05:00Z,31650 +2021-09-27T06:00Z,29678 +2021-09-27T07:00Z,27779 +2021-09-27T08:00Z,26661 +2021-09-27T09:00Z,25713 +2021-09-27T10:00Z,25020 +2021-09-27T11:00Z,24902 +2021-09-27T12:00Z,25363 +2021-09-27T13:00Z,26817 +2021-09-27T14:00Z,29175 +2021-09-27T15:00Z,30767 +2021-09-27T16:00Z,31844 +2021-09-27T17:00Z,32389 +2021-09-27T18:00Z,32566 +2021-09-27T19:00Z,32699 +2021-09-27T20:00Z,32498 +2021-09-27T21:00Z,32437 +2021-09-27T22:00Z,32551 +2021-09-27T23:00Z,33149 +2021-09-28,34011 +2021-09-28T01:00Z,34965 +2021-09-28T02:00Z,35592 +2021-09-28T03:00Z,36018 +2021-09-28T04:00Z,34890 +2021-09-28T05:00Z,33372 +2021-09-28T06:00Z,31123 +2021-09-28T07:00Z,29034 +2021-09-28T08:00Z,27724 +2021-09-28T09:00Z,26589 +2021-09-28T10:00Z,25880 +2021-09-28T11:00Z,25554 +2021-09-28T12:00Z,25853 +2021-09-28T13:00Z,27141 +2021-09-28T14:00Z,29501 +2021-09-28T15:00Z,30789 +2021-09-28T16:00Z,31686 +2021-09-28T17:00Z,31948 +2021-09-28T18:00Z,31511 +2021-09-28T19:00Z,31315 +2021-09-28T20:00Z,30759 +2021-09-28T21:00Z,30587 +2021-09-28T22:00Z,30779 +2021-09-28T23:00Z,31436 +2021-09-29,32766 +2021-09-29T01:00Z,33804 +2021-09-29T02:00Z,35589 +2021-09-29T03:00Z,35419 +2021-09-29T04:00Z,34383 +2021-09-29T05:00Z,32982 +2021-09-29T06:00Z,30943 +2021-09-29T07:00Z,28819 +2021-09-29T08:00Z,27138 +2021-09-29T09:00Z,26181 +2021-09-29T10:00Z,25444 +2021-09-29T11:00Z,25075 +2021-09-29T12:00Z,25356 +2021-09-29T13:00Z,26670 +2021-09-29T14:00Z,29097 +2021-09-29T15:00Z,30082 +2021-09-29T16:00Z,29963 +2021-09-29T17:00Z,30103 +2021-09-29T18:00Z,29583 +2021-09-29T19:00Z,29631 +2021-09-29T20:00Z,30075 +2021-09-29T21:00Z,30510 +2021-09-29T22:00Z,31349 +2021-09-29T23:00Z,32677 +2021-09-30,33847 +2021-09-30T01:00Z,34840 +2021-09-30T02:00Z,35600 +2021-09-30T03:00Z,36038 +2021-09-30T04:00Z,34799 +2021-09-30T05:00Z,33332 +2021-09-30T06:00Z,31048 +2021-09-30T07:00Z,28846 +2021-09-30T08:00Z,27295 +2021-09-30T09:00Z,26061 +2021-09-30T10:00Z,25510 +2021-09-30T11:00Z,25174 +2021-09-30T12:00Z,25420 +2021-09-30T13:00Z,26678 +2021-09-30T14:00Z,28910 +2021-09-30T15:00Z,29909 +2021-09-30T16:00Z,30168 +2021-09-30T17:00Z,30140 +2021-09-30T18:00Z,30253 +2021-09-30T19:00Z,30610 +2021-09-30T20:00Z,31519 +2021-09-30T21:00Z,33241 +2021-09-30T22:00Z,34902 +2021-09-30T23:00Z,36467 +2021-10-01,37801 +2021-10-01T01:00Z,39246 +2021-10-01T02:00Z,39180 +2021-10-01T03:00Z,38690 +2021-10-01T04:00Z,36909 +2021-10-01T05:00Z,34950 +2021-10-01T06:00Z,32268 +2021-10-01T07:00Z,29492 +2021-10-01T08:00Z,27976 +2021-10-01T09:00Z,26760 +2021-10-01T10:00Z,25937 +2021-10-01T11:00Z,25447 +2021-10-01T12:00Z,25718 +2021-10-01T13:00Z,26908 +2021-10-01T14:00Z,28968 +2021-10-01T15:00Z,29968 +2021-10-01T16:00Z,30480 +2021-10-01T17:00Z,30871 +2021-10-01T18:00Z,31252 +2021-10-01T19:00Z,32258 +2021-10-01T20:00Z,32936 +2021-10-01T21:00Z,34244 +2021-10-01T22:00Z,35790 +2021-10-01T23:00Z,38085 +2021-10-02,39954 +2021-10-02T01:00Z,40878 +2021-10-02T02:00Z,39994 +2021-10-02T03:00Z,38990 +2021-10-02T04:00Z,37066 +2021-10-02T05:00Z,35129 +2021-10-02T06:00Z,32795 +2021-10-02T07:00Z,30124 +2021-10-02T08:00Z,28650 +2021-10-02T09:00Z,27178 +2021-10-02T10:00Z,26070 +2021-10-02T11:00Z,25313 +2021-10-02T12:00Z,25132 +2021-10-02T13:00Z,25509 +2021-10-02T14:00Z,26260 +2021-10-02T15:00Z,26523 +2021-10-02T16:00Z,27511 +2021-10-02T17:00Z,27924 +2021-10-02T18:00Z,28800 +2021-10-02T19:00Z,29556 +2021-10-02T20:00Z,30254 +2021-10-02T21:00Z,31884 +2021-10-02T22:00Z,33755 +2021-10-02T23:00Z,36302 +2021-10-03,38658 +2021-10-03T01:00Z,39958 +2021-10-03T02:00Z,39533 +2021-10-03T03:00Z,38473 +2021-10-03T04:00Z,36439 +2021-10-03T05:00Z,34457 +2021-10-03T06:00Z,32173 +2021-10-03T07:00Z,29656 +2021-10-03T08:00Z,28095 +2021-10-03T09:00Z,26686 +2021-10-03T10:00Z,25607 +2021-10-03T11:00Z,24992 +2021-10-03T12:00Z,24616 +2021-10-03T13:00Z,24672 +2021-10-03T14:00Z,25132 +2021-10-03T15:00Z,25126 +2021-10-03T16:00Z,25832 +2021-10-03T17:00Z,26039 +2021-10-03T18:00Z,26859 +2021-10-03T19:00Z,27829 +2021-10-03T20:00Z,29285 +2021-10-03T21:00Z,31419 +2021-10-03T22:00Z,33945 +2021-10-03T23:00Z,36376 +2021-10-04,38767 +2021-10-04T01:00Z,40162 +2021-10-04T02:00Z,39949 +2021-10-04T03:00Z,39151 +2021-10-04T04:00Z,37107 +2021-10-04T05:00Z,34966 +2021-10-04T06:00Z,31878 +2021-10-04T07:00Z,29254 +2021-10-04T08:00Z,27839 +2021-10-04T09:00Z,26561 +2021-10-04T10:00Z,25918 +2021-10-04T11:00Z,25546 +2021-10-04T12:00Z,25889 +2021-10-04T13:00Z,27128 +2021-10-04T14:00Z,29519 +2021-10-04T15:00Z,31031 +2021-10-04T16:00Z,31766 +2021-10-04T17:00Z,32418 +2021-10-04T18:00Z,33118 +2021-10-04T19:00Z,33876 +2021-10-04T20:00Z,35266 +2021-10-04T21:00Z,36984 +2021-10-04T22:00Z,38534 +2021-10-04T23:00Z,40292 +2021-10-05,40693 +2021-10-05T01:00Z,40366 +2021-10-05T02:00Z,39688 +2021-10-05T03:00Z,39142 +2021-10-05T04:00Z,37364 +2021-10-05T05:00Z,35375 +2021-10-05T06:00Z,32752 +2021-10-05T07:00Z,30457 +2021-10-05T08:00Z,28974 +2021-10-05T09:00Z,27697 +2021-10-05T10:00Z,26762 +2021-10-05T11:00Z,26347 +2021-10-05T12:00Z,26530 +2021-10-05T13:00Z,27769 +2021-10-05T14:00Z,30082 +2021-10-05T15:00Z,31360 +2021-10-05T16:00Z,31691 +2021-10-05T17:00Z,31781 +2021-10-05T18:00Z,32013 +2021-10-05T19:00Z,32361 +2021-10-05T20:00Z,32953 +2021-10-05T21:00Z,34169 +2021-10-05T22:00Z,35587 +2021-10-05T23:00Z,36710 +2021-10-06,37862 +2021-10-06T01:00Z,38628 +2021-10-06T02:00Z,38498 +2021-10-06T03:00Z,38214 +2021-10-06T04:00Z,36729 +2021-10-06T05:00Z,35028 +2021-10-06T06:00Z,32489 +2021-10-06T07:00Z,29760 +2021-10-06T08:00Z,28667 +2021-10-06T09:00Z,27405 +2021-10-06T10:00Z,26527 +2021-10-06T11:00Z,26107 +2021-10-06T12:00Z,26435 +2021-10-06T13:00Z,27468 +2021-10-06T14:00Z,29639 +2021-10-06T15:00Z,30919 +2021-10-06T16:00Z,31675 +2021-10-06T17:00Z,32074 +2021-10-06T18:00Z,32015 +2021-10-06T19:00Z,31816 +2021-10-06T20:00Z,31480 +2021-10-06T21:00Z,31649 +2021-10-06T22:00Z,32452 +2021-10-06T23:00Z,33453 +2021-10-07,34408 +2021-10-07T01:00Z,35146 +2021-10-07T02:00Z,35795 +2021-10-07T03:00Z,36041 +2021-10-07T04:00Z,34801 +2021-10-07T05:00Z,33510 +2021-10-07T06:00Z,31692 +2021-10-07T07:00Z,29396 +2021-10-07T08:00Z,27686 +2021-10-07T09:00Z,26677 +2021-10-07T10:00Z,26018 +2021-10-07T11:00Z,25605 +2021-10-07T12:00Z,25891 +2021-10-07T13:00Z,27180 +2021-10-07T14:00Z,29688 +2021-10-07T15:00Z,31327 +2021-10-07T16:00Z,31836 +2021-10-07T17:00Z,32020 +2021-10-07T18:00Z,31804 +2021-10-07T19:00Z,31722 +2021-10-07T20:00Z,31353 +2021-10-07T21:00Z,31288 +2021-10-07T22:00Z,31481 +2021-10-07T23:00Z,31986 +2021-10-08,32378 +2021-10-08T01:00Z,33161 +2021-10-08T02:00Z,34124 +2021-10-08T03:00Z,34475 +2021-10-08T04:00Z,33517 +2021-10-08T05:00Z,32284 +2021-10-08T06:00Z,30319 +2021-10-08T07:00Z,28437 +2021-10-08T08:00Z,27332 +2021-10-08T09:00Z,26301 +2021-10-08T10:00Z,25705 +2021-10-08T11:00Z,25284 +2021-10-08T12:00Z,25543 +2021-10-08T13:00Z,26893 +2021-10-08T14:00Z,29210 +2021-10-08T15:00Z,30785 +2021-10-08T16:00Z,31280 +2021-10-08T17:00Z,31100 +2021-10-08T18:00Z,30422 +2021-10-08T19:00Z,29774 +2021-10-08T20:00Z,29277 +2021-10-08T21:00Z,29333 +2021-10-08T22:00Z,29075 +2021-10-08T23:00Z,29647 +2021-10-09,29816 +2021-10-09T01:00Z,30817 +2021-10-09T02:00Z,32137 +2021-10-09T03:00Z,32695 +2021-10-09T04:00Z,31760 +2021-10-09T05:00Z,30736 +2021-10-09T06:00Z,29256 +2021-10-09T07:00Z,27804 +2021-10-09T08:00Z,26219 +2021-10-09T09:00Z,25246 +2021-10-09T10:00Z,24492 +2021-10-09T11:00Z,24304 +2021-10-09T12:00Z,24360 +2021-10-09T13:00Z,24896 +2021-10-09T14:00Z,25630 +2021-10-09T15:00Z,25985 +2021-10-09T16:00Z,26609 +2021-10-09T17:00Z,26214 +2021-10-09T18:00Z,25406 +2021-10-09T19:00Z,24875 +2021-10-09T20:00Z,24863 +2021-10-09T21:00Z,24672 +2021-10-09T22:00Z,24898 +2021-10-09T23:00Z,26018 +2021-10-10,27411 +2021-10-10T01:00Z,29432 +2021-10-10T02:00Z,30718 +2021-10-10T03:00Z,31235 +2021-10-10T04:00Z,30377 +2021-10-10T05:00Z,29435 +2021-10-10T06:00Z,27938 +2021-10-10T07:00Z,26447 +2021-10-10T08:00Z,25431 +2021-10-10T09:00Z,24461 +2021-10-10T10:00Z,23743 +2021-10-10T11:00Z,23323 +2021-10-10T12:00Z,23278 +2021-10-10T13:00Z,23507 +2021-10-10T14:00Z,24199 +2021-10-10T15:00Z,24577 +2021-10-10T16:00Z,24542 +2021-10-10T17:00Z,24196 +2021-10-10T18:00Z,23699 +2021-10-10T19:00Z,23484 +2021-10-10T20:00Z,23600 +2021-10-10T21:00Z,24115 +2021-10-10T22:00Z,24925 +2021-10-10T23:00Z,26175 +2021-10-11,28228 +2021-10-11T01:00Z,30637 +2021-10-11T02:00Z,31783 +2021-10-11T03:00Z,32156 +2021-10-11T04:00Z,31221 +2021-10-11T05:00Z,29830 +2021-10-11T06:00Z,28014 +2021-10-11T07:00Z,26264 +2021-10-11T08:00Z,25245 +2021-10-11T09:00Z,24459 +2021-10-11T10:00Z,23916 +2021-10-11T11:00Z,23693 +2021-10-11T12:00Z,24036 +2021-10-11T13:00Z,25327 +2021-10-11T14:00Z,27609 +2021-10-11T15:00Z,28752 +2021-10-11T16:00Z,28994 +2021-10-11T17:00Z,28843 +2021-10-11T18:00Z,28549 +2021-10-11T19:00Z,28083 +2021-10-11T20:00Z,27610 +2021-10-11T21:00Z,27837 +2021-10-11T22:00Z,28142 +2021-10-11T23:00Z,28553 +2021-10-12,29527 +2021-10-12T01:00Z,30796 +2021-10-12T02:00Z,32285 +2021-10-12T03:00Z,32721 +2021-10-12T04:00Z,31724 +2021-10-12T05:00Z,30468 +2021-10-12T06:00Z,28548 +2021-10-12T07:00Z,26707 +2021-10-12T08:00Z,25648 +2021-10-12T09:00Z,24795 +2021-10-12T10:00Z,24236 +2021-10-12T11:00Z,24048 +2021-10-12T12:00Z,24454 +2021-10-12T13:00Z,25934 +2021-10-12T14:00Z,28236 +2021-10-12T15:00Z,29577 +2021-10-12T16:00Z,29094 +2021-10-12T17:00Z,28516 +2021-10-12T18:00Z,27519 +2021-10-12T19:00Z,27036 +2021-10-12T20:00Z,26652 +2021-10-12T21:00Z,27563 +2021-10-12T22:00Z,26967 +2021-10-12T23:00Z,27877 +2021-10-13,28946 +2021-10-13T01:00Z,30885 +2021-10-13T02:00Z,32444 +2021-10-13T03:00Z,32903 +2021-10-13T04:00Z,31999 +2021-10-13T05:00Z,30735 +2021-10-13T06:00Z,28756 +2021-10-13T07:00Z,26974 +2021-10-13T08:00Z,25696 +2021-10-13T09:00Z,24822 +2021-10-13T10:00Z,24328 +2021-10-13T11:00Z,24128 +2021-10-13T12:00Z,24671 +2021-10-13T13:00Z,26210 +2021-10-13T14:00Z,28833 +2021-10-13T15:00Z,30292 +2021-10-13T16:00Z,29949 +2021-10-13T17:00Z,29809 +2021-10-13T18:00Z,29470 +2021-10-13T19:00Z,28572 +2021-10-13T20:00Z,28022 +2021-10-13T21:00Z,28329 +2021-10-13T22:00Z,28545 +2021-10-13T23:00Z,29438 +2021-10-14,29865 +2021-10-14T01:00Z,31194 +2021-10-14T02:00Z,32897 +2021-10-14T03:00Z,33226 +2021-10-14T04:00Z,32148 +2021-10-14T05:00Z,30842 +2021-10-14T06:00Z,28971 +2021-10-14T07:00Z,27219 +2021-10-14T08:00Z,26100 +2021-10-14T09:00Z,25168 +2021-10-14T10:00Z,24628 +2021-10-14T11:00Z,24323 +2021-10-14T12:00Z,24637 +2021-10-14T13:00Z,26106 +2021-10-14T14:00Z,28771 +2021-10-14T15:00Z,30135 +2021-10-14T16:00Z,29800 +2021-10-14T17:00Z,28960 +2021-10-14T18:00Z,28707 +2021-10-14T19:00Z,28339 +2021-10-14T20:00Z,28057 +2021-10-14T21:00Z,28269 +2021-10-14T22:00Z,28765 +2021-10-14T23:00Z,29827 +2021-10-15,30498 +2021-10-15T01:00Z,32103 +2021-10-15T02:00Z,33499 +2021-10-15T03:00Z,33727 +2021-10-15T04:00Z,32681 +2021-10-15T05:00Z,31214 +2021-10-15T06:00Z,29329 +2021-10-15T07:00Z,27407 +2021-10-15T08:00Z,26050 +2021-10-15T09:00Z,25265 +2021-10-15T10:00Z,24768 +2021-10-15T11:00Z,24611 +2021-10-15T12:00Z,24905 +2021-10-15T13:00Z,26291 +2021-10-15T14:00Z,28614 +2021-10-15T15:00Z,30066 +2021-10-15T16:00Z,29996 +2021-10-15T17:00Z,30299 +2021-10-15T18:00Z,29732 +2021-10-15T19:00Z,29385 +2021-10-15T20:00Z,29500 +2021-10-15T21:00Z,30171 +2021-10-15T22:00Z,30849 +2021-10-15T23:00Z,31500 +2021-10-16,32865 +2021-10-16T01:00Z,34175 +2021-10-16T02:00Z,34536 +2021-10-16T03:00Z,34080 +2021-10-16T04:00Z,32835 +2021-10-16T05:00Z,31550 +2021-10-16T06:00Z,29657 +2021-10-16T07:00Z,27860 +2021-10-16T08:00Z,26461 +2021-10-16T09:00Z,25281 +2021-10-16T10:00Z,24581 +2021-10-16T11:00Z,24082 +2021-10-16T12:00Z,24041 +2021-10-16T13:00Z,24509 +2021-10-16T14:00Z,25536 +2021-10-16T15:00Z,25970 +2021-10-16T16:00Z,26481 +2021-10-16T17:00Z,26645 +2021-10-16T18:00Z,26389 +2021-10-16T19:00Z,26242 +2021-10-16T20:00Z,26555 +2021-10-16T21:00Z,27237 +2021-10-16T22:00Z,28259 +2021-10-16T23:00Z,29446 +2021-10-17,30992 +2021-10-17T01:00Z,32558 +2021-10-17T02:00Z,33113 +2021-10-17T03:00Z,32668 +2021-10-17T04:00Z,31452 +2021-10-17T05:00Z,30210 +2021-10-17T06:00Z,28527 +2021-10-17T07:00Z,26806 +2021-10-17T08:00Z,25495 +2021-10-17T09:00Z,24456 +2021-10-17T10:00Z,23701 +2021-10-17T11:00Z,23266 +2021-10-17T12:00Z,23477 +2021-10-17T13:00Z,23608 +2021-10-17T14:00Z,24295 +2021-10-17T15:00Z,24397 +2021-10-17T16:00Z,24885 +2021-10-17T17:00Z,24650 +2021-10-17T18:00Z,24566 +2021-10-17T19:00Z,24366 +2021-10-17T20:00Z,24400 +2021-10-17T21:00Z,24591 +2021-10-17T22:00Z,25219 +2021-10-17T23:00Z,26710 +2021-10-18,28044 +2021-10-18T01:00Z,29404 +2021-10-18T02:00Z,30956 +2021-10-18T03:00Z,31117 +2021-10-18T04:00Z,30147 +2021-10-18T05:00Z,29061 +2021-10-18T06:00Z,27451 +2021-10-18T07:00Z,25964 +2021-10-18T08:00Z,24984 +2021-10-18T09:00Z,24488 +2021-10-18T10:00Z,24060 +2021-10-18T11:00Z,24129 +2021-10-18T12:00Z,24535 +2021-10-18T13:00Z,25841 +2021-10-18T14:00Z,28204 +2021-10-18T15:00Z,29968 +2021-10-18T16:00Z,30426 +2021-10-18T17:00Z,30793 +2021-10-18T18:00Z,30504 +2021-10-18T19:00Z,29694 +2021-10-18T20:00Z,29283 +2021-10-18T21:00Z,29036 +2021-10-18T22:00Z,28805 +2021-10-18T23:00Z,29130 +2021-10-19,29324 +2021-10-19T01:00Z,30830 +2021-10-19T02:00Z,32673 +2021-10-19T03:00Z,32805 +2021-10-19T04:00Z,31870 +2021-10-19T05:00Z,30546 +2021-10-19T06:00Z,28670 +2021-10-19T07:00Z,26971 +2021-10-19T08:00Z,25690 +2021-10-19T09:00Z,24817 +2021-10-19T10:00Z,24343 +2021-10-19T11:00Z,24293 +2021-10-19T12:00Z,24701 +2021-10-19T13:00Z,26243 +2021-10-19T14:00Z,28924 +2021-10-19T15:00Z,30581 +2021-10-19T16:00Z,30110 +2021-10-19T17:00Z,29440 +2021-10-19T18:00Z,28852 +2021-10-19T19:00Z,27968 +2021-10-19T20:00Z,27367 +2021-10-19T21:00Z,27347 +2021-10-19T22:00Z,27883 +2021-10-19T23:00Z,28658 +2021-10-20,29597 +2021-10-20T01:00Z,31235 +2021-10-20T02:00Z,33163 +2021-10-20T03:00Z,33184 +2021-10-20T04:00Z,32159 +2021-10-20T05:00Z,30872 +2021-10-20T06:00Z,28883 +2021-10-20T07:00Z,27031 +2021-10-20T08:00Z,25827 +2021-10-20T09:00Z,24991 +2021-10-20T10:00Z,24464 +2021-10-20T11:00Z,24370 +2021-10-20T12:00Z,24742 +2021-10-20T13:00Z,26108 +2021-10-20T14:00Z,28642 +2021-10-20T15:00Z,30191 +2021-10-20T16:00Z,30467 +2021-10-20T17:00Z,30328 +2021-10-20T18:00Z,29797 +2021-10-20T19:00Z,29628 +2021-10-20T20:00Z,29659 +2021-10-20T21:00Z,29980 +2021-10-20T22:00Z,30117 +2021-10-20T23:00Z,30125 +2021-10-21,31155 +2021-10-21T01:00Z,32339 +2021-10-21T02:00Z,33577 +2021-10-21T03:00Z,33418 +2021-10-21T04:00Z,32434 +2021-10-21T05:00Z,31295 +2021-10-21T06:00Z,29338 +2021-10-21T07:00Z,27566 +2021-10-21T08:00Z,26222 +2021-10-21T09:00Z,25295 +2021-10-21T10:00Z,24776 +2021-10-21T11:00Z,24574 +2021-10-21T12:00Z,25008 +2021-10-21T13:00Z,26321 +2021-10-21T14:00Z,28844 +2021-10-21T15:00Z,30448 +2021-10-21T16:00Z,30570 +2021-10-21T17:00Z,30108 +2021-10-21T18:00Z,30181 +2021-10-21T19:00Z,29888 +2021-10-21T20:00Z,29766 +2021-10-21T21:00Z,30096 +2021-10-21T22:00Z,30712 +2021-10-21T23:00Z,31309 +2021-10-22,32137 +2021-10-22T01:00Z,33125 +2021-10-22T02:00Z,34078 +2021-10-22T03:00Z,33860 +2021-10-22T04:00Z,32718 +2021-10-22T05:00Z,31349 +2021-10-22T06:00Z,29340 +2021-10-22T07:00Z,27475 +2021-10-22T08:00Z,26247 +2021-10-22T09:00Z,25326 +2021-10-22T10:00Z,24671 +2021-10-22T11:00Z,24826 +2021-10-22T12:00Z,25151 +2021-10-22T13:00Z,26397 +2021-10-22T14:00Z,28489 +2021-10-22T15:00Z,29848 +2021-10-22T16:00Z,30084 +2021-10-22T17:00Z,30285 +2021-10-22T18:00Z,30031 +2021-10-22T19:00Z,29837 +2021-10-22T20:00Z,29390 +2021-10-22T21:00Z,29447 +2021-10-22T22:00Z,29493 +2021-10-22T23:00Z,29820 +2021-10-23,29965 +2021-10-23T01:00Z,31320 +2021-10-23T02:00Z,32539 +2021-10-23T03:00Z,32261 +2021-10-23T04:00Z,31350 +2021-10-23T05:00Z,30308 +2021-10-23T06:00Z,28827 +2021-10-23T07:00Z,27294 +2021-10-23T08:00Z,26157 +2021-10-23T09:00Z,25151 +2021-10-23T10:00Z,24438 +2021-10-23T11:00Z,23964 +2021-10-23T12:00Z,23908 +2021-10-23T13:00Z,24267 +2021-10-23T14:00Z,25254 +2021-10-23T15:00Z,25961 +2021-10-23T16:00Z,26430 +2021-10-23T17:00Z,27086 +2021-10-23T18:00Z,27658 +2021-10-23T19:00Z,26862 +2021-10-23T20:00Z,26430 +2021-10-23T21:00Z,26227 +2021-10-23T22:00Z,26653 +2021-10-23T23:00Z,27509 +2021-10-24,27951 +2021-10-24T01:00Z,28986 +2021-10-24T02:00Z,30552 +2021-10-24T03:00Z,30541 +2021-10-24T04:00Z,29672 +2021-10-24T05:00Z,28990 +2021-10-24T06:00Z,27561 +2021-10-24T07:00Z,26183 +2021-10-24T08:00Z,25111 +2021-10-24T09:00Z,24150 +2021-10-24T10:00Z,23510 +2021-10-24T11:00Z,23076 +2021-10-24T12:00Z,22993 +2021-10-24T13:00Z,23218 +2021-10-24T14:00Z,24051 +2021-10-24T15:00Z,24655 +2021-10-24T16:00Z,25254 +2021-10-24T17:00Z,25615 +2021-10-24T18:00Z,25843 +2021-10-24T19:00Z,26164 +2021-10-24T20:00Z,26420 +2021-10-24T21:00Z,26605 +2021-10-24T22:00Z,26707 +2021-10-24T23:00Z,27335 +2021-10-25,28422 +2021-10-25T01:00Z,29877 +2021-10-25T02:00Z,31352 +2021-10-25T03:00Z,31213 +2021-10-25T04:00Z,30265 +2021-10-25T05:00Z,29288 +2021-10-25T06:00Z,27616 +2021-10-25T07:00Z,25893 +2021-10-25T08:00Z,24740 +2021-10-25T09:00Z,24297 +2021-10-25T10:00Z,23856 +2021-10-25T11:00Z,23886 +2021-10-25T12:00Z,24302 +2021-10-25T13:00Z,25587 +2021-10-25T14:00Z,27919 +2021-10-25T15:00Z,29277 +2021-10-25T16:00Z,30285 +2021-10-25T17:00Z,30403 +2021-10-25T18:00Z,30143 +2021-10-25T19:00Z,29936 +2021-10-25T20:00Z,30097 +2021-10-25T21:00Z,30101 +2021-10-25T22:00Z,31206 +2021-10-25T23:00Z,29459 +2021-10-26,29821 +2021-10-26T01:00Z,30677 +2021-10-26T02:00Z,32089 +2021-10-26T03:00Z,31981 +2021-10-26T04:00Z,31195 +2021-10-26T05:00Z,31087 +2021-10-26T06:00Z,28269 +2021-10-26T07:00Z,26574 +2021-10-26T08:00Z,25503 +2021-10-26T09:00Z,24942 +2021-10-26T10:00Z,24549 +2021-10-26T11:00Z,24363 +2021-10-26T12:00Z,24829 +2021-10-26T13:00Z,26003 +2021-10-26T14:00Z,28416 +2021-10-26T15:00Z,30092 +2021-10-26T16:00Z,29878 +2021-10-26T17:00Z,29937 +2021-10-26T18:00Z,29010 +2021-10-26T19:00Z,28614 +2021-10-26T20:00Z,28047 +2021-10-26T21:00Z,27824 +2021-10-26T22:00Z,28164 +2021-10-26T23:00Z,28714 +2021-10-27,29476 +2021-10-27T01:00Z,31163 +2021-10-27T02:00Z,32829 +2021-10-27T03:00Z,32743 +2021-10-27T04:00Z,31789 +2021-10-27T05:00Z,30503 +2021-10-27T06:00Z,28659 +2021-10-27T07:00Z,26854 +2021-10-27T08:00Z,25956 +2021-10-27T09:00Z,25354 +2021-10-27T10:00Z,24796 +2021-10-27T11:00Z,24678 +2021-10-27T12:00Z,24882 +2021-10-27T13:00Z,26032 +2021-10-27T14:00Z,28575 +2021-10-27T15:00Z,30270 +2021-10-27T16:00Z,29931 +2021-10-27T17:00Z,29440 +2021-10-27T18:00Z,29160 +2021-10-27T19:00Z,28950 +2021-10-27T20:00Z,28839 +2021-10-27T21:00Z,29066 +2021-10-27T22:00Z,29461 +2021-10-27T23:00Z,30103 +2021-10-28,31226 +2021-10-28T01:00Z,32721 +2021-10-28T02:00Z,34124 +2021-10-28T03:00Z,33929 +2021-10-28T04:00Z,32862 +2021-10-28T05:00Z,31494 +2021-10-28T06:00Z,29372 +2021-10-28T07:00Z,27470 +2021-10-28T08:00Z,26191 +2021-10-28T09:00Z,25288 +2021-10-28T10:00Z,24613 +2021-10-28T11:00Z,24460 +2021-10-28T12:00Z,24771 +2021-10-28T13:00Z,26084 +2021-10-28T14:00Z,28599 +2021-10-28T15:00Z,30239 +2021-10-28T16:00Z,30271 +2021-10-28T17:00Z,29700 +2021-10-28T18:00Z,29655 +2021-10-28T19:00Z,29698 +2021-10-28T20:00Z,30209 +2021-10-28T21:00Z,31003 +2021-10-28T22:00Z,31906 +2021-10-28T23:00Z,32962 +2021-10-29,34343 +2021-10-29T01:00Z,35821 +2021-10-29T02:00Z,36307 +2021-10-29T03:00Z,35567 +2021-10-29T04:00Z,34155 +2021-10-29T05:00Z,32637 +2021-10-29T06:00Z,30398 +2021-10-29T07:00Z,28329 +2021-10-29T08:00Z,26882 +2021-10-29T09:00Z,26158 +2021-10-29T10:00Z,25365 +2021-10-29T11:00Z,25143 +2021-10-29T12:00Z,25247 +2021-10-29T13:00Z,26234 +2021-10-29T14:00Z,28418 +2021-10-29T15:00Z,29895 +2021-10-29T16:00Z,29832 +2021-10-29T17:00Z,29848 +2021-10-29T18:00Z,29825 +2021-10-29T19:00Z,29961 +2021-10-29T20:00Z,30161 +2021-10-29T21:00Z,30515 +2021-10-29T22:00Z,31429 +2021-10-29T23:00Z,32570 +2021-10-30,33861 +2021-10-30T01:00Z,34648 +2021-10-30T02:00Z,34950 +2021-10-30T03:00Z,34197 +2021-10-30T04:00Z,32983 +2021-10-30T05:00Z,31750 +2021-10-30T06:00Z,29847 +2021-10-30T07:00Z,27986 +2021-10-30T08:00Z,26639 +2021-10-30T09:00Z,25517 +2021-10-30T10:00Z,24625 +2021-10-30T11:00Z,24229 +2021-10-30T12:00Z,24404 +2021-10-30T13:00Z,24898 +2021-10-30T14:00Z,25879 +2021-10-30T15:00Z,26581 +2021-10-30T16:00Z,26775 +2021-10-30T17:00Z,27140 +2021-10-30T18:00Z,26807 +2021-10-30T19:00Z,26272 +2021-10-30T20:00Z,26139 +2021-10-30T21:00Z,26466 +2021-10-30T22:00Z,26759 +2021-10-30T23:00Z,27409 +2021-10-31,28556 +2021-10-31T01:00Z,30139 +2021-10-31T02:00Z,31453 +2021-10-31T03:00Z,31052 +2021-10-31T04:00Z,30076 +2021-10-31T05:00Z,29169 +2021-10-31T06:00Z,27868 +2021-10-31T07:00Z,26510 +2021-10-31T08:00Z,25723 +2021-10-31T09:00Z,24814 +2021-10-31T10:00Z,24105 +2021-10-31T11:00Z,23732 +2021-10-31T12:00Z,23632 +2021-10-31T13:00Z,23807 +2021-10-31T14:00Z,24515 +2021-10-31T15:00Z,25153 +2021-10-31T16:00Z,25639 +2021-10-31T17:00Z,26299 +2021-10-31T18:00Z,26007 +2021-10-31T19:00Z,25144 +2021-10-31T20:00Z,24748 +2021-10-31T21:00Z,24582 +2021-10-31T22:00Z,25061 +2021-10-31T23:00Z,26021 +2021-11-01,27225 +2021-11-01T01:00Z,28663 +2021-11-01T02:00Z,29851 +2021-11-01T03:00Z,29410 +2021-11-01T04:00Z,28996 +2021-11-01T05:00Z,28430 +2021-11-01T06:00Z,27110 +2021-11-01T07:00Z,25594 +2021-11-01T08:00Z,24898 +2021-11-01T09:00Z,24312 +2021-11-01T10:00Z,23841 +2021-11-01T11:00Z,23657 +2021-11-01T12:00Z,24107 +2021-11-01T13:00Z,25500 +2021-11-01T14:00Z,27524 +2021-11-01T15:00Z,29310 +2021-11-01T16:00Z,29996 +2021-11-01T17:00Z,30435 +2021-11-01T18:00Z,30561 +2021-11-01T19:00Z,30673 +2021-11-01T20:00Z,30671 +2021-11-01T21:00Z,30417 +2021-11-01T22:00Z,30450 +2021-11-01T23:00Z,30559 +2021-11-02,30646 +2021-11-02T01:00Z,32084 +2021-11-02T02:00Z,33528 +2021-11-02T03:00Z,33131 +2021-11-02T04:00Z,32172 +2021-11-02T05:00Z,30869 +2021-11-02T06:00Z,28920 +2021-11-02T07:00Z,27160 +2021-11-02T08:00Z,25861 +2021-11-02T09:00Z,25052 +2021-11-02T10:00Z,24467 +2021-11-02T11:00Z,24176 +2021-11-02T12:00Z,24539 +2021-11-02T13:00Z,25844 +2021-11-02T14:00Z,28378 +2021-11-02T15:00Z,30401 +2021-11-02T16:00Z,30330 +2021-11-02T17:00Z,30396 +2021-11-02T18:00Z,29991 +2021-11-02T19:00Z,29430 +2021-11-02T20:00Z,28453 +2021-11-02T21:00Z,28615 +2021-11-02T22:00Z,29068 +2021-11-02T23:00Z,29324 +2021-11-03,30168 +2021-11-03T01:00Z,32024 +2021-11-03T02:00Z,33570 +2021-11-03T03:00Z,33348 +2021-11-03T04:00Z,32298 +2021-11-03T05:00Z,30945 +2021-11-03T06:00Z,28782 +2021-11-03T07:00Z,26851 +2021-11-03T08:00Z,25667 +2021-11-03T09:00Z,24672 +2021-11-03T10:00Z,24078 +2021-11-03T11:00Z,23996 +2021-11-03T12:00Z,24367 +2021-11-03T13:00Z,25581 +2021-11-03T14:00Z,28067 +2021-11-03T15:00Z,30001 +2021-11-03T16:00Z,29776 +2021-11-03T17:00Z,29572 +2021-11-03T18:00Z,28731 +2021-11-03T19:00Z,28473 +2021-11-03T20:00Z,28373 +2021-11-03T21:00Z,28719 +2021-11-03T22:00Z,29436 +2021-11-03T23:00Z,29864 +2021-11-04,31173 +2021-11-04T01:00Z,32751 +2021-11-04T02:00Z,33917 +2021-11-04T03:00Z,33371 +2021-11-04T04:00Z,32197 +2021-11-04T05:00Z,30919 +2021-11-04T06:00Z,28967 +2021-11-04T07:00Z,26940 +2021-11-04T08:00Z,25923 +2021-11-04T09:00Z,24962 +2021-11-04T10:00Z,24359 +2021-11-04T11:00Z,24168 +2021-11-04T12:00Z,24430 +2021-11-04T13:00Z,25790 +2021-11-04T14:00Z,28250 +2021-11-04T15:00Z,29972 +2021-11-04T16:00Z,30001 +2021-11-04T17:00Z,29969 +2021-11-04T18:00Z,30102 +2021-11-04T19:00Z,29673 +2021-11-04T20:00Z,29624 +2021-11-04T21:00Z,29860 +2021-11-04T22:00Z,30456 +2021-11-04T23:00Z,31005 +2021-11-05,31466 +2021-11-05T01:00Z,32804 +2021-11-05T02:00Z,33850 +2021-11-05T03:00Z,33421 +2021-11-05T04:00Z,32374 +2021-11-05T05:00Z,31019 +2021-11-05T06:00Z,29306 +2021-11-05T07:00Z,27822 +2021-11-05T08:00Z,26325 +2021-11-05T09:00Z,25240 +2021-11-05T10:00Z,24617 +2021-11-05T11:00Z,24353 +2021-11-05T12:00Z,24729 +2021-11-05T13:00Z,25886 +2021-11-05T14:00Z,28249 +2021-11-05T15:00Z,30180 +2021-11-05T16:00Z,30024 +2021-11-05T17:00Z,29637 +2021-11-05T18:00Z,29057 +2021-11-05T19:00Z,28498 +2021-11-05T20:00Z,28398 +2021-11-05T21:00Z,28767 +2021-11-05T22:00Z,28896 +2021-11-05T23:00Z,29925 +2021-11-06,31028 +2021-11-06T01:00Z,32193 +2021-11-06T02:00Z,33118 +2021-11-06T03:00Z,32421 +2021-11-06T04:00Z,31483 +2021-11-06T05:00Z,30400 +2021-11-06T06:00Z,28696 +2021-11-06T07:00Z,27045 +2021-11-06T08:00Z,25760 +2021-11-06T09:00Z,24734 +2021-11-06T10:00Z,24389 +2021-11-06T11:00Z,24088 +2021-11-06T12:00Z,23810 +2021-11-06T13:00Z,24251 +2021-11-06T14:00Z,25339 +2021-11-06T15:00Z,26372 +2021-11-06T16:00Z,26788 +2021-11-06T17:00Z,26960 +2021-11-06T18:00Z,27131 +2021-11-06T19:00Z,26659 +2021-11-06T20:00Z,26354 +2021-11-06T21:00Z,26251 +2021-11-06T22:00Z,26418 +2021-11-06T23:00Z,27032 +2021-11-07,27655 +2021-11-07T01:00Z,29276 +2021-11-07T02:00Z,30958 +2021-11-07T03:00Z,30513 +2021-11-07T04:00Z,29749 +2021-11-07T05:00Z,28838 +2021-11-07T06:00Z,27534 +2021-11-07T07:00Z,26100 +2021-11-07T08:00Z,24987 +2021-11-07T09:00Z,24242 +2021-11-07T10:00Z,23826 +2021-11-07T11:00Z,23551 +2021-11-07T12:00Z,23184 +2021-11-07T13:00Z,23150 +2021-11-07T14:00Z,23749 +2021-11-07T15:00Z,24444 +2021-11-07T16:00Z,25053 +2021-11-07T17:00Z,25360 +2021-11-07T18:00Z,24541 +2021-11-07T19:00Z,23322 +2021-11-07T20:00Z,22861 +2021-11-07T21:00Z,23203 +2021-11-07T22:00Z,23921 +2021-11-07T23:00Z,25513 +2021-11-08,26788 +2021-11-08T01:00Z,28678 +2021-11-08T02:00Z,30945 +2021-11-08T03:00Z,30951 +2021-11-08T04:00Z,30383 +2021-11-08T05:00Z,29616 +2021-11-08T06:00Z,28361 +2021-11-08T07:00Z,26770 +2021-11-08T08:00Z,25386 +2021-11-08T09:00Z,24481 +2021-11-08T10:00Z,24127 +2021-11-08T11:00Z,23700 +2021-11-08T12:00Z,23698 +2021-11-08T13:00Z,24370 +2021-11-08T14:00Z,25973 +2021-11-08T15:00Z,28328 +2021-11-08T16:00Z,29175 +2021-11-08T17:00Z,28421 +2021-11-08T18:00Z,27389 +2021-11-08T19:00Z,26719 +2021-11-08T20:00Z,26465 +2021-11-08T21:00Z,26849 +2021-11-08T22:00Z,27824 +2021-11-08T23:00Z,28685 +2021-11-09,30582 +2021-11-09T01:00Z,32056 +2021-11-09T02:00Z,33530 +2021-11-09T03:00Z,33108 +2021-11-09T04:00Z,32160 +2021-11-09T05:00Z,31209 +2021-11-09T06:00Z,29781 +2021-11-09T07:00Z,27738 +2021-11-09T08:00Z,26233 +2021-11-09T09:00Z,25635 +2021-11-09T10:00Z,25032 +2021-11-09T11:00Z,24685 +2021-11-09T12:00Z,24578 +2021-11-09T13:00Z,24901 +2021-11-09T14:00Z,26385 +2021-11-09T15:00Z,28779 +2021-11-09T16:00Z,29950 +2021-11-09T17:00Z,30258 +2021-11-09T18:00Z,30292 +2021-11-09T19:00Z,29999 +2021-11-09T20:00Z,29782 +2021-11-09T21:00Z,29661 +2021-11-09T22:00Z,29751 +2021-11-09T23:00Z,30215 +2021-11-10,30822 +2021-11-10T01:00Z,32362 +2021-11-10T02:00Z,34239 +2021-11-10T03:00Z,33896 +2021-11-10T04:00Z,33044 +2021-11-10T05:00Z,32016 +2021-11-10T06:00Z,30493 +2021-11-10T07:00Z,28459 +2021-11-10T08:00Z,26802 +2021-11-10T09:00Z,25812 +2021-11-10T10:00Z,24895 +2021-11-10T11:00Z,24744 +2021-11-10T12:00Z,24439 +2021-11-10T13:00Z,24687 +2021-11-10T14:00Z,26241 +2021-11-10T15:00Z,28545 +2021-11-10T16:00Z,29455 +2021-11-10T17:00Z,29587 +2021-11-10T18:00Z,29249 +2021-11-10T19:00Z,29125 +2021-11-10T20:00Z,28893 +2021-11-10T21:00Z,29071 +2021-11-10T22:00Z,29561 +2021-11-10T23:00Z,29716 +2021-11-11,31196 +2021-11-11T01:00Z,32710 +2021-11-11T02:00Z,34281 +2021-11-11T03:00Z,33901 +2021-11-11T04:00Z,32978 +2021-11-11T05:00Z,31879 +2021-11-11T06:00Z,30569 +2021-11-11T07:00Z,28678 +2021-11-11T08:00Z,26987 +2021-11-11T09:00Z,25846 +2021-11-11T10:00Z,25041 +2021-11-11T11:00Z,24525 +2021-11-11T12:00Z,24469 +2021-11-11T13:00Z,24757 +2021-11-11T14:00Z,25990 +2021-11-11T15:00Z,27657 +2021-11-11T16:00Z,28660 +2021-11-11T17:00Z,29309 +2021-11-11T18:00Z,29223 +2021-11-11T19:00Z,29420 +2021-11-11T20:00Z,29372 +2021-11-11T21:00Z,29854 +2021-11-11T22:00Z,30595 +2021-11-11T23:00Z,31877 +2021-11-12,33328 +2021-11-12T01:00Z,34550 +2021-11-12T02:00Z,35519 +2021-11-12T03:00Z,35101 +2021-11-12T04:00Z,33923 +2021-11-12T05:00Z,32693 +2021-11-12T06:00Z,31275 +2021-11-12T07:00Z,29340 +2021-11-12T08:00Z,27589 +2021-11-12T09:00Z,26262 +2021-11-12T10:00Z,25332 +2021-11-12T11:00Z,24780 +2021-11-12T12:00Z,24770 +2021-11-12T13:00Z,25271 +2021-11-12T14:00Z,26811 +2021-11-12T15:00Z,28729 +2021-11-12T16:00Z,29819 +2021-11-12T17:00Z,30537 +2021-11-12T18:00Z,30956 +2021-11-12T19:00Z,31683 +2021-11-12T20:00Z,31630 +2021-11-12T21:00Z,31814 +2021-11-12T22:00Z,32784 +2021-11-12T23:00Z,33995 +2021-11-13,35581 +2021-11-13T01:00Z,36593 +2021-11-13T02:00Z,36965 +2021-11-13T03:00Z,35720 +2021-11-13T04:00Z,34349 +2021-11-13T05:00Z,32980 +2021-11-13T06:00Z,31651 +2021-11-13T07:00Z,29820 +2021-11-13T08:00Z,27958 +2021-11-13T09:00Z,26491 +2021-11-13T10:00Z,25440 +2021-11-13T11:00Z,24884 +2021-11-13T12:00Z,24323 +2021-11-13T13:00Z,24257 +2021-11-13T14:00Z,24857 +2021-11-13T15:00Z,25495 +2021-11-13T16:00Z,26158 +2021-11-13T17:00Z,26916 +2021-11-13T18:00Z,27585 +2021-11-13T19:00Z,27734 +2021-11-13T20:00Z,28244 +2021-11-13T21:00Z,28614 +2021-11-13T22:00Z,29173 +2021-11-13T23:00Z,29708 +2021-11-14,31411 +2021-11-14T01:00Z,32523 +2021-11-14T02:00Z,33483 +2021-11-14T03:00Z,32715 +2021-11-14T04:00Z,31387 +2021-11-14T05:00Z,30291 +2021-11-14T06:00Z,29216 +2021-11-14T07:00Z,27717 +2021-11-14T08:00Z,26158 +2021-11-14T09:00Z,24922 +2021-11-14T10:00Z,23970 +2021-11-14T11:00Z,23424 +2021-11-14T12:00Z,23460 +2021-11-14T13:00Z,23571 +2021-11-14T14:00Z,23875 +2021-11-14T15:00Z,24498 +2021-11-14T16:00Z,25040 +2021-11-14T17:00Z,25091 +2021-11-14T18:00Z,25103 +2021-11-14T19:00Z,25963 +2021-11-14T20:00Z,26202 +2021-11-14T21:00Z,26555 +2021-11-14T22:00Z,27424 +2021-11-14T23:00Z,28492 +2021-11-15,30233 +2021-11-15T01:00Z,31724 +2021-11-15T02:00Z,33307 +2021-11-15T03:00Z,32747 +2021-11-15T04:00Z,31667 +2021-11-15T05:00Z,30531 +2021-11-15T06:00Z,29123 +2021-11-15T07:00Z,27255 +2021-11-15T08:00Z,25786 +2021-11-15T09:00Z,24848 +2021-11-15T10:00Z,24415 +2021-11-15T11:00Z,23953 +2021-11-15T12:00Z,24112 +2021-11-15T13:00Z,24205 +2021-11-15T14:00Z,25718 +2021-11-15T15:00Z,27661 +2021-11-15T16:00Z,28704 +2021-11-15T17:00Z,29673 +2021-11-15T18:00Z,30261 +2021-11-15T19:00Z,30855 +2021-11-15T20:00Z,30880 +2021-11-15T21:00Z,31045 +2021-11-15T22:00Z,31508 +2021-11-15T23:00Z,32140 +2021-11-16,33160 +2021-11-16T01:00Z,34266 +2021-11-16T02:00Z,35386 +2021-11-16T03:00Z,34644 +2021-11-16T04:00Z,33508 +2021-11-16T05:00Z,32230 +2021-11-16T06:00Z,30573 +2021-11-16T07:00Z,28601 +2021-11-16T08:00Z,26738 +2021-11-16T09:00Z,25499 +2021-11-16T10:00Z,24652 +2021-11-16T11:00Z,24278 +2021-11-16T12:00Z,23904 +2021-11-16T13:00Z,24411 +2021-11-16T14:00Z,25903 +2021-11-16T15:00Z,28226 +2021-11-16T16:00Z,29426 +2021-11-16T17:00Z,29972 +2021-11-16T18:00Z,29945 +2021-11-16T19:00Z,29997 +2021-11-16T20:00Z,29515 +2021-11-16T21:00Z,29801 +2021-11-16T22:00Z,29967 +2021-11-16T23:00Z,30356 +2021-11-17,30756 +2021-11-17T01:00Z,32326 +2021-11-17T02:00Z,34182 +2021-11-17T03:00Z,33587 +2021-11-17T04:00Z,32727 +2021-11-17T05:00Z,31639 +2021-11-17T06:00Z,30314 +2021-11-17T07:00Z,28307 +2021-11-17T08:00Z,26509 +2021-11-17T09:00Z,25310 +2021-11-17T10:00Z,24581 +2021-11-17T11:00Z,24069 +2021-11-17T12:00Z,23948 +2021-11-17T13:00Z,24397 +2021-11-17T14:00Z,25897 +2021-11-17T15:00Z,28245 +2021-11-17T16:00Z,29486 +2021-11-17T17:00Z,29780 +2021-11-17T18:00Z,29610 +2021-11-17T19:00Z,28980 +2021-11-17T20:00Z,28805 +2021-11-17T21:00Z,28777 +2021-11-17T22:00Z,29210 +2021-11-17T23:00Z,29956 +2021-11-18,30666 +2021-11-18T01:00Z,32249 +2021-11-18T02:00Z,34078 +2021-11-18T03:00Z,33690 +2021-11-18T04:00Z,32828 +2021-11-18T05:00Z,31870 +2021-11-18T06:00Z,30490 +2021-11-18T07:00Z,28546 +2021-11-18T08:00Z,26699 +2021-11-18T09:00Z,25511 +2021-11-18T10:00Z,24749 +2021-11-18T11:00Z,24282 +2021-11-18T12:00Z,24364 +2021-11-18T13:00Z,24681 +2021-11-18T14:00Z,26115 +2021-11-18T15:00Z,28513 +2021-11-18T16:00Z,29577 +2021-11-18T17:00Z,29756 +2021-11-18T18:00Z,29683 +2021-11-18T19:00Z,29190 +2021-11-18T20:00Z,29057 +2021-11-18T21:00Z,29376 +2021-11-18T22:00Z,29776 +2021-11-18T23:00Z,30223 +2021-11-19,31009 +2021-11-19T01:00Z,32389 +2021-11-19T02:00Z,34047 +2021-11-19T03:00Z,33616 +2021-11-19T04:00Z,32868 +2021-11-19T05:00Z,31925 +2021-11-19T06:00Z,30506 +2021-11-19T07:00Z,28617 +2021-11-19T08:00Z,26870 +2021-11-19T09:00Z,25641 +2021-11-19T10:00Z,24724 +2021-11-19T11:00Z,24246 +2021-11-19T12:00Z,24186 +2021-11-19T13:00Z,24651 +2021-11-19T14:00Z,26022 +2021-11-19T15:00Z,28326 +2021-11-19T16:00Z,29588 +2021-11-19T17:00Z,30053 +2021-11-19T18:00Z,29865 +2021-11-19T19:00Z,29457 +2021-11-19T20:00Z,29299 +2021-11-19T21:00Z,29512 +2021-11-19T22:00Z,29871 +2021-11-19T23:00Z,29962 +2021-11-20,30506 +2021-11-20T01:00Z,31906 +2021-11-20T02:00Z,33377 +2021-11-20T03:00Z,32741 +2021-11-20T04:00Z,31945 +2021-11-20T05:00Z,31071 +2021-11-20T06:00Z,29990 +2021-11-20T07:00Z,28438 +2021-11-20T08:00Z,26785 +2021-11-20T09:00Z,25635 +2021-11-20T10:00Z,24684 +2021-11-20T11:00Z,24392 +2021-11-20T12:00Z,24488 +2021-11-20T13:00Z,24379 +2021-11-20T14:00Z,25132 +2021-11-20T15:00Z,26112 +2021-11-20T16:00Z,26788 +2021-11-20T17:00Z,27314 +2021-11-20T18:00Z,26782 +2021-11-20T19:00Z,26190 +2021-11-20T20:00Z,25605 +2021-11-20T21:00Z,25351 +2021-11-20T22:00Z,25901 +2021-11-20T23:00Z,26756 +2021-11-21,27050 +2021-11-21T01:00Z,29013 +2021-11-21T02:00Z,31038 +2021-11-21T03:00Z,30796 +2021-11-21T04:00Z,30180 +2021-11-21T05:00Z,29502 +2021-11-21T06:00Z,28718 +2021-11-21T07:00Z,27277 +2021-11-21T08:00Z,26096 +2021-11-21T09:00Z,25105 +2021-11-21T10:00Z,23942 +2021-11-21T11:00Z,23444 +2021-11-21T12:00Z,23151 +2021-11-21T13:00Z,23197 +2021-11-21T14:00Z,23684 +2021-11-21T15:00Z,24462 +2021-11-21T16:00Z,24891 +2021-11-21T17:00Z,25697 +2021-11-21T18:00Z,25486 +2021-11-21T19:00Z,25083 +2021-11-21T20:00Z,24824 +2021-11-21T21:00Z,24832 +2021-11-21T22:00Z,25428 +2021-11-21T23:00Z,26166 +2021-11-22,27598 +2021-11-22T01:00Z,29281 +2021-11-22T02:00Z,31326 +2021-11-22T03:00Z,31186 +2021-11-22T04:00Z,30509 +2021-11-22T05:00Z,29685 +2021-11-22T06:00Z,28659 +2021-11-22T07:00Z,27086 +2021-11-22T08:00Z,25661 +2021-11-22T09:00Z,24604 +2021-11-22T10:00Z,23899 +2021-11-22T11:00Z,23723 +2021-11-22T12:00Z,23650 +2021-11-22T13:00Z,24070 +2021-11-22T14:00Z,25707 +2021-11-22T15:00Z,27967 +2021-11-22T16:00Z,29195 +2021-11-22T17:00Z,29843 +2021-11-22T18:00Z,29640 +2021-11-22T19:00Z,29125 +2021-11-22T20:00Z,28986 +2021-11-22T21:00Z,29212 +2021-11-22T22:00Z,29867 +2021-11-22T23:00Z,30528 +2021-11-23,31745 +2021-11-23T01:00Z,32788 +2021-11-23T02:00Z,34327 +2021-11-23T03:00Z,33940 +2021-11-23T04:00Z,32993 +2021-11-23T05:00Z,32068 +2021-11-23T06:00Z,30798 +2021-11-23T07:00Z,28853 +2021-11-23T08:00Z,27023 +2021-11-23T09:00Z,25802 +2021-11-23T10:00Z,24888 +2021-11-23T11:00Z,24279 +2021-11-23T12:00Z,24315 +2021-11-23T13:00Z,24697 +2021-11-23T14:00Z,26129 +2021-11-23T15:00Z,28088 +2021-11-23T16:00Z,29355 +2021-11-23T17:00Z,29823 +2021-11-23T18:00Z,30055 +2021-11-23T19:00Z,29585 +2021-11-23T20:00Z,29344 +2021-11-23T21:00Z,29266 +2021-11-23T22:00Z,29717 +2021-11-23T23:00Z,30535 +2021-11-24,30691 +2021-11-24T01:00Z,32291 +2021-11-24T02:00Z,34030 +2021-11-24T03:00Z,33506 +2021-11-24T04:00Z,32715 +2021-11-24T05:00Z,31852 +2021-11-24T06:00Z,30819 +2021-11-24T07:00Z,29384 +2021-11-24T08:00Z,27585 +2021-11-24T09:00Z,26242 +2021-11-24T10:00Z,25484 +2021-11-24T11:00Z,24707 +2021-11-24T12:00Z,24528 +2021-11-24T13:00Z,25054 +2021-11-24T14:00Z,26275 +2021-11-24T15:00Z,28324 +2021-11-24T16:00Z,29211 +2021-11-24T17:00Z,29297 +2021-11-24T18:00Z,29284 +2021-11-24T19:00Z,28366 +2021-11-24T20:00Z,28146 +2021-11-24T21:00Z,28240 +2021-11-24T22:00Z,28744 +2021-11-24T23:00Z,29079 +2021-11-25,29638 +2021-11-25T01:00Z,31536 +2021-11-25T02:00Z,33449 +2021-11-25T03:00Z,32971 +2021-11-25T04:00Z,32209 +2021-11-25T05:00Z,31467 +2021-11-25T06:00Z,30372 +2021-11-25T07:00Z,28697 +2021-11-25T08:00Z,26848 +2021-11-25T09:00Z,25573 +2021-11-25T10:00Z,24698 +2021-11-25T11:00Z,23892 +2021-11-25T12:00Z,23606 +2021-11-25T13:00Z,23643 +2021-11-25T14:00Z,24087 +2021-11-25T15:00Z,24948 +2021-11-25T16:00Z,25079 +2021-11-25T17:00Z,25345 +2021-11-25T18:00Z,25272 +2021-11-25T19:00Z,24998 +2021-11-25T20:00Z,24786 +2021-11-25T21:00Z,24674 +2021-11-25T22:00Z,25183 +2021-11-25T23:00Z,25758 +2021-11-26,26349 +2021-11-26T01:00Z,27750 +2021-11-26T02:00Z,28876 +2021-11-26T03:00Z,28209 +2021-11-26T04:00Z,27495 +2021-11-26T05:00Z,27394 +2021-11-26T06:00Z,26709 +2021-11-26T07:00Z,25825 +2021-11-26T08:00Z,24994 +2021-11-26T09:00Z,24026 +2021-11-26T10:00Z,23425 +2021-11-26T11:00Z,22997 +2021-11-26T12:00Z,22858 +2021-11-26T13:00Z,22959 +2021-11-26T14:00Z,23867 +2021-11-26T15:00Z,25029 +2021-11-26T16:00Z,25345 +2021-11-26T17:00Z,25388 +2021-11-26T18:00Z,24784 +2021-11-26T19:00Z,24336 +2021-11-26T20:00Z,24123 +2021-11-26T21:00Z,24068 +2021-11-26T22:00Z,24340 +2021-11-26T23:00Z,25450 +2021-11-27,27095 +2021-11-27T01:00Z,29104 +2021-11-27T02:00Z,30969 +2021-11-27T03:00Z,30619 +2021-11-27T04:00Z,30011 +2021-11-27T05:00Z,29285 +2021-11-27T06:00Z,28492 +2021-11-27T07:00Z,27150 +2021-11-27T08:00Z,25819 +2021-11-27T09:00Z,24623 +2021-11-27T10:00Z,23743 +2021-11-27T11:00Z,23166 +2021-11-27T12:00Z,22922 +2021-11-27T13:00Z,23009 +2021-11-27T14:00Z,23655 +2021-11-27T15:00Z,24595 +2021-11-27T16:00Z,24640 +2021-11-27T17:00Z,24631 +2021-11-27T18:00Z,24889 +2021-11-27T19:00Z,24615 +2021-11-27T20:00Z,24364 +2021-11-27T21:00Z,24237 +2021-11-27T22:00Z,24688 +2021-11-27T23:00Z,25578 +2021-11-28,26382 +2021-11-28T01:00Z,28437 +2021-11-28T02:00Z,30585 +2021-11-28T03:00Z,30461 +2021-11-28T04:00Z,29815 +2021-11-28T05:00Z,29179 +2021-11-28T06:00Z,28439 +2021-11-28T07:00Z,27001 +2021-11-28T08:00Z,25614 +2021-11-28T09:00Z,24482 +2021-11-28T10:00Z,23740 +2021-11-28T11:00Z,23177 +2021-11-28T12:00Z,22902 +2021-11-28T13:00Z,22916 +2021-11-28T14:00Z,23298 +2021-11-28T15:00Z,24000 +2021-11-28T16:00Z,24201 +2021-11-28T17:00Z,23928 +2021-11-28T18:00Z,24155 +2021-11-28T19:00Z,23860 +2021-11-28T20:00Z,23631 +2021-11-28T21:00Z,23859 +2021-11-28T22:00Z,24568 +2021-11-28T23:00Z,25726 +2021-11-29,26774 +2021-11-29T01:00Z,28869 +2021-11-29T02:00Z,31252 +2021-11-29T03:00Z,31209 +2021-11-29T04:00Z,29670 +2021-11-29T05:00Z,29779 +2021-11-29T06:00Z,28785 +2021-11-29T07:00Z,27089 +2021-11-29T08:00Z,25395 +2021-11-29T09:00Z,24572 +2021-11-29T10:00Z,24009 +2021-11-29T11:00Z,23539 +2021-11-29T12:00Z,23571 +2021-11-29T13:00Z,24235 +2021-11-29T14:00Z,25817 +2021-11-29T15:00Z,28171 +2021-11-29T16:00Z,29534 +2021-11-29T17:00Z,29471 +2021-11-29T18:00Z,29549 +2021-11-29T19:00Z,29053 +2021-11-29T20:00Z,28830 +2021-11-29T21:00Z,29183 +2021-11-29T22:00Z,29326 +2021-11-29T23:00Z,29985 +2021-11-30,31373 +2021-11-30T01:00Z,32956 +2021-11-30T02:00Z,34850 +2021-11-30T03:00Z,34389 +2021-11-30T04:00Z,33460 +2021-11-30T05:00Z,32311 +2021-11-30T06:00Z,31005 +2021-11-30T07:00Z,28905 +2021-11-30T08:00Z,27106 +2021-11-30T09:00Z,25924 +2021-11-30T10:00Z,25241 +2021-11-30T11:00Z,24635 +2021-11-30T12:00Z,24571 +2021-11-30T13:00Z,25122 +2021-11-30T14:00Z,26565 +2021-11-30T15:00Z,29227 +2021-11-30T16:00Z,30308 +2021-11-30T17:00Z,30448 +2021-11-30T18:00Z,29606 +2021-11-30T19:00Z,28917 +2021-11-30T20:00Z,28619 +2021-11-30T21:00Z,29030 +2021-11-30T22:00Z,29568 +2021-11-30T23:00Z,30361 +2021-12-01,31119 +2021-12-01T01:00Z,32959 +2021-12-01T02:00Z,34886 +2021-12-01T03:00Z,34490 +2021-12-01T04:00Z,33610 +2021-12-01T05:00Z,32707 +2021-12-01T06:00Z,31299 +2021-12-01T07:00Z,29373 +2021-12-01T08:00Z,27368 +2021-12-01T09:00Z,26016 +2021-12-01T10:00Z,25126 +2021-12-01T11:00Z,24593 +2021-12-01T12:00Z,24564 +2021-12-01T13:00Z,25189 +2021-12-01T14:00Z,26703 +2021-12-01T15:00Z,29141 +2021-12-01T16:00Z,30321 +2021-12-01T17:00Z,30053 +2021-12-01T18:00Z,29546 +2021-12-01T19:00Z,29248 +2021-12-01T20:00Z,29144 +2021-12-01T21:00Z,29310 +2021-12-01T22:00Z,29950 +2021-12-01T23:00Z,30415 +2021-12-02,31558 +2021-12-02T01:00Z,33055 +2021-12-02T02:00Z,34812 +2021-12-02T03:00Z,34365 +2021-12-02T04:00Z,33744 +2021-12-02T05:00Z,32712 +2021-12-02T06:00Z,31303 +2021-12-02T07:00Z,29285 +2021-12-02T08:00Z,27411 +2021-12-02T09:00Z,26293 +2021-12-02T10:00Z,25348 +2021-12-02T11:00Z,25044 +2021-12-02T12:00Z,24799 +2021-12-02T13:00Z,25165 +2021-12-02T14:00Z,26579 +2021-12-02T15:00Z,29075 +2021-12-02T16:00Z,30321 +2021-12-02T17:00Z,30542 +2021-12-02T18:00Z,30491 +2021-12-02T19:00Z,29640 +2021-12-02T20:00Z,29231 +2021-12-02T21:00Z,29111 +2021-12-02T22:00Z,29534 +2021-12-02T23:00Z,29904 +2021-12-03,30483 +2021-12-03T01:00Z,32391 +2021-12-03T02:00Z,34437 +2021-12-03T03:00Z,34342 +2021-12-03T04:00Z,33517 +2021-12-03T05:00Z,32587 +2021-12-03T06:00Z,31279 +2021-12-03T07:00Z,29247 +2021-12-03T08:00Z,27441 +2021-12-03T09:00Z,26173 +2021-12-03T10:00Z,25096 +2021-12-03T11:00Z,24508 +2021-12-03T12:00Z,24338 +2021-12-03T13:00Z,24895 +2021-12-03T14:00Z,26432 +2021-12-03T15:00Z,28917 +2021-12-03T16:00Z,30292 +2021-12-03T17:00Z,30429 +2021-12-03T18:00Z,30150 +2021-12-03T19:00Z,29549 +2021-12-03T20:00Z,29218 +2021-12-03T21:00Z,28900 +2021-12-03T22:00Z,28969 +2021-12-03T23:00Z,30580 +2021-12-04,30711 +2021-12-04T01:00Z,31996 +2021-12-04T02:00Z,33922 +2021-12-04T03:00Z,33464 +2021-12-04T04:00Z,32798 +2021-12-04T05:00Z,32100 +2021-12-04T06:00Z,31004 +2021-12-04T07:00Z,29389 +2021-12-04T08:00Z,27659 +2021-12-04T09:00Z,26353 +2021-12-04T10:00Z,25372 +2021-12-04T11:00Z,24970 +2021-12-04T12:00Z,24627 +2021-12-04T13:00Z,24578 +2021-12-04T14:00Z,25205 +2021-12-04T15:00Z,26309 +2021-12-04T16:00Z,26743 +2021-12-04T17:00Z,27946 +2021-12-04T18:00Z,28627 +2021-12-04T19:00Z,28256 +2021-12-04T20:00Z,27700 +2021-12-04T21:00Z,27014 +2021-12-04T22:00Z,27025 +2021-12-04T23:00Z,27255 +2021-12-05,27809 +2021-12-05T01:00Z,29906 +2021-12-05T02:00Z,32185 +2021-12-05T03:00Z,32150 +2021-12-05T04:00Z,31676 +2021-12-05T05:00Z,31102 +2021-12-05T06:00Z,30237 +2021-12-05T07:00Z,28706 +2021-12-05T08:00Z,27114 +2021-12-05T09:00Z,25874 +2021-12-05T10:00Z,25134 +2021-12-05T11:00Z,24365 +2021-12-05T12:00Z,24026 +2021-12-05T13:00Z,24017 +2021-12-05T14:00Z,24085 +2021-12-05T15:00Z,24887 +2021-12-05T16:00Z,25344 +2021-12-05T17:00Z,26383 +2021-12-05T18:00Z,27538 +2021-12-05T19:00Z,27700 +2021-12-05T20:00Z,27218 +2021-12-05T21:00Z,26918 +2021-12-05T22:00Z,26842 +2021-12-05T23:00Z,26773 +2021-12-06,27215 +2021-12-06T01:00Z,29355 +2021-12-06T02:00Z,32247 +2021-12-06T03:00Z,32492 +2021-12-06T04:00Z,32204 +2021-12-06T05:00Z,31469 +2021-12-06T06:00Z,30355 +2021-12-06T07:00Z,28583 +2021-12-06T08:00Z,26626 +2021-12-06T09:00Z,25545 +2021-12-06T10:00Z,24559 +2021-12-06T11:00Z,24227 +2021-12-06T12:00Z,24055 +2021-12-06T13:00Z,24805 +2021-12-06T14:00Z,26584 +2021-12-06T15:00Z,29197 +2021-12-06T16:00Z,30884 +2021-12-06T17:00Z,31253 +2021-12-06T18:00Z,31606 +2021-12-06T19:00Z,31465 +2021-12-06T20:00Z,31106 +2021-12-06T21:00Z,31067 +2021-12-06T22:00Z,31343 +2021-12-06T23:00Z,31571 +2021-12-07,32139 +2021-12-07T01:00Z,33810 +2021-12-07T02:00Z,35807 +2021-12-07T03:00Z,35345 +2021-12-07T04:00Z,34907 +2021-12-07T05:00Z,33785 +2021-12-07T06:00Z,32131 +2021-12-07T07:00Z,29838 +2021-12-07T08:00Z,27748 +2021-12-07T09:00Z,26499 +2021-12-07T10:00Z,25701 +2021-12-07T11:00Z,25331 +2021-12-07T12:00Z,25049 +2021-12-07T13:00Z,25329 +2021-12-07T14:00Z,26727 +2021-12-07T15:00Z,29269 +2021-12-07T16:00Z,31288 +2021-12-07T17:00Z,31720 +2021-12-07T18:00Z,31994 +2021-12-07T19:00Z,31984 +2021-12-07T20:00Z,31798 +2021-12-07T21:00Z,31191 +2021-12-07T22:00Z,30650 +2021-12-07T23:00Z,30305 +2021-12-08,31052 +2021-12-08T01:00Z,32774 +2021-12-08T02:00Z,35079 +2021-12-08T03:00Z,34976 +2021-12-08T04:00Z,34382 +2021-12-08T05:00Z,33536 +2021-12-08T06:00Z,32244 +2021-12-08T07:00Z,30046 +2021-12-08T08:00Z,28157 +2021-12-08T09:00Z,26729 +2021-12-08T10:00Z,25990 +2021-12-08T11:00Z,25995 +2021-12-08T12:00Z,25986 +2021-12-08T13:00Z,26105 +2021-12-08T14:00Z,27824 +2021-12-08T15:00Z,30447 +2021-12-08T16:00Z,32078 +2021-12-08T17:00Z,31620 +2021-12-08T18:00Z,31228 +2021-12-08T19:00Z,31113 +2021-12-08T20:00Z,30280 +2021-12-08T21:00Z,29950 +2021-12-08T22:00Z,30413 +2021-12-08T23:00Z,31034 +2021-12-09,31396 +2021-12-09T01:00Z,33360 +2021-12-09T02:00Z,35562 +2021-12-09T03:00Z,35361 +2021-12-09T04:00Z,34809 +2021-12-09T05:00Z,33898 +2021-12-09T06:00Z,32309 +2021-12-09T07:00Z,30211 +2021-12-09T08:00Z,28566 +2021-12-09T09:00Z,27747 +2021-12-09T10:00Z,27162 +2021-12-09T11:00Z,26045 +2021-12-09T12:00Z,25511 +2021-12-09T13:00Z,25792 +2021-12-09T14:00Z,26914 +2021-12-09T15:00Z,29174 +2021-12-09T16:00Z,30854 +2021-12-09T17:00Z,31561 +2021-12-09T18:00Z,31608 +2021-12-09T19:00Z,31658 +2021-12-09T20:00Z,31670 +2021-12-09T21:00Z,31313 +2021-12-09T22:00Z,31640 +2021-12-09T23:00Z,31067 +2021-12-10,31495 +2021-12-10T01:00Z,33001 +2021-12-10T02:00Z,35268 +2021-12-10T03:00Z,35351 +2021-12-10T04:00Z,38561 +2021-12-10T05:00Z,34195 +2021-12-10T06:00Z,32810 +2021-12-10T07:00Z,30762 +2021-12-10T08:00Z,28845 +2021-12-10T09:00Z,27661 +2021-12-10T10:00Z,26832 +2021-12-10T11:00Z,26480 +2021-12-10T12:00Z,26342 +2021-12-10T13:00Z,26559 +2021-12-10T14:00Z,28089 +2021-12-10T15:00Z,30680 +2021-12-10T16:00Z,32146 +2021-12-10T17:00Z,31783 +2021-12-10T18:00Z,30664 +2021-12-10T19:00Z,29717 +2021-12-10T20:00Z,29693 +2021-12-10T21:00Z,29549 +2021-12-10T22:00Z,28855 +2021-12-10T23:00Z,28983 +2021-12-11,29748 +2021-12-11T01:00Z,32131 +2021-12-11T02:00Z,34904 +2021-12-11T03:00Z,34979 +2021-12-11T04:00Z,34436 +2021-12-11T05:00Z,33960 +2021-12-11T06:00Z,32880 +2021-12-11T07:00Z,31151 +2021-12-11T08:00Z,29322 +2021-12-11T09:00Z,27789 +2021-12-11T10:00Z,26796 +2021-12-11T11:00Z,26216 +2021-12-11T12:00Z,26030 +2021-12-11T13:00Z,26160 +2021-12-11T14:00Z,26808 +2021-12-11T15:00Z,28192 +2021-12-11T16:00Z,28499 +2021-12-11T17:00Z,28145 +2021-12-11T18:00Z,27927 +2021-12-11T19:00Z,27506 +2021-12-11T20:00Z,26637 +2021-12-11T21:00Z,26243 +2021-12-11T22:00Z,26410 +2021-12-11T23:00Z,26869 +2021-12-12,27445 +2021-12-12T01:00Z,29988 +2021-12-12T02:00Z,32843 +2021-12-12T03:00Z,33105 +2021-12-12T04:00Z,32836 +2021-12-12T05:00Z,32216 +2021-12-12T06:00Z,31447 +2021-12-12T07:00Z,30086 +2021-12-12T08:00Z,28423 +2021-12-12T09:00Z,27012 +2021-12-12T10:00Z,26112 +2021-12-12T11:00Z,25776 +2021-12-12T12:00Z,25561 +2021-12-12T13:00Z,25560 +2021-12-12T14:00Z,25904 +2021-12-12T15:00Z,26879 +2021-12-12T16:00Z,27377 +2021-12-12T17:00Z,27829 +2021-12-12T18:00Z,27947 +2021-12-12T19:00Z,27470 +2021-12-12T20:00Z,27212 +2021-12-12T21:00Z,27287 +2021-12-12T22:00Z,27620 +2021-12-12T23:00Z,28177 +2021-12-13,28631 +2021-12-13T01:00Z,31090 +2021-12-13T02:00Z,33607 +2021-12-13T03:00Z,33771 +2021-12-13T04:00Z,33424 +2021-12-13T05:00Z,32723 +2021-12-13T06:00Z,31611 +2021-12-13T07:00Z,29677 +2021-12-13T08:00Z,27937 +2021-12-13T09:00Z,27048 +2021-12-13T10:00Z,26501 +2021-12-13T11:00Z,26117 +2021-12-13T12:00Z,25747 +2021-12-13T13:00Z,26359 +2021-12-13T14:00Z,27927 +2021-12-13T15:00Z,30396 +2021-12-13T16:00Z,32386 +2021-12-13T17:00Z,33202 +2021-12-13T18:00Z,33757 +2021-12-13T19:00Z,34163 +2021-12-13T20:00Z,34276 +2021-12-13T21:00Z,34356 +2021-12-13T22:00Z,34205 +2021-12-13T23:00Z,34233 +2021-12-14,34531 +2021-12-14T01:00Z,35829 +2021-12-14T02:00Z,37305 +2021-12-14T03:00Z,37134 +2021-12-14T04:00Z,36424 +2021-12-14T05:00Z,35476 +2021-12-14T06:00Z,33822 +2021-12-14T07:00Z,31456 +2021-12-14T08:00Z,29698 +2021-12-14T09:00Z,28360 +2021-12-14T10:00Z,27758 +2021-12-14T11:00Z,27265 +2021-12-14T12:00Z,26940 +2021-12-14T13:00Z,26998 +2021-12-14T14:00Z,28369 +2021-12-14T15:00Z,31044 +2021-12-14T16:00Z,33195 +2021-12-14T17:00Z,33918 +2021-12-14T18:00Z,34263 +2021-12-14T19:00Z,34022 +2021-12-14T20:00Z,33544 +2021-12-14T21:00Z,33635 +2021-12-14T22:00Z,33557 +2021-12-14T23:00Z,33426 +2021-12-15,33585 +2021-12-15T01:00Z,35115 +2021-12-15T02:00Z,37890 +2021-12-15T03:00Z,37955 +2021-12-15T04:00Z,37542 +2021-12-15T05:00Z,36736 +2021-12-15T06:00Z,35179 +2021-12-15T07:00Z,32789 +2021-12-15T08:00Z,30657 +2021-12-15T09:00Z,29127 +2021-12-15T10:00Z,28349 +2021-12-15T11:00Z,27828 +2021-12-15T12:00Z,27665 +2021-12-15T13:00Z,28169 +2021-12-15T14:00Z,29785 +2021-12-15T15:00Z,32753 +2021-12-15T16:00Z,34221 +2021-12-15T17:00Z,33705 +2021-12-15T18:00Z,32526 +2021-12-15T19:00Z,31350 +2021-12-15T20:00Z,31022 +2021-12-15T21:00Z,31207 +2021-12-15T22:00Z,31578 +2021-12-15T23:00Z,32119 +2021-12-16,32994 +2021-12-16T01:00Z,35095 +2021-12-16T02:00Z,37861 +2021-12-16T03:00Z,37893 +2021-12-16T04:00Z,37491 +2021-12-16T05:00Z,36781 +2021-12-16T06:00Z,35343 +2021-12-16T07:00Z,33149 +2021-12-16T08:00Z,30631 +2021-12-16T09:00Z,29476 +2021-12-16T10:00Z,28472 +2021-12-16T11:00Z,27943 +2021-12-16T12:00Z,27989 +2021-12-16T13:00Z,28370 +2021-12-16T14:00Z,29826 +2021-12-16T15:00Z,32543 +2021-12-16T16:00Z,33974 +2021-12-16T17:00Z,33658 +2021-12-16T18:00Z,32922 +2021-12-16T19:00Z,31985 +2021-12-16T20:00Z,31230 +2021-12-16T21:00Z,31292 +2021-12-16T22:00Z,32198 +2021-12-16T23:00Z,32185 +2021-12-17,32717 +2021-12-17T01:00Z,34953 +2021-12-17T02:00Z,37190 +2021-12-17T03:00Z,37218 +2021-12-17T04:00Z,36560 +2021-12-17T05:00Z,35764 +2021-12-17T06:00Z,34608 +2021-12-17T07:00Z,32476 +2021-12-17T08:00Z,30357 +2021-12-17T09:00Z,29007 +2021-12-17T10:00Z,27943 +2021-12-17T11:00Z,27488 +2021-12-17T12:00Z,27398 +2021-12-17T13:00Z,27845 +2021-12-17T14:00Z,29416 +2021-12-17T15:00Z,32243 +2021-12-17T16:00Z,33662 +2021-12-17T17:00Z,33240 +2021-12-17T18:00Z,32459 +2021-12-17T19:00Z,32068 +2021-12-17T20:00Z,31519 +2021-12-17T21:00Z,30841 +2021-12-17T22:00Z,30489 +2021-12-17T23:00Z,30323 +2021-12-18,31125 +2021-12-18T01:00Z,33062 +2021-12-18T02:00Z,35732 +2021-12-18T03:00Z,35979 +2021-12-18T04:00Z,35455 +2021-12-18T05:00Z,34888 +2021-12-18T06:00Z,33950 +2021-12-18T07:00Z,32269 +2021-12-18T08:00Z,30393 +2021-12-18T09:00Z,29449 +2021-12-18T10:00Z,28570 +2021-12-18T11:00Z,27868 +2021-12-18T12:00Z,27579 +2021-12-18T13:00Z,27731 +2021-12-18T14:00Z,28521 +2021-12-18T15:00Z,29849 +2021-12-18T16:00Z,30681 +2021-12-18T17:00Z,30703 +2021-12-18T18:00Z,30187 +2021-12-18T19:00Z,29299 +2021-12-18T20:00Z,28645 +2021-12-18T21:00Z,28151 +2021-12-18T22:00Z,28394 +2021-12-18T23:00Z,28639 +2021-12-19,29088 +2021-12-19T01:00Z,31591 +2021-12-19T02:00Z,34650 +2021-12-19T03:00Z,34886 +2021-12-19T04:00Z,34561 +2021-12-19T05:00Z,34161 +2021-12-19T06:00Z,33555 +2021-12-19T07:00Z,32027 +2021-12-19T08:00Z,30346 +2021-12-19T09:00Z,28888 +2021-12-19T10:00Z,27930 +2021-12-19T11:00Z,27484 +2021-12-19T12:00Z,27242 +2021-12-19T13:00Z,27301 +2021-12-19T14:00Z,27771 +2021-12-19T15:00Z,28752 +2021-12-19T16:00Z,29233 +2021-12-19T17:00Z,29467 +2021-12-19T18:00Z,29433 +2021-12-19T19:00Z,28777 +2021-12-19T20:00Z,28380 +2021-12-19T21:00Z,27827 +2021-12-19T22:00Z,27838 +2021-12-19T23:00Z,28263 +2021-12-20,28996 +2021-12-20T01:00Z,31503 +2021-12-20T02:00Z,34548 +2021-12-20T03:00Z,34849 +2021-12-20T04:00Z,34757 +2021-12-20T05:00Z,34402 +2021-12-20T06:00Z,33558 +2021-12-20T07:00Z,31684 +2021-12-20T08:00Z,29658 +2021-12-20T09:00Z,28345 +2021-12-20T10:00Z,27910 +2021-12-20T11:00Z,27545 +2021-12-20T12:00Z,27500 +2021-12-20T13:00Z,27752 +2021-12-20T14:00Z,29478 +2021-12-20T15:00Z,31909 +2021-12-20T16:00Z,33624 +2021-12-20T17:00Z,33819 +2021-12-20T18:00Z,32974 +2021-12-20T19:00Z,31932 +2021-12-20T20:00Z,31434 +2021-12-20T21:00Z,31754 +2021-12-20T22:00Z,31825 +2021-12-20T23:00Z,32616 +2021-12-21,32887 +2021-12-21T01:00Z,34369 +2021-12-21T02:00Z,36484 +2021-12-21T03:00Z,36561 +2021-12-21T04:00Z,36130 +2021-12-21T05:00Z,35317 +2021-12-21T06:00Z,34023 +2021-12-21T07:00Z,31789 +2021-12-21T08:00Z,29650 +2021-12-21T09:00Z,28037 +2021-12-21T10:00Z,27103 +2021-12-21T11:00Z,26798 +2021-12-21T12:00Z,26484 +2021-12-21T13:00Z,26842 +2021-12-21T14:00Z,28142 +2021-12-21T15:00Z,30699 +2021-12-21T16:00Z,32639 +2021-12-21T17:00Z,33162 +2021-12-21T18:00Z,32907 +2021-12-21T19:00Z,32378 +2021-12-21T20:00Z,31921 +2021-12-21T21:00Z,31481 +2021-12-21T22:00Z,31393 +2021-12-21T23:00Z,31315 +2021-12-22,32061 +2021-12-22T01:00Z,33617 +2021-12-22T02:00Z,35910 +2021-12-22T03:00Z,36012 +2021-12-22T04:00Z,35543 +2021-12-22T05:00Z,34854 +2021-12-22T06:00Z,33690 +2021-12-22T07:00Z,31718 +2021-12-22T08:00Z,29753 +2021-12-22T09:00Z,28208 +2021-12-22T10:00Z,27264 +2021-12-22T11:00Z,26894 +2021-12-22T12:00Z,26503 +2021-12-22T13:00Z,26847 +2021-12-22T14:00Z,28287 +2021-12-22T15:00Z,30545 +2021-12-22T16:00Z,32016 +2021-12-22T17:00Z,32369 +2021-12-22T18:00Z,32150 +2021-12-22T19:00Z,31567 +2021-12-22T20:00Z,31659 +2021-12-22T21:00Z,31871 +2021-12-22T22:00Z,31982 +2021-12-22T23:00Z,32175 +2021-12-23,32828 +2021-12-23T01:00Z,33821 +2021-12-23T02:00Z,35659 +2021-12-23T03:00Z,35465 +2021-12-23T04:00Z,34729 +2021-12-23T05:00Z,33926 +2021-12-23T06:00Z,32665 +2021-12-23T07:00Z,30638 +2021-12-23T08:00Z,28623 +2021-12-23T09:00Z,27117 +2021-12-23T10:00Z,25982 +2021-12-23T11:00Z,25328 +2021-12-23T12:00Z,25173 +2021-12-23T13:00Z,25455 +2021-12-23T14:00Z,26605 +2021-12-23T15:00Z,28497 +2021-12-23T16:00Z,29983 +2021-12-23T17:00Z,30834 +2021-12-23T18:00Z,31887 +2021-12-23T19:00Z,32546 +2021-12-23T20:00Z,33109 +2021-12-23T21:00Z,32999 +2021-12-23T22:00Z,32470 +2021-12-23T23:00Z,32160 +2021-12-24,32475 +2021-12-24T01:00Z,33304 +2021-12-24T02:00Z,35027 +2021-12-24T03:00Z,34796 +2021-12-24T04:00Z,34102 +2021-12-24T05:00Z,33336 +2021-12-24T06:00Z,32330 +2021-12-24T07:00Z,30641 +2021-12-24T08:00Z,28845 +2021-12-24T09:00Z,27473 +2021-12-24T10:00Z,26685 +2021-12-24T11:00Z,26063 +2021-12-24T12:00Z,25680 +2021-12-24T13:00Z,25461 +2021-12-24T14:00Z,25659 +2021-12-24T15:00Z,26694 +2021-12-24T16:00Z,27662 +2021-12-24T17:00Z,27892 +2021-12-24T18:00Z,28284 +2021-12-24T19:00Z,27468 +2021-12-24T20:00Z,26519 +2021-12-24T21:00Z,25982 +2021-12-24T22:00Z,26334 +2021-12-24T23:00Z,27001 +2021-12-25,28336 +2021-12-25T01:00Z,29939 +2021-12-25T02:00Z,31997 +2021-12-25T03:00Z,31427 +2021-12-25T04:00Z,30818 +2021-12-25T05:00Z,30709 +2021-12-25T06:00Z,30132 +2021-12-25T07:00Z,29080 +2021-12-25T08:00Z,27894 +2021-12-25T09:00Z,26924 +2021-12-25T10:00Z,25979 +2021-12-25T11:00Z,25235 +2021-12-25T12:00Z,24997 +2021-12-25T13:00Z,24784 +2021-12-25T14:00Z,24675 +2021-12-25T15:00Z,25292 +2021-12-25T16:00Z,25884 +2021-12-25T17:00Z,26936 +2021-12-25T18:00Z,27505 +2021-12-25T19:00Z,27474 +2021-12-25T20:00Z,27291 +2021-12-25T21:00Z,27280 +2021-12-25T22:00Z,27285 +2021-12-25T23:00Z,27706 +2021-12-26,28043 +2021-12-26T01:00Z,29081 +2021-12-26T02:00Z,30744 +2021-12-26T03:00Z,30546 +2021-12-26T04:00Z,30193 +2021-12-26T05:00Z,29967 +2021-12-26T06:00Z,29496 +2021-12-26T07:00Z,28556 +2021-12-26T08:00Z,27514 +2021-12-26T09:00Z,26488 +2021-12-26T10:00Z,25410 +2021-12-26T11:00Z,24823 +2021-12-26T12:00Z,24650 +2021-12-26T13:00Z,24754 +2021-12-26T14:00Z,25179 +2021-12-26T15:00Z,26268 +2021-12-26T16:00Z,26627 +2021-12-26T17:00Z,26483 +2021-12-26T18:00Z,26807 +2021-12-26T19:00Z,26328 +2021-12-26T20:00Z,26149 +2021-12-26T21:00Z,26288 +2021-12-26T22:00Z,26265 +2021-12-26T23:00Z,26561 +2021-12-27,27567 +2021-12-27T01:00Z,29528 +2021-12-27T02:00Z,32497 +2021-12-27T03:00Z,32888 +2021-12-27T04:00Z,32618 +2021-12-27T05:00Z,31989 +2021-12-27T06:00Z,31106 +2021-12-27T07:00Z,29430 +2021-12-27T08:00Z,27619 +2021-12-27T09:00Z,26734 +2021-12-27T10:00Z,26077 +2021-12-27T11:00Z,25914 +2021-12-27T12:00Z,25745 +2021-12-27T13:00Z,26178 +2021-12-27T14:00Z,27135 +2021-12-27T15:00Z,28721 +2021-12-27T16:00Z,30207 +2021-12-27T17:00Z,30725 +2021-12-27T18:00Z,30527 +2021-12-27T19:00Z,30149 +2021-12-27T20:00Z,30301 +2021-12-27T21:00Z,30636 +2021-12-27T22:00Z,30814 +2021-12-27T23:00Z,31402 +2021-12-28,31779 +2021-12-28T01:00Z,33399 +2021-12-28T02:00Z,35658 +2021-12-28T03:00Z,35579 +2021-12-28T04:00Z,34982 +2021-12-28T05:00Z,34121 +2021-12-28T06:00Z,32842 +2021-12-28T07:00Z,30917 +2021-12-28T08:00Z,28866 +2021-12-28T09:00Z,27693 +2021-12-28T10:00Z,26818 +2021-12-28T11:00Z,26382 +2021-12-28T12:00Z,26396 +2021-12-28T13:00Z,26999 +2021-12-28T14:00Z,27915 +2021-12-28T15:00Z,29709 +2021-12-28T16:00Z,31039 +2021-12-28T17:00Z,31415 +2021-12-28T18:00Z,31119 +2021-12-28T19:00Z,30964 +2021-12-28T20:00Z,30668 +2021-12-28T21:00Z,30438 +2021-12-28T22:00Z,30472 +2021-12-28T23:00Z,31058 +2021-12-29,31810 +2021-12-29T01:00Z,33401 +2021-12-29T02:00Z,35855 +2021-12-29T03:00Z,35942 +2021-12-29T04:00Z,35252 +2021-12-29T05:00Z,34470 +2021-12-29T06:00Z,33220 +2021-12-29T07:00Z,31399 +2021-12-29T08:00Z,29468 +2021-12-29T09:00Z,27877 +2021-12-29T10:00Z,26992 +2021-12-29T11:00Z,26533 +2021-12-29T12:00Z,26364 +2021-12-29T13:00Z,26495 +2021-12-29T14:00Z,27603 +2021-12-29T15:00Z,29498 +2021-12-29T16:00Z,30795 +2021-12-29T17:00Z,31459 +2021-12-29T18:00Z,31712 +2021-12-29T19:00Z,31814 +2021-12-29T20:00Z,31974 +2021-12-29T21:00Z,32464 +2021-12-29T22:00Z,32573 +2021-12-29T23:00Z,32772 +2021-12-30,33147 +2021-12-30T01:00Z,34399 +2021-12-30T02:00Z,36367 +2021-12-30T03:00Z,36174 +2021-12-30T04:00Z,35396 +2021-12-30T05:00Z,34469 +2021-12-30T06:00Z,33150 +2021-12-30T07:00Z,31259 +2021-12-30T08:00Z,29074 +2021-12-30T09:00Z,27715 +2021-12-30T10:00Z,26724 +2021-12-30T11:00Z,26182 +2021-12-30T12:00Z,25981 +2021-12-30T13:00Z,26170 +2021-12-30T14:00Z,27312 +2021-12-30T15:00Z,29246 +2021-12-30T16:00Z,30667 +2021-12-30T17:00Z,31288 +2021-12-30T18:00Z,31098 +2021-12-30T19:00Z,30553 +2021-12-30T20:00Z,30142 +2021-12-30T21:00Z,29785 +2021-12-30T22:00Z,29577 +2021-12-30T23:00Z,29658 +2021-12-31,30501 +2021-12-31T01:00Z,32418 +2021-12-31T02:00Z,34825 +2021-12-31T03:00Z,34788 +2021-12-31T04:00Z,34166 +2021-12-31T05:00Z,33387 +2021-12-31T06:00Z,32246 +2021-12-31T07:00Z,30517 +2021-12-31T08:00Z,28629 +2021-12-31T09:00Z,27220 +2021-12-31T10:00Z,26257 +2021-12-31T11:00Z,25624 +2021-12-31T12:00Z,25258 +2021-12-31T13:00Z,25444 +2021-12-31T14:00Z,26431 +2021-12-31T15:00Z,27611 +2021-12-31T16:00Z,28312 +2021-12-31T17:00Z,28458 +2021-12-31T18:00Z,28294 +2021-12-31T19:00Z,27551 +2021-12-31T20:00Z,26946 +2021-12-31T21:00Z,26852 +2021-12-31T22:00Z,27100 +2021-12-31T23:00Z,27294 +2022-01-01,27730 +2022-01-01T01:00Z,29970 +2022-01-01T02:00Z,33002 +2022-01-01T03:00Z,33101 +2022-01-01T04:00Z,32336 +2022-01-01T05:00Z,31464 +2022-01-01T06:00Z,30535 +2022-01-01T07:00Z,29463 +2022-01-01T08:00Z,28453 +2022-01-01T09:00Z,27258 +2022-01-01T10:00Z,26281 +2022-01-01T11:00Z,25711 +2022-01-01T12:00Z,25480 +2022-01-01T13:00Z,25516 +2022-01-01T14:00Z,25987 +2022-01-01T15:00Z,26782 +2022-01-01T16:00Z,26947 +2022-01-01T17:00Z,26658 +2022-01-01T18:00Z,25800 +2022-01-01T19:00Z,24996 +2022-01-01T20:00Z,23778 +2022-01-01T21:00Z,23515 +2022-01-01T22:00Z,23518 +2022-01-01T23:00Z,24484 +2022-01-02,25435 +2022-01-02T01:00Z,27867 +2022-01-02T02:00Z,31261 +2022-01-02T03:00Z,32093 +2022-01-02T04:00Z,31986 +2022-01-02T05:00Z,31632 +2022-01-02T06:00Z,31002 +2022-01-02T07:00Z,29684 +2022-01-02T08:00Z,28195 +2022-01-02T09:00Z,27094 +2022-01-02T10:00Z,26349 +2022-01-02T11:00Z,26001 +2022-01-02T12:00Z,25865 +2022-01-02T13:00Z,26097 +2022-01-02T14:00Z,26743 +2022-01-02T15:00Z,27756 +2022-01-02T16:00Z,28268 +2022-01-02T17:00Z,27796 +2022-01-02T18:00Z,26880 +2022-01-02T19:00Z,25704 +2022-01-02T20:00Z,24655 +2022-01-02T21:00Z,24247 +2022-01-02T22:00Z,24390 +2022-01-02T23:00Z,25109 +2022-01-03,26144 +2022-01-03T01:00Z,29091 +2022-01-03T02:00Z,32582 +2022-01-03T03:00Z,33226 +2022-01-03T04:00Z,33002 +2022-01-03T05:00Z,32488 +2022-01-03T06:00Z,31540 +2022-01-03T07:00Z,29901 +2022-01-03T08:00Z,28107 +2022-01-03T09:00Z,27089 +2022-01-03T10:00Z,26320 +2022-01-03T11:00Z,26047 +2022-01-03T12:00Z,26180 +2022-01-03T13:00Z,26739 +2022-01-03T14:00Z,28573 +2022-01-03T15:00Z,30947 +2022-01-03T16:00Z,32393 +2022-01-03T17:00Z,31983 +2022-01-03T18:00Z,31056 +2022-01-03T19:00Z,30263 +2022-01-03T20:00Z,29356 +2022-01-03T21:00Z,29407 +2022-01-03T22:00Z,29414 +2022-01-03T23:00Z,29806 +2022-01-04,30463 +2022-01-04T01:00Z,32507 +2022-01-04T02:00Z,35381 +2022-01-04T03:00Z,35647 +2022-01-04T04:00Z,35102 +2022-01-04T05:00Z,34263 +2022-01-04T06:00Z,32897 +2022-01-04T07:00Z,30827 +2022-01-04T08:00Z,28830 +2022-01-04T09:00Z,27495 +2022-01-04T10:00Z,26586 +2022-01-04T11:00Z,26452 +2022-01-04T12:00Z,26278 +2022-01-04T13:00Z,26745 +2022-01-04T14:00Z,28307 +2022-01-04T15:00Z,30836 +2022-01-04T16:00Z,31858 +2022-01-04T17:00Z,31874 +2022-01-04T18:00Z,31336 +2022-01-04T19:00Z,30050 +2022-01-04T20:00Z,28726 +2022-01-04T21:00Z,28282 +2022-01-04T22:00Z,28133 +2022-01-04T23:00Z,28525 +2022-01-05,29294 +2022-01-05T01:00Z,31592 +2022-01-05T02:00Z,34529 +2022-01-05T03:00Z,34782 +2022-01-05T04:00Z,34287 +2022-01-05T05:00Z,33447 +2022-01-05T06:00Z,32184 +2022-01-05T07:00Z,30299 +2022-01-05T08:00Z,28373 +2022-01-05T09:00Z,27248 +2022-01-05T10:00Z,25831 +2022-01-05T11:00Z,25914 +2022-01-05T12:00Z,25949 +2022-01-05T13:00Z,26442 +2022-01-05T14:00Z,27870 +2022-01-05T15:00Z,30392 +2022-01-05T16:00Z,31893 +2022-01-05T17:00Z,31801 +2022-01-05T18:00Z,31025 +2022-01-05T19:00Z,30045 +2022-01-05T20:00Z,28774 +2022-01-05T21:00Z,28155 +2022-01-05T22:00Z,28123 +2022-01-05T23:00Z,28520 +2022-01-06,29346 +2022-01-06T01:00Z,31561 +2022-01-06T02:00Z,34085 +2022-01-06T03:00Z,34259 +2022-01-06T04:00Z,33686 +2022-01-06T05:00Z,32834 +2022-01-06T06:00Z,31569 +2022-01-06T07:00Z,29696 +2022-01-06T08:00Z,27833 +2022-01-06T09:00Z,26804 +2022-01-06T10:00Z,25947 +2022-01-06T11:00Z,25459 +2022-01-06T12:00Z,25432 +2022-01-06T13:00Z,25984 +2022-01-06T14:00Z,27441 +2022-01-06T15:00Z,29949 +2022-01-06T16:00Z,31403 +2022-01-06T17:00Z,31073 +2022-01-06T18:00Z,30597 +2022-01-06T19:00Z,29786 +2022-01-06T20:00Z,29377 +2022-01-06T21:00Z,29055 +2022-01-06T22:00Z,29066 +2022-01-06T23:00Z,29391 +2022-01-07,29888 +2022-01-07T01:00Z,31723 +2022-01-07T02:00Z,34084 +2022-01-07T03:00Z,34211 +2022-01-07T04:00Z,33499 +2022-01-07T05:00Z,32578 +2022-01-07T06:00Z,31380 +2022-01-07T07:00Z,29542 +2022-01-07T08:00Z,27759 +2022-01-07T09:00Z,26586 +2022-01-07T10:00Z,25817 +2022-01-07T11:00Z,25396 +2022-01-07T12:00Z,25286 +2022-01-07T13:00Z,25981 +2022-01-07T14:00Z,27413 +2022-01-07T15:00Z,29767 +2022-01-07T16:00Z,31306 +2022-01-07T17:00Z,31722 +2022-01-07T18:00Z,31769 +2022-01-07T19:00Z,31337 +2022-01-07T20:00Z,30568 +2022-01-07T21:00Z,30525 +2022-01-07T22:00Z,30583 +2022-01-07T23:00Z,30641 +2022-01-08,30789 +2022-01-08T01:00Z,32030 +2022-01-08T02:00Z,34227 +2022-01-08T03:00Z,34190 +2022-01-08T04:00Z,33467 +2022-01-08T05:00Z,32582 +2022-01-08T06:00Z,31412 +2022-01-08T07:00Z,29743 +2022-01-08T08:00Z,27926 +2022-01-08T09:00Z,26705 +2022-01-08T10:00Z,25628 +2022-01-08T11:00Z,25050 +2022-01-08T12:00Z,24675 +2022-01-08T13:00Z,24921 +2022-01-08T14:00Z,25515 +2022-01-08T15:00Z,26649 +2022-01-08T16:00Z,27438 +2022-01-08T17:00Z,27865 +2022-01-08T18:00Z,27337 +2022-01-08T19:00Z,26800 +2022-01-08T20:00Z,26240 +2022-01-08T21:00Z,25613 +2022-01-08T22:00Z,25375 +2022-01-08T23:00Z,25837 +2022-01-09,26618 +2022-01-09T01:00Z,28750 +2022-01-09T02:00Z,31668 +2022-01-09T03:00Z,32188 +2022-01-09T04:00Z,31846 +2022-01-09T05:00Z,31228 +2022-01-09T06:00Z,30374 +2022-01-09T07:00Z,28960 +2022-01-09T08:00Z,27534 +2022-01-09T09:00Z,26488 +2022-01-09T10:00Z,25687 +2022-01-09T11:00Z,25208 +2022-01-09T12:00Z,24943 +2022-01-09T13:00Z,25027 +2022-01-09T14:00Z,25640 +2022-01-09T15:00Z,26600 +2022-01-09T16:00Z,27046 +2022-01-09T17:00Z,26771 +2022-01-09T18:00Z,26206 +2022-01-09T19:00Z,25225 +2022-01-09T20:00Z,24102 +2022-01-09T21:00Z,23758 +2022-01-09T22:00Z,23807 +2022-01-09T23:00Z,24418 +2022-01-10,25392 +2022-01-10T01:00Z,28332 +2022-01-10T02:00Z,31567 +2022-01-10T03:00Z,32086 +2022-01-10T04:00Z,31664 +2022-01-10T05:00Z,30915 +2022-01-10T06:00Z,29921 +2022-01-10T07:00Z,28187 +2022-01-10T08:00Z,26500 +2022-01-10T09:00Z,25826 +2022-01-10T10:00Z,25184 +2022-01-10T11:00Z,24822 +2022-01-10T12:00Z,24816 +2022-01-10T13:00Z,25577 +2022-01-10T14:00Z,27267 +2022-01-10T15:00Z,30021 +2022-01-10T16:00Z,31953 +2022-01-10T17:00Z,31974 +2022-01-10T18:00Z,31489 +2022-01-10T19:00Z,30398 +2022-01-10T20:00Z,29230 +2022-01-10T21:00Z,28502 +2022-01-10T22:00Z,28309 +2022-01-10T23:00Z,28507 +2022-01-11,29547 +2022-01-11T01:00Z,31579 +2022-01-11T02:00Z,34078 +2022-01-11T03:00Z,34307 +2022-01-11T04:00Z,33691 +2022-01-11T05:00Z,32746 +2022-01-11T06:00Z,31406 +2022-01-11T07:00Z,29423 +2022-01-11T08:00Z,27616 +2022-01-11T09:00Z,26878 +2022-01-11T10:00Z,25979 +2022-01-11T11:00Z,25564 +2022-01-11T12:00Z,25370 +2022-01-11T13:00Z,26047 +2022-01-11T14:00Z,27816 +2022-01-11T15:00Z,30693 +2022-01-11T16:00Z,32318 +2022-01-11T17:00Z,31575 +2022-01-11T18:00Z,30212 +2022-01-11T19:00Z,28593 +2022-01-11T20:00Z,27516 +2022-01-11T21:00Z,27259 +2022-01-11T22:00Z,27635 +2022-01-11T23:00Z,28287 +2022-01-12,29252 +2022-01-12T01:00Z,31286 +2022-01-12T02:00Z,33928 +2022-01-12T03:00Z,34181 +2022-01-12T04:00Z,33352 +2022-01-12T05:00Z,32456 +2022-01-12T06:00Z,31166 +2022-01-12T07:00Z,29227 +2022-01-12T08:00Z,27468 +2022-01-12T09:00Z,26542 +2022-01-12T10:00Z,25804 +2022-01-12T11:00Z,25429 +2022-01-12T12:00Z,25438 +2022-01-12T13:00Z,26010 +2022-01-12T14:00Z,27681 +2022-01-12T15:00Z,30673 +2022-01-12T16:00Z,32392 +2022-01-12T17:00Z,31891 +2022-01-12T18:00Z,30650 +2022-01-12T19:00Z,29262 +2022-01-12T20:00Z,28391 +2022-01-12T21:00Z,28284 +2022-01-12T22:00Z,28347 +2022-01-12T23:00Z,28691 +2022-01-13,30122 +2022-01-13T01:00Z,32466 +2022-01-13T02:00Z,34233 +2022-01-13T03:00Z,34009 +2022-01-13T04:00Z,33343 +2022-01-13T05:00Z,32381 +2022-01-13T06:00Z,31151 +2022-01-13T07:00Z,29127 +2022-01-13T08:00Z,27448 +2022-01-13T09:00Z,26442 +2022-01-13T10:00Z,25724 +2022-01-13T11:00Z,25257 +2022-01-13T12:00Z,25262 +2022-01-13T13:00Z,25638 +2022-01-13T14:00Z,27250 +2022-01-13T15:00Z,29973 +2022-01-13T16:00Z,31519 +2022-01-13T17:00Z,31660 +2022-01-13T18:00Z,31211 +2022-01-13T19:00Z,30610 +2022-01-13T20:00Z,30316 +2022-01-13T21:00Z,30354 +2022-01-13T22:00Z,29928 +2022-01-13T23:00Z,30028 +2022-01-14,31062 +2022-01-14T01:00Z,32179 +2022-01-14T02:00Z,34085 +2022-01-14T03:00Z,34135 +2022-01-14T04:00Z,33381 +2022-01-14T05:00Z,32409 +2022-01-14T06:00Z,30960 +2022-01-14T07:00Z,29061 +2022-01-14T08:00Z,27290 +2022-01-14T09:00Z,26254 +2022-01-14T10:00Z,25633 +2022-01-14T11:00Z,25061 +2022-01-14T12:00Z,25053 +2022-01-14T13:00Z,25623 +2022-01-14T14:00Z,27164 +2022-01-14T15:00Z,29987 +2022-01-14T16:00Z,31599 +2022-01-14T17:00Z,31337 +2022-01-14T18:00Z,30173 +2022-01-14T19:00Z,28922 +2022-01-14T20:00Z,28051 +2022-01-14T21:00Z,27619 +2022-01-14T22:00Z,27746 +2022-01-14T23:00Z,28190 +2022-01-15,28960 +2022-01-15T01:00Z,30588 +2022-01-15T02:00Z,33068 +2022-01-15T03:00Z,33079 +2022-01-15T04:00Z,32362 +2022-01-15T05:00Z,31481 +2022-01-15T06:00Z,30440 +2022-01-15T07:00Z,28995 +2022-01-15T08:00Z,27394 +2022-01-15T09:00Z,26097 +2022-01-15T10:00Z,25215 +2022-01-15T11:00Z,24663 +2022-01-15T12:00Z,24323 +2022-01-15T13:00Z,24422 +2022-01-15T14:00Z,25162 +2022-01-15T15:00Z,26418 +2022-01-15T16:00Z,27332 +2022-01-15T17:00Z,28105 +2022-01-15T18:00Z,28554 +2022-01-15T19:00Z,28657 +2022-01-15T20:00Z,28094 +2022-01-15T21:00Z,27819 +2022-01-15T22:00Z,27555 +2022-01-15T23:00Z,27343 +2022-01-16,28113 +2022-01-16T01:00Z,29008 +2022-01-16T02:00Z,31397 +2022-01-16T03:00Z,31783 +2022-01-16T04:00Z,31003 +2022-01-16T05:00Z,30333 +2022-01-16T06:00Z,29379 +2022-01-16T07:00Z,28042 +2022-01-16T08:00Z,26541 +2022-01-16T09:00Z,25442 +2022-01-16T10:00Z,24489 +2022-01-16T11:00Z,23929 +2022-01-16T12:00Z,23561 +2022-01-16T13:00Z,23648 +2022-01-16T14:00Z,24090 +2022-01-16T15:00Z,24953 +2022-01-16T16:00Z,25455 +2022-01-16T17:00Z,25617 +2022-01-16T18:00Z,25278 +2022-01-16T19:00Z,24831 +2022-01-16T20:00Z,24310 +2022-01-16T21:00Z,24160 +2022-01-16T22:00Z,24381 +2022-01-16T23:00Z,24889 +2022-01-17,26174 +2022-01-17T01:00Z,27906 +2022-01-17T02:00Z,30476 +2022-01-17T03:00Z,31045 +2022-01-17T04:00Z,30466 +2022-01-17T05:00Z,29698 +2022-01-17T06:00Z,28624 +2022-01-17T07:00Z,27250 +2022-01-17T08:00Z,25832 +2022-01-17T09:00Z,24911 +2022-01-17T10:00Z,24281 +2022-01-17T11:00Z,23742 +2022-01-17T12:00Z,23798 +2022-01-17T13:00Z,24324 +2022-01-17T14:00Z,25844 +2022-01-17T15:00Z,27806 +2022-01-17T16:00Z,29124 +2022-01-17T17:00Z,29751 +2022-01-17T18:00Z,29561 +2022-01-17T19:00Z,29118 +2022-01-17T20:00Z,29013 +2022-01-17T21:00Z,28841 +2022-01-17T22:00Z,29012 +2022-01-17T23:00Z,29024 +2022-01-18,29710 +2022-01-18T01:00Z,31042 +2022-01-18T02:00Z,33329 +2022-01-18T03:00Z,33542 +2022-01-18T04:00Z,32862 +2022-01-18T05:00Z,31943 +2022-01-18T06:00Z,30593 +2022-01-18T07:00Z,28639 +2022-01-18T08:00Z,26804 +2022-01-18T09:00Z,25684 +2022-01-18T10:00Z,24885 +2022-01-18T11:00Z,24530 +2022-01-18T12:00Z,24640 +2022-01-18T13:00Z,24982 +2022-01-18T14:00Z,26647 +2022-01-18T15:00Z,29126 +2022-01-18T16:00Z,30796 +2022-01-18T17:00Z,31036 +2022-01-18T18:00Z,30351 +2022-01-18T19:00Z,29367 +2022-01-18T20:00Z,28629 +2022-01-18T21:00Z,27976 +2022-01-18T22:00Z,27975 +2022-01-18T23:00Z,27986 +2022-01-19,28506 +2022-01-19T01:00Z,30401 +2022-01-19T02:00Z,33149 +2022-01-19T03:00Z,33571 +2022-01-19T04:00Z,32791 +2022-01-19T05:00Z,31832 +2022-01-19T06:00Z,30742 +2022-01-19T07:00Z,28813 +2022-01-19T08:00Z,26940 +2022-01-19T09:00Z,25734 +2022-01-19T10:00Z,25038 +2022-01-19T11:00Z,24649 +2022-01-19T12:00Z,24590 +2022-01-19T13:00Z,25175 +2022-01-19T14:00Z,26857 +2022-01-19T15:00Z,29590 +2022-01-19T16:00Z,31374 +2022-01-19T17:00Z,31316 +2022-01-19T18:00Z,30626 +2022-01-19T19:00Z,29650 +2022-01-19T20:00Z,28364 +2022-01-19T21:00Z,27355 +2022-01-19T22:00Z,27048 +2022-01-19T23:00Z,27483 +2022-01-20,28325 +2022-01-20T01:00Z,30266 +2022-01-20T02:00Z,33063 +2022-01-20T03:00Z,33702 +2022-01-20T04:00Z,33085 +2022-01-20T05:00Z,32145 +2022-01-20T06:00Z,30874 +2022-01-20T07:00Z,28915 +2022-01-20T08:00Z,27190 +2022-01-20T09:00Z,26003 +2022-01-20T10:00Z,25182 +2022-01-20T11:00Z,25012 +2022-01-20T12:00Z,25061 +2022-01-20T13:00Z,25610 +2022-01-20T14:00Z,27271 +2022-01-20T15:00Z,30136 +2022-01-20T16:00Z,31660 +2022-01-20T17:00Z,31200 +2022-01-20T18:00Z,30163 +2022-01-20T19:00Z,28734 +2022-01-20T20:00Z,27603 +2022-01-20T21:00Z,27219 +2022-01-20T22:00Z,27186 +2022-01-20T23:00Z,27736 +2022-01-21,28447 +2022-01-21T01:00Z,30547 +2022-01-21T02:00Z,32916 +2022-01-21T03:00Z,33452 +2022-01-21T04:00Z,32763 +2022-01-21T05:00Z,31940 +2022-01-21T06:00Z,30741 +2022-01-21T07:00Z,28924 +2022-01-21T08:00Z,26925 +2022-01-21T09:00Z,26120 +2022-01-21T10:00Z,25315 +2022-01-21T11:00Z,24981 +2022-01-21T12:00Z,24946 +2022-01-21T13:00Z,25566 +2022-01-21T14:00Z,27102 +2022-01-21T15:00Z,29981 +2022-01-21T16:00Z,31650 +2022-01-21T17:00Z,30927 +2022-01-21T18:00Z,29694 +2022-01-21T19:00Z,28611 +2022-01-21T20:00Z,28029 +2022-01-21T21:00Z,27528 +2022-01-21T22:00Z,27306 +2022-01-21T23:00Z,27642 +2022-01-22,28149 +2022-01-22T01:00Z,30050 +2022-01-22T02:00Z,32566 +2022-01-22T03:00Z,33027 +2022-01-22T04:00Z,32208 +2022-01-22T05:00Z,31419 +2022-01-22T06:00Z,30355 +2022-01-22T07:00Z,28703 +2022-01-22T08:00Z,27124 +2022-01-22T09:00Z,26018 +2022-01-22T10:00Z,25153 +2022-01-22T11:00Z,24589 +2022-01-22T12:00Z,24306 +2022-01-22T13:00Z,24520 +2022-01-22T14:00Z,25204 +2022-01-22T15:00Z,26289 +2022-01-22T16:00Z,26765 +2022-01-22T17:00Z,26915 +2022-01-22T18:00Z,25973 +2022-01-22T19:00Z,25051 +2022-01-22T20:00Z,23873 +2022-01-22T21:00Z,23354 +2022-01-22T22:00Z,23372 +2022-01-22T23:00Z,24159 +2022-01-23,25007 +2022-01-23T01:00Z,27332 +2022-01-23T02:00Z,30212 +2022-01-23T03:00Z,30940 +2022-01-23T04:00Z,30375 +2022-01-23T05:00Z,29776 +2022-01-23T06:00Z,28952 +2022-01-23T07:00Z,27610 +2022-01-23T08:00Z,26174 +2022-01-23T09:00Z,25303 +2022-01-23T10:00Z,24453 +2022-01-23T11:00Z,23896 +2022-01-23T12:00Z,23756 +2022-01-23T13:00Z,23870 +2022-01-23T14:00Z,24413 +2022-01-23T15:00Z,25325 +2022-01-23T16:00Z,25662 +2022-01-23T17:00Z,25535 +2022-01-23T18:00Z,24661 +2022-01-23T19:00Z,23741 +2022-01-23T20:00Z,23107 +2022-01-23T21:00Z,22656 +2022-01-23T22:00Z,22665 +2022-01-23T23:00Z,23792 +2022-01-24,24754 diff --git a/test/data/federal-funds.csv b/test/data/federal-funds.csv new file mode 100644 index 0000000000..ac65d52c6a --- /dev/null +++ b/test/data/federal-funds.csv @@ -0,0 +1,1057 @@ +"Series Description","Federal funds effective rate" +"Unit:","Percent:_Per_Year" +"Multiplier:","1" +"Currency:","NA" +"Unique Identifier: ","H15/H15/RIFSPFF_N.BWAW" +"Time Period","RIFSPFF_N.BWAW" +1982-09-29,10.21 +1982-10-13,10.19 +1982-10-27,9.49 +1982-11-10,9.44 +1982-11-24,9.26 +1982-12-08,8.77 +1982-12-22,8.78 +1983-01-05,9.50 +1983-01-19,8.46 +1983-02-02,8.49 +1983-02-16,8.56 +1983-03-02,8.46 +1983-03-16,8.58 +1983-03-30,8.81 +1983-04-13,9.10 +1983-04-27,8.64 +1983-05-11,8.64 +1983-05-25,8.65 +1983-06-08,8.80 +1983-06-22,8.99 +1983-07-06,9.15 +1983-07-20,9.32 +1983-08-03,9.53 +1983-08-17,9.66 +1983-08-31,9.42 +1983-09-14,9.54 +1983-09-28,9.26 +1983-10-12,9.73 +1983-10-26,9.36 +1983-11-09,9.38 +1983-11-23,9.34 +1983-12-07,9.38 +1983-12-21,9.57 +1984-01-04,9.51 +1984-01-18,9.54 +1984-02-01,9.47 +1984-02-15,9.56 +1984-02-29,9.61 +1984-03-14,9.76 +1984-03-28,10.01 +1984-04-11,10.27 +1984-04-25,10.18 +1984-05-09,10.58 +1984-05-23,10.13 +1984-06-06,10.51 +1984-06-20,11.17 +1984-07-04,11.09 +1984-07-18,11.23 +1984-08-01,11.36 +1984-08-15,11.61 +1984-08-29,11.63 +1984-09-12,11.60 +1984-09-26,11.09 +1984-10-10,10.60 +1984-10-24,9.84 +1984-11-07,9.80 +1984-11-21,9.51 +1984-12-05,8.92 +1984-12-19,8.34 +1985-01-02,8.35 +1985-01-16,8.25 +1985-01-30,8.32 +1985-02-13,8.52 +1985-02-27,8.49 +1985-03-13,8.58 +1985-03-27,8.57 +1985-04-10,8.57 +1985-04-24,8.08 +1985-05-08,8.27 +1985-05-22,8.03 +1985-06-05,7.68 +1985-06-19,7.38 +1985-07-03,7.76 +1985-07-17,7.92 +1985-07-31,7.76 +1985-08-14,7.90 +1985-08-28,7.92 +1985-09-11,7.84 +1985-09-25,7.91 +1985-10-09,7.98 +1985-10-23,8.08 +1985-11-06,8.09 +1985-11-20,8.04 +1985-12-04,8.10 +1985-12-18,8.04 +1986-01-01,8.78 +1986-01-15,8.07 +1986-01-29,7.85 +1986-02-12,7.91 +1986-02-26,7.83 +1986-03-12,7.71 +1986-03-26,7.36 +1986-04-09,7.22 +1986-04-23,6.95 +1986-05-07,6.87 +1986-05-21,6.85 +1986-06-04,6.90 +1986-06-18,6.88 +1986-07-02,6.94 +1986-07-16,6.69 +1986-07-30,6.37 +1986-08-13,6.33 +1986-08-27,6.13 +1986-09-10,5.83 +1986-09-24,5.84 +1986-10-08,5.91 +1986-10-22,5.87 +1986-11-05,5.94 +1986-11-19,6.05 +1986-12-03,6.12 +1986-12-17,6.14 +1986-12-31,7.76 +1987-01-14,6.82 +1987-01-28,6.07 +1987-02-11,6.18 +1987-02-25,6.08 +1987-03-11,6.09 +1987-03-25,6.11 +1987-04-08,6.17 +1987-04-22,6.34 +1987-05-06,6.90 +1987-05-20,6.76 +1987-06-03,6.73 +1987-06-17,6.73 +1987-07-01,6.70 +1987-07-15,6.58 +1987-07-29,6.60 +1987-08-12,6.66 +1987-08-26,6.75 +1987-09-09,6.90 +1987-09-23,7.24 +1987-10-07,7.50 +1987-10-21,7.48 +1987-11-04,6.73 +1987-11-18,6.73 +1987-12-02,6.83 +1987-12-16,6.71 +1987-12-30,6.78 +1988-01-13,6.92 +1988-01-27,6.77 +1988-02-10,6.57 +1988-02-24,6.64 +1988-03-09,6.56 +1988-03-23,6.56 +1988-04-06,6.72 +1988-04-20,6.87 +1988-05-04,6.83 +1988-05-18,7.03 +1988-06-01,7.28 +1988-06-15,7.40 +1988-06-29,7.58 +1988-07-13,7.70 +1988-07-27,7.82 +1988-08-10,7.80 +1988-08-24,8.11 +1988-09-07,8.15 +1988-09-21,8.15 +1988-10-05,8.31 +1988-10-19,8.27 +1988-11-02,8.33 +1988-11-16,8.29 +1988-11-30,8.38 +1988-12-14,8.55 +1988-12-28,8.87 +1989-01-11,9.15 +1989-01-25,9.09 +1989-02-08,9.13 +1989-02-22,9.33 +1989-03-08,9.81 +1989-03-22,9.85 +1989-04-05,9.80 +1989-04-19,9.89 +1989-05-03,9.87 +1989-05-17,9.80 +1989-05-31,9.79 +1989-06-14,9.51 +1989-06-28,9.53 +1989-07-12,9.44 +1989-07-26,9.19 +1989-08-09,8.97 +1989-08-23,9.02 +1989-09-06,8.96 +1989-09-20,9.00 +1989-10-04,9.10 +1989-10-18,8.84 +1989-11-01,8.76 +1989-11-15,8.58 +1989-11-29,8.48 +1989-12-13,8.50 +1989-12-27,8.45 +1990-01-10,8.27 +1990-01-24,8.21 +1990-02-07,8.23 +1990-02-21,8.23 +1990-03-07,8.27 +1990-03-21,8.27 +1990-04-04,8.30 +1990-04-18,8.26 +1990-05-02,8.18 +1990-05-16,8.18 +1990-05-30,8.21 +1990-06-13,8.28 +1990-06-27,8.28 +1990-07-11,8.31 +1990-07-25,8.09 +1990-08-08,8.05 +1990-08-22,8.21 +1990-09-05,8.17 +1990-09-19,8.15 +1990-10-03,8.24 +1990-10-17,8.08 +1990-10-31,8.08 +1990-11-14,7.96 +1990-11-28,7.68 +1990-12-12,7.43 +1990-12-26,7.23 +1991-01-09,6.79 +1991-01-23,6.82 +1991-02-06,6.89 +1991-02-20,6.28 +1991-03-06,6.39 +1991-03-20,6.13 +1991-04-03,6.05 +1991-04-17,5.79 +1991-05-01,5.92 +1991-05-15,5.79 +1991-05-29,5.76 +1991-06-12,5.83 +1991-06-26,5.78 +1991-07-10,6.06 +1991-07-24,5.80 +1991-08-07,5.81 +1991-08-21,5.65 +1991-09-04,5.59 +1991-09-18,5.50 +1991-10-02,5.31 +1991-10-16,5.24 +1991-10-30,5.17 +1991-11-13,4.89 +1991-11-27,4.78 +1991-12-11,4.67 +1991-12-25,4.36 +1992-01-08,4.19 +1992-01-22,3.94 +1992-02-05,4.09 +1992-02-19,4.07 +1992-03-04,4.02 +1992-03-18,4.00 +1992-04-01,4.01 +1992-04-15,3.81 +1992-04-29,3.56 +1992-05-13,3.80 +1992-05-27,3.85 +1992-06-10,3.77 +1992-06-24,3.72 +1992-07-08,3.56 +1992-07-22,3.25 +1992-08-05,3.25 +1992-08-19,3.29 +1992-09-02,3.30 +1992-09-16,3.19 +1992-09-30,3.24 +1992-10-14,3.20 +1992-10-28,3.01 +1992-11-11,2.99 +1992-11-25,3.04 +1992-12-09,3.16 +1992-12-23,2.94 +1993-01-06,2.94 +1993-01-20,3.04 +1993-02-03,3.04 +1993-02-17,2.99 +1993-03-03,3.07 +1993-03-17,3.03 +1993-03-31,3.05 +1993-04-14,3.02 +1993-04-28,2.89 +1993-05-12,2.94 +1993-05-26,3.04 +1993-06-09,3.03 +1993-06-23,3.00 +1993-07-07,3.11 +1993-07-21,3.05 +1993-08-04,3.06 +1993-08-18,3.02 +1993-09-01,3.03 +1993-09-15,3.01 +1993-09-29,3.09 +1993-10-13,3.07 +1993-10-27,2.97 +1993-11-10,3.00 +1993-11-24,3.01 +1993-12-08,3.01 +1993-12-22,2.97 +1994-01-05,2.99 +1994-01-19,3.06 +1994-02-02,3.07 +1994-02-16,3.23 +1994-03-02,3.26 +1994-03-16,3.22 +1994-03-30,3.40 +1994-04-13,3.53 +1994-04-27,3.59 +1994-05-11,3.73 +1994-05-25,4.12 +1994-06-08,4.20 +1994-06-22,4.20 +1994-07-06,4.28 +1994-07-20,4.30 +1994-08-03,4.28 +1994-08-17,4.31 +1994-08-31,4.69 +1994-09-14,4.72 +1994-09-28,4.69 +1994-10-12,4.84 +1994-10-26,4.72 +1994-11-09,4.75 +1994-11-23,5.38 +1994-12-07,5.66 +1994-12-21,5.52 +1995-01-04,5.42 +1995-01-18,5.49 +1995-02-01,5.52 +1995-02-15,5.94 +1995-03-01,5.91 +1995-03-15,5.94 +1995-03-29,6.01 +1995-04-12,6.09 +1995-04-26,6.03 +1995-05-10,6.02 +1995-05-24,6.00 +1995-06-07,6.03 +1995-06-21,6.01 +1995-07-05,6.08 +1995-07-19,5.76 +1995-08-02,5.79 +1995-08-16,5.74 +1995-08-30,5.70 +1995-09-13,5.75 +1995-09-27,5.79 +1995-10-11,5.86 +1995-10-25,5.73 +1995-11-08,5.74 +1995-11-22,5.77 +1995-12-06,5.83 +1995-12-20,5.82 +1996-01-03,5.42 +1996-01-17,5.57 +1996-01-31,5.49 +1996-02-14,5.15 +1996-02-28,5.24 +1996-03-13,5.41 +1996-03-27,5.29 +1996-04-10,5.19 +1996-04-24,5.24 +1996-05-08,5.26 +1996-05-22,5.24 +1996-06-05,5.26 +1996-06-19,5.35 +1996-07-03,5.37 +1996-07-17,5.24 +1996-07-31,5.39 +1996-08-14,5.24 +1996-08-28,5.20 +1996-09-11,5.28 +1996-09-25,5.28 +1996-10-09,5.27 +1996-10-23,5.22 +1996-11-06,5.30 +1996-11-20,5.31 +1996-12-04,5.41 +1996-12-18,5.30 +1997-01-01,5.28 +1997-01-15,5.24 +1997-01-29,5.19 +1997-02-12,5.18 +1997-02-26,5.19 +1997-03-12,5.27 +1997-03-26,5.33 +1997-04-09,5.61 +1997-04-23,5.48 +1997-05-07,5.58 +1997-05-21,5.50 +1997-06-04,5.48 +1997-06-18,5.55 +1997-07-02,5.62 +1997-07-16,5.46 +1997-07-30,5.50 +1997-08-13,5.54 +1997-08-27,5.58 +1997-09-10,5.56 +1997-09-24,5.51 +1997-10-08,5.52 +1997-10-22,5.50 +1997-11-05,5.55 +1997-11-19,5.50 +1997-12-03,5.53 +1997-12-17,5.53 +1997-12-31,5.44 +1998-01-14,5.59 +1998-01-28,5.53 +1998-02-11,5.48 +1998-02-25,5.52 +1998-03-11,5.52 +1998-03-25,5.45 +1998-04-08,5.54 +1998-04-22,5.42 +1998-05-06,5.38 +1998-05-20,5.54 +1998-06-03,5.54 +1998-06-17,5.51 +1998-07-01,5.65 +1998-07-15,5.48 +1998-07-29,5.52 +1998-08-12,5.55 +1998-08-26,5.54 +1998-09-09,5.54 +1998-09-23,5.48 +1998-10-07,5.40 +1998-10-21,5.00 +1998-11-04,5.08 +1998-11-18,4.84 +1998-12-02,4.70 +1998-12-16,4.82 +1998-12-30,4.58 +1999-01-13,4.53 +1999-01-27,4.65 +1999-02-10,4.76 +1999-02-24,4.75 +1999-03-10,4.83 +1999-03-24,4.79 +1999-04-07,4.82 +1999-04-21,4.65 +1999-05-05,4.85 +1999-05-19,4.73 +1999-06-02,4.69 +1999-06-16,4.72 +1999-06-30,4.83 +1999-07-14,4.98 +1999-07-28,4.99 +1999-08-11,5.01 +1999-08-25,5.03 +1999-09-08,5.25 +1999-09-22,5.20 +1999-10-06,5.27 +1999-10-20,5.17 +1999-11-03,5.23 +1999-11-17,5.32 +1999-12-01,5.58 +1999-12-15,5.45 +1999-12-29,5.24 +2000-01-12,5.17 +2000-01-26,5.51 +2000-02-09,5.69 +2000-02-23,5.73 +2000-03-08,5.75 +2000-03-22,5.80 +2000-04-05,6.06 +2000-04-19,6.01 +2000-05-03,6.02 +2000-05-17,6.06 +2000-05-31,6.51 +2000-06-14,6.50 +2000-06-28,6.52 +2000-07-12,6.64 +2000-07-26,6.50 +2000-08-09,6.47 +2000-08-23,6.49 +2000-09-06,6.55 +2000-09-20,6.50 +2000-10-04,6.54 +2000-10-18,6.48 +2000-11-01,6.53 +2000-11-15,6.51 +2000-11-29,6.51 +2000-12-13,6.52 +2000-12-27,6.50 +2001-01-10,5.90 +2001-01-24,5.99 +2001-02-07,5.73 +2001-02-21,5.48 +2001-03-07,5.50 +2001-03-21,5.39 +2001-04-04,5.10 +2001-04-18,4.97 +2001-05-02,4.48 +2001-05-16,4.40 +2001-05-30,3.98 +2001-06-13,4.04 +2001-06-27,3.93 +2001-07-11,3.78 +2001-07-25,3.79 +2001-08-08,3.75 +2001-08-22,3.69 +2001-09-05,3.57 +2001-09-19,2.98 +2001-10-03,2.85 +2001-10-17,2.44 +2001-10-31,2.52 +2001-11-14,2.20 +2001-11-28,1.98 +2001-12-12,1.95 +2001-12-26,1.80 +2002-01-09,1.64 +2002-01-23,1.74 +2002-02-06,1.76 +2002-02-20,1.74 +2002-03-06,1.74 +2002-03-20,1.74 +2002-04-03,1.74 +2002-04-17,1.74 +2002-05-01,1.76 +2002-05-15,1.74 +2002-05-29,1.74 +2002-06-12,1.76 +2002-06-26,1.75 +2002-07-10,1.74 +2002-07-24,1.73 +2002-08-07,1.73 +2002-08-21,1.72 +2002-09-04,1.78 +2002-09-18,1.73 +2002-10-02,1.76 +2002-10-16,1.74 +2002-10-30,1.76 +2002-11-13,1.45 +2002-11-27,1.28 +2002-12-11,1.24 +2002-12-25,1.25 +2003-01-08,1.20 +2003-01-22,1.25 +2003-02-05,1.26 +2003-02-19,1.26 +2003-03-05,1.27 +2003-03-19,1.24 +2003-04-02,1.25 +2003-04-16,1.25 +2003-04-30,1.27 +2003-05-14,1.26 +2003-05-28,1.25 +2003-06-11,1.25 +2003-06-25,1.23 +2003-07-09,1.05 +2003-07-23,1.02 +2003-08-06,1.00 +2003-08-20,1.08 +2003-09-03,1.01 +2003-09-17,0.99 +2003-10-01,1.04 +2003-10-15,1.01 +2003-10-29,1.00 +2003-11-12,1.00 +2003-11-26,0.99 +2003-12-10,0.99 +2003-12-24,0.99 +2004-01-07,0.97 +2004-01-21,1.00 +2004-02-04,1.01 +2004-02-18,1.01 +2004-03-03,1.01 +2004-03-17,1.00 +2004-03-31,1.00 +2004-04-14,1.01 +2004-04-28,1.00 +2004-05-12,1.00 +2004-05-26,1.01 +2004-06-09,1.00 +2004-06-23,1.01 +2004-07-07,1.20 +2004-07-21,1.25 +2004-08-04,1.27 +2004-08-18,1.39 +2004-09-01,1.52 +2004-09-15,1.49 +2004-09-29,1.70 +2004-10-13,1.78 +2004-10-27,1.75 +2004-11-10,1.79 +2004-11-24,2.00 +2004-12-08,2.01 +2004-12-22,2.20 +2005-01-05,2.20 +2005-01-19,2.26 +2005-02-02,2.35 +2005-02-16,2.50 +2005-03-02,2.51 +2005-03-16,2.52 +2005-03-30,2.74 +2005-04-13,2.79 +2005-04-27,2.76 +2005-05-11,2.97 +2005-05-25,3.01 +2005-06-08,3.00 +2005-06-22,3.00 +2005-07-06,3.20 +2005-07-20,3.24 +2005-08-03,3.28 +2005-08-17,3.51 +2005-08-31,3.53 +2005-09-14,3.50 +2005-09-28,3.71 +2005-10-12,3.77 +2005-10-26,3.76 +2005-11-09,3.97 +2005-11-23,3.99 +2005-12-07,4.01 +2005-12-21,4.21 +2006-01-04,4.19 +2006-01-18,4.26 +2006-02-01,4.35 +2006-02-15,4.49 +2006-03-01,4.49 +2006-03-15,4.51 +2006-03-29,4.64 +2006-04-12,4.82 +2006-04-26,4.76 +2006-05-10,4.83 +2006-05-24,4.99 +2006-06-07,5.00 +2006-06-21,4.98 +2006-07-05,5.07 +2006-07-19,5.25 +2006-08-02,5.25 +2006-08-16,5.24 +2006-08-30,5.24 +2006-09-13,5.24 +2006-09-27,5.26 +2006-10-11,5.27 +2006-10-25,5.24 +2006-11-08,5.24 +2006-11-22,5.24 +2006-12-06,5.26 +2006-12-20,5.25 +2007-01-03,5.23 +2007-01-17,5.24 +2007-01-31,5.26 +2007-02-14,5.25 +2007-02-28,5.27 +2007-03-14,5.25 +2007-03-28,5.26 +2007-04-11,5.27 +2007-04-25,5.24 +2007-05-09,5.24 +2007-05-23,5.25 +2007-06-06,5.26 +2007-06-20,5.26 +2007-07-04,5.27 +2007-07-18,5.25 +2007-08-01,5.27 +2007-08-15,5.02 +2007-08-29,5.01 +2007-09-12,5.01 +2007-09-26,4.95 +2007-10-10,4.74 +2007-10-24,4.74 +2007-11-07,4.56 +2007-11-21,4.52 +2007-12-05,4.54 +2007-12-19,4.30 +2008-01-02,3.99 +2008-01-16,4.23 +2008-01-30,3.75 +2008-02-13,3.00 +2008-02-27,2.97 +2008-03-12,2.99 +2008-03-26,2.44 +2008-04-09,2.23 +2008-04-23,2.30 +2008-05-07,2.11 +2008-05-21,1.96 +2008-06-04,2.02 +2008-06-18,1.98 +2008-07-02,2.02 +2008-07-16,1.98 +2008-07-30,2.03 +2008-08-13,2.01 +2008-08-27,2.01 +2008-09-10,1.97 +2008-09-24,1.89 +2008-10-08,1.45 +2008-10-22,0.82 +2008-11-05,0.53 +2008-11-19,0.32 +2008-12-03,0.53 +2008-12-17,0.14 +2008-12-31,0.11 +2009-01-14,0.10 +2009-01-28,0.19 +2009-02-11,0.23 +2009-02-25,0.22 +2009-03-11,0.21 +2009-03-25,0.17 +2009-04-08,0.15 +2009-04-22,0.14 +2009-05-06,0.19 +2009-05-20,0.16 +2009-06-03,0.18 +2009-06-17,0.20 +2009-07-01,0.22 +2009-07-15,0.16 +2009-07-29,0.15 +2009-08-12,0.17 +2009-08-26,0.16 +2009-09-09,0.15 +2009-09-23,0.16 +2009-10-07,0.12 +2009-10-21,0.12 +2009-11-04,0.11 +2009-11-18,0.12 +2009-12-02,0.12 +2009-12-16,0.12 +2009-12-30,0.12 +2010-01-13,0.09 +2010-01-27,0.12 +2010-02-10,0.13 +2010-02-24,0.12 +2010-03-10,0.15 +2010-03-24,0.18 +2010-04-07,0.18 +2010-04-21,0.20 +2010-05-05,0.20 +2010-05-19,0.20 +2010-06-02,0.20 +2010-06-16,0.19 +2010-06-30,0.16 +2010-07-14,0.18 +2010-07-28,0.19 +2010-08-11,0.18 +2010-08-25,0.19 +2010-09-08,0.19 +2010-09-22,0.20 +2010-10-06,0.20 +2010-10-20,0.19 +2010-11-03,0.19 +2010-11-17,0.19 +2010-12-01,0.20 +2010-12-15,0.18 +2010-12-29,0.19 +2011-01-12,0.17 +2011-01-26,0.17 +2011-02-09,0.17 +2011-02-23,0.15 +2011-03-09,0.15 +2011-03-23,0.14 +2011-04-06,0.12 +2011-04-20,0.10 +2011-05-04,0.09 +2011-05-18,0.09 +2011-06-01,0.10 +2011-06-15,0.10 +2011-06-29,0.09 +2011-07-13,0.07 +2011-07-27,0.06 +2011-08-10,0.11 +2011-08-24,0.09 +2011-09-07,0.08 +2011-09-21,0.09 +2011-10-05,0.07 +2011-10-19,0.07 +2011-11-02,0.07 +2011-11-16,0.08 +2011-11-30,0.08 +2011-12-14,0.08 +2011-12-28,0.07 +2012-01-11,0.06 +2012-01-25,0.09 +2012-02-08,0.10 +2012-02-22,0.11 +2012-03-07,0.10 +2012-03-21,0.13 +2012-04-04,0.13 +2012-04-18,0.15 +2012-05-02,0.14 +2012-05-16,0.16 +2012-05-30,0.16 +2012-06-13,0.17 +2012-06-27,0.17 +2012-07-11,0.15 +2012-07-25,0.16 +2012-08-08,0.14 +2012-08-22,0.13 +2012-09-05,0.13 +2012-09-19,0.15 +2012-10-03,0.14 +2012-10-17,0.16 +2012-10-31,0.16 +2012-11-14,0.16 +2012-11-28,0.16 +2012-12-12,0.16 +2012-12-26,0.17 +2013-01-09,0.15 +2013-01-23,0.14 +2013-02-06,0.14 +2013-02-20,0.15 +2013-03-06,0.15 +2013-03-20,0.15 +2013-04-03,0.13 +2013-04-17,0.15 +2013-05-01,0.14 +2013-05-15,0.13 +2013-05-29,0.09 +2013-06-12,0.09 +2013-06-26,0.10 +2013-07-10,0.09 +2013-07-24,0.09 +2013-08-07,0.09 +2013-08-21,0.09 +2013-09-04,0.08 +2013-09-18,0.08 +2013-10-02,0.08 +2013-10-16,0.09 +2013-10-30,0.09 +2013-11-13,0.08 +2013-11-27,0.09 +2013-12-11,0.09 +2013-12-25,0.09 +2014-01-08,0.08 +2014-01-22,0.07 +2014-02-05,0.07 +2014-02-19,0.06 +2014-03-05,0.07 +2014-03-19,0.08 +2014-04-02,0.08 +2014-04-16,0.09 +2014-04-30,0.10 +2014-05-14,0.09 +2014-05-28,0.09 +2014-06-11,0.09 +2014-06-25,0.10 +2014-07-09,0.10 +2014-07-23,0.09 +2014-08-06,0.09 +2014-08-20,0.09 +2014-09-03,0.08 +2014-09-17,0.09 +2014-10-01,0.09 +2014-10-15,0.09 +2014-10-29,0.09 +2014-11-12,0.09 +2014-11-26,0.10 +2014-12-10,0.11 +2014-12-24,0.13 +2015-01-07,0.12 +2015-01-21,0.12 +2015-02-04,0.11 +2015-02-18,0.12 +2015-03-04,0.10 +2015-03-18,0.12 +2015-04-01,0.11 +2015-04-15,0.12 +2015-04-29,0.13 +2015-05-13,0.13 +2015-05-27,0.13 +2015-06-10,0.12 +2015-06-24,0.13 +2015-07-08,0.13 +2015-07-22,0.13 +2015-08-05,0.12 +2015-08-19,0.14 +2015-09-02,0.14 +2015-09-16,0.14 +2015-09-30,0.13 +2015-10-14,0.13 +2015-10-28,0.13 +2015-11-11,0.11 +2015-11-25,0.12 +2015-12-09,0.12 +2015-12-23,0.26 +2016-01-06,0.31 +2016-01-20,0.36 +2016-02-03,0.36 +2016-02-17,0.38 +2016-03-02,0.37 +2016-03-16,0.36 +2016-03-30,0.37 +2016-04-13,0.36 +2016-04-27,0.37 +2016-05-11,0.36 +2016-05-25,0.37 +2016-06-08,0.36 +2016-06-22,0.38 +2016-07-06,0.40 +2016-07-20,0.40 +2016-08-03,0.38 +2016-08-17,0.40 +2016-08-31,0.39 +2016-09-14,0.40 +2016-09-28,0.40 +2016-10-12,0.38 +2016-10-26,0.41 +2016-11-09,0.40 +2016-11-23,0.41 +2016-12-07,0.40 +2016-12-21,0.54 +2017-01-04,0.63 +2017-01-18,0.66 +2017-02-01,0.65 +2017-02-15,0.66 +2017-03-01,0.65 +2017-03-15,0.66 +2017-03-29,0.91 +2017-04-12,0.89 +2017-04-26,0.91 +2017-05-10,0.89 +2017-05-24,0.91 +2017-06-07,0.90 +2017-06-21,1.04 +2017-07-05,1.14 +2017-07-19,1.16 +2017-08-02,1.15 +2017-08-16,1.16 +2017-08-30,1.16 +2017-09-13,1.15 +2017-09-27,1.16 +2017-10-11,1.14 +2017-10-25,1.16 +2017-11-08,1.15 +2017-11-22,1.16 +2017-12-06,1.15 +2017-12-20,1.29 +2018-01-03,1.39 +2018-01-17,1.42 +2018-01-31,1.41 +2018-02-14,1.42 +2018-02-28,1.42 +2018-03-14,1.42 +2018-03-28,1.56 +2018-04-11,1.68 +2018-04-25,1.69 +2018-05-09,1.70 +2018-05-23,1.70 +2018-06-06,1.70 +2018-06-20,1.80 +2018-07-04,1.91 +2018-07-18,1.91 +2018-08-01,1.91 +2018-08-15,1.91 +2018-08-29,1.92 +2018-09-12,1.92 +2018-09-26,1.92 +2018-10-10,2.18 +2018-10-24,2.19 +2018-11-07,2.20 +2018-11-21,2.20 +2018-12-05,2.20 +2018-12-19,2.19 +2019-01-02,2.40 +2019-01-16,2.40 +2019-01-30,2.40 +2019-02-13,2.40 +2019-02-27,2.40 +2019-03-13,2.40 +2019-03-27,2.40 +2019-04-10,2.41 +2019-04-24,2.43 +2019-05-08,2.42 +2019-05-22,2.39 +2019-06-05,2.39 +2019-06-19,2.37 +2019-07-03,2.39 +2019-07-17,2.40 +2019-07-31,2.40 +2019-08-14,2.13 +2019-08-28,2.12 +2019-09-11,2.13 +2019-09-25,2.05 +2019-10-09,1.84 +2019-10-23,1.85 +2019-11-06,1.70 +2019-11-20,1.55 +2019-12-04,1.55 +2019-12-18,1.55 +2020-01-01,1.55 +2020-01-15,1.55 +2020-01-29,1.55 +2020-02-12,1.59 +2020-02-26,1.58 +2020-03-11,1.30 +2020-03-25,0.44 +2020-04-08,0.07 +2020-04-22,0.05 +2020-05-06,0.05 +2020-05-20,0.05 +2020-06-03,0.05 +2020-06-17,0.08 +2020-07-01,0.08 +2020-07-15,0.09 +2020-07-29,0.09 +2020-08-12,0.10 +2020-08-26,0.09 +2020-09-09,0.09 +2020-09-23,0.09 +2020-10-07,0.09 +2020-10-21,0.09 +2020-11-04,0.09 +2020-11-18,0.09 +2020-12-02,0.08 +2020-12-16,0.09 +2020-12-30,0.09 +2021-01-13,0.09 +2021-01-27,0.09 +2021-02-10,0.08 +2021-02-24,0.08 +2021-03-10,0.07 +2021-03-24,0.07 +2021-04-07,0.07 +2021-04-21,0.07 +2021-05-05,0.06 +2021-05-19,0.06 +2021-06-02,0.06 +2021-06-16,0.06 +2021-06-30,0.10 +2021-07-14,0.10 +2021-07-28,0.10 +2021-08-11,0.09 +2021-08-25,0.09 +2021-09-08,0.08 +2021-09-22,0.08 +2021-10-06,0.08 +2021-10-20,0.08 +2021-11-03,0.08 +2021-11-17,0.08 +2021-12-01,0.08 +2021-12-15,0.08 +2021-12-29,0.08 +2022-01-12,0.08 +2022-01-26,0.08 +2022-02-09,0.08 +2022-02-23,0.08 +2022-03-09,0.08 +2022-03-23,0.21 +2022-04-06,0.33 +2022-04-20,0.33 +2022-05-04,0.33 +2022-05-18,0.83 +2022-06-01,0.83 +2022-06-15,0.83 +2022-06-29,1.58 +2022-07-13,1.58 +2022-07-27,1.58 +2022-08-10,2.33 +2022-08-24,2.33 +2022-09-07,2.33 +2022-09-21,2.33 +2022-10-05,3.08 +2022-10-19,3.08 +2022-11-02,3.08 +2022-11-16,3.83 +2022-11-30,3.83 +2022-12-14,3.83 +2022-12-28,4.33 \ No newline at end of file diff --git a/test/output/aaplBollinger.svg b/test/output/aaplBollinger.svg index 943b12ca1f..e950133f03 100644 --- a/test/output/aaplBollinger.svg +++ b/test/output/aaplBollinger.svg @@ -13,80 +13,70 @@ white-space: pre; } - - - - 60 - - - - 70 - - - - 80 - - - - 90 - - - - 100 - - - - 110 - - - - 120 - - - - 130 - - - - 140 - - - - 150 - - - - 160 - - - - 170 - - - - 180 - - - - 190 - ↑ Close + + + + + + + + + + + + + + + - - - 2014 - - - 2015 - - - 2016 - - - 2017 - - - 2018 - + + + + + + + + + + + + + + + + + + 60 + 70 + 80 + 90 + 100 + 110 + 120 + 130 + 140 + 150 + 160 + 170 + 180 + 190 + + + ↑ Close + + + + + + + + + + 2014 + 2015 + 2016 + 2017 + 2018 diff --git a/test/output/aaplBollingerGridInterval.svg b/test/output/aaplBollingerGridInterval.svg new file mode 100644 index 0000000000..2d768aa5b5 --- /dev/null +++ b/test/output/aaplBollingerGridInterval.svg @@ -0,0 +1,115 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 60 + 80 + 100 + 120 + 140 + 160 + 180 + + + ↑ Close + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 2014 + 2015 + 2016 + 2017 + 2018 + + + + + + + + + + + \ No newline at end of file diff --git a/test/output/aaplBollingerGridSpacing.svg b/test/output/aaplBollingerGridSpacing.svg new file mode 100644 index 0000000000..2d768aa5b5 --- /dev/null +++ b/test/output/aaplBollingerGridSpacing.svg @@ -0,0 +1,115 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 60 + 80 + 100 + 120 + 140 + 160 + 180 + + + ↑ Close + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 2014 + 2015 + 2016 + 2017 + 2018 + + + + + + + + + + + \ No newline at end of file diff --git a/test/output/aaplCandlestick.svg b/test/output/aaplCandlestick.svg index 45b8595048..92e6ddda36 100644 --- a/test/output/aaplCandlestick.svg +++ b/test/output/aaplCandlestick.svg @@ -13,65 +13,62 @@ white-space: pre; } - - - - 155 - - - - 160 - - - - 165 - - - - 170 - - - - 175 - - - - 180 - - - - 185 - - - - 190 - ↑ Apple stock price ($) + + + + + + + + + - - - - December - - - - 2018 - - - - February - - - - March - - - - April - - - - May - + + + + + + + + + + + + 155 + 160 + 165 + 170 + 175 + 180 + 185 + 190 + + + ↑ Apple stock price ($) + + + + + + + + + + + + + + + + + + + December + 2018 + February + March + April + May diff --git a/test/output/aaplChangeVolume.svg b/test/output/aaplChangeVolume.svg index 41cb75666d..88bdd478d4 100644 --- a/test/output/aaplChangeVolume.svg +++ b/test/output/aaplChangeVolume.svg @@ -13,97 +13,89 @@ white-space: pre; } - - - - 7.1 - - - - 7.2 - - - - 7.3 - - - - 7.4 - - - - 7.5 - - - - 7.6 - - - - 7.7 - - - - 7.8 - - - - 7.9 - - - - 8.0 - - - - 8.1 - - - - 8.2 - - - - 8.3 - - - - 8.4 - ↑ Volume (log₁₀) + + + + + + + + + + + + + + + - - - - −6 - - - - −4 - - - - −2 - - - - +0 - - - - +2 - - - - +4 - - - - +6 - - - - +8 - Daily change (%) → + + + + + + + + + + + + + + + + + + 7.1 + 7.2 + 7.3 + 7.4 + 7.5 + 7.6 + 7.7 + 7.8 + 7.9 + 8.0 + 8.1 + 8.2 + 8.3 + 8.4 + + + ↑ Volume (log₁₀) + + + + + + + + + + + + + + + + + + + + + + + −6 + −4 + −2 + +0 + +2 + +4 + +6 + +8 + + + Daily change (%) → diff --git a/test/output/aaplClose.svg b/test/output/aaplClose.svg index 890e976d80..8544d2e0d3 100644 --- a/test/output/aaplClose.svg +++ b/test/output/aaplClose.svg @@ -13,64 +13,58 @@ white-space: pre; } - - - - 0 - - - - 20 - - - - 40 - - - - 60 - - - - 80 - - - - 100 - - - - 120 - - - - 140 - - - - 160 - - - - 180 - ↑ Close + + + + + + + + + + + + + + + + + + + + + + + + + + 0 + 20 + 40 + 60 + 80 + 100 + 120 + 140 + 160 + 180 + + + ↑ Close + + + + + + + - - - 2014 - - - 2015 - - - 2016 - - - 2017 - - - 2018 - + + 2014 + 2015 + 2016 + 2017 + 2018 diff --git a/test/output/aaplCloseDataTicks.svg b/test/output/aaplCloseDataTicks.svg new file mode 100644 index 0000000000..3f93df49a9 --- /dev/null +++ b/test/output/aaplCloseDataTicks.svg @@ -0,0 +1,62 @@ + + + + + + + + + + + 2014 + 2015 + 2016 + 2017 + 2018 + + + + + + + + + + + + + + + + 0 + 20 + 40 + 60 + 80 + 100 + 120 + 140 + 160 + 180 + 200 + + + ↑ Close + + + + + \ No newline at end of file diff --git a/test/output/aaplCloseGridColor.svg b/test/output/aaplCloseGridColor.svg new file mode 100644 index 0000000000..53f86885c1 --- /dev/null +++ b/test/output/aaplCloseGridColor.svg @@ -0,0 +1,84 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 60 + 70 + 80 + 90 + 100 + 110 + 120 + 130 + 140 + 150 + 160 + 170 + 180 + 190 + + + ↑ Close + + + + + + + + + + 2014 + 2015 + 2016 + 2017 + 2018 + + + + + \ No newline at end of file diff --git a/test/output/aaplCloseGridInterval.svg b/test/output/aaplCloseGridInterval.svg new file mode 100644 index 0000000000..032b339173 --- /dev/null +++ b/test/output/aaplCloseGridInterval.svg @@ -0,0 +1,90 @@ + + + + + + + + + + + + + + + + + + + + 60 + 70 + 80 + 90 + 100 + 110 + 120 + 130 + 140 + 150 + 160 + 170 + 180 + 190 + + + ↑ Close + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 2014 + 2015 + 2016 + 2017 + 2018 + + + + + \ No newline at end of file diff --git a/test/output/aaplCloseGridIntervalName.svg b/test/output/aaplCloseGridIntervalName.svg new file mode 100644 index 0000000000..6af3705714 --- /dev/null +++ b/test/output/aaplCloseGridIntervalName.svg @@ -0,0 +1,130 @@ + + + + + + + + + + + + + + + + + + + + 60 + 70 + 80 + 90 + 100 + 110 + 120 + 130 + 140 + 150 + 160 + 170 + 180 + 190 + + + ↑ Close + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 2014 + 2015 + 2016 + 2017 + 2018 + + + + + \ No newline at end of file diff --git a/test/output/aaplCloseGridIterable.svg b/test/output/aaplCloseGridIterable.svg new file mode 100644 index 0000000000..b43ab04ec3 --- /dev/null +++ b/test/output/aaplCloseGridIterable.svg @@ -0,0 +1,73 @@ + + + + + + + + + + + + + + + + + + + + + + + + + 60 + 70 + 80 + 90 + 100 + 110 + 120 + 130 + 140 + 150 + 160 + 170 + 180 + 190 + + + ↑ Close + + + + + + + + + + 2014 + 2015 + 2016 + 2017 + 2018 + + + + + \ No newline at end of file diff --git a/test/output/aaplCloseImplicitGrid.svg b/test/output/aaplCloseImplicitGrid.svg new file mode 100644 index 0000000000..6fbb1528ed --- /dev/null +++ b/test/output/aaplCloseImplicitGrid.svg @@ -0,0 +1,84 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + 2014 + 2015 + 2016 + 2017 + 2018 + + + + + + + + + + + + + + + + + + + 60 + 70 + 80 + 90 + 100 + 110 + 120 + 130 + 140 + 150 + 160 + 170 + 180 + 190 + + + ↑ Close + + + + + \ No newline at end of file diff --git a/test/output/aaplCloseUntyped.svg b/test/output/aaplCloseUntyped.svg index 1237f5beb9..998c370b90 100644 --- a/test/output/aaplCloseUntyped.svg +++ b/test/output/aaplCloseUntyped.svg @@ -13,64 +13,58 @@ white-space: pre; } - - - - 0 - - - - 20 - - - - 40 - - - - 60 - - - - 80 - - - - 100 - - - - 120 - - - - 140 - - - - 160 - - - - 180 - ↑ Close + + + + + + + + + + + + + + + + + + + + + + + + + + 0 + 20 + 40 + 60 + 80 + 100 + 120 + 140 + 160 + 180 + + + ↑ Close + + + + + + + - - - 2014 - - - 2015 - - - 2016 - - - 2017 - - - 2018 - + + 2014 + 2015 + 2016 + 2017 + 2018 diff --git a/test/output/aaplFancyAxis.svg b/test/output/aaplFancyAxis.svg new file mode 100644 index 0000000000..884f090764 --- /dev/null +++ b/test/output/aaplFancyAxis.svg @@ -0,0 +1,75 @@ + + + + + + + + + + + 2014 + 2015 + 2016 + 2017 + 2018 + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 0 + 20 + 40 + 60 + 80 + 100 + 120 + 140 + 160 + 180 + + + ↑ Close + + \ No newline at end of file diff --git a/test/output/aaplMonthly.svg b/test/output/aaplMonthly.svg index 025a6daf94..07b1f27dff 100644 --- a/test/output/aaplMonthly.svg +++ b/test/output/aaplMonthly.svg @@ -13,66 +13,54 @@ white-space: pre; } - - - 0 - - - 20 - - - 40 - - - 60 - - - 80 - - - 100 - - - 120 - - - 140 - - - 160 - - - 180 - - - 200 - - - 220 - - - 240 - - - 260 - ↑ Daily trade volume (millions) + + + + + + + + + + + + + + + - - - 2014 - - - 2015 - - - 2016 - - - 2017 - - - 2018 - + + 0 + 20 + 40 + 60 + 80 + 100 + 120 + 140 + 160 + 180 + 200 + 220 + 240 + 260 + + + ↑ Daily trade volume (millions) + + + + + + + + + + 2014 + 2015 + 2016 + 2017 + 2018 diff --git a/test/output/aaplVolume.svg b/test/output/aaplVolume.svg index ba5a420a5f..5047d67640 100644 --- a/test/output/aaplVolume.svg +++ b/test/output/aaplVolume.svg @@ -13,69 +13,64 @@ white-space: pre; } - - - - 0 - - - - 2 - - - - 4 - - - - 6 - - - - 8 - - - - 10 - - - - 12 - - - - 14 - - - - 16 - ↑ Frequency (%) + + + + + + + + + + + + + + + + + + + + + + + + 0 + 2 + 4 + 6 + 8 + 10 + 12 + 14 + 16 + + + ↑ Frequency (%) + + + + + + + + + + + + + 7.0 + 7.2 + 7.4 + 7.6 + 7.8 + 8.0 + 8.2 + 8.4 - - - 7.0 - - - 7.2 - - - 7.4 - - - 7.6 - - - 7.8 - - - 8.0 - - - 8.2 - - - 8.4 - Trade volume (log₁₀) → + + Trade volume (log₁₀) → diff --git a/test/output/aaplVolumeRect.svg b/test/output/aaplVolumeRect.svg index 5b814e7cbd..42a109c0a3 100644 --- a/test/output/aaplVolumeRect.svg +++ b/test/output/aaplVolumeRect.svg @@ -13,89 +13,76 @@ white-space: pre; } - - - - 0 - - - - 5 - - - - 10 - - - - 15 - - - - 20 - - - - 25 - - - - 30 - - - - 35 - - - - 40 - - - - 45 - - - - 50 - - - - 55 - - - - 60 - - - - 65 - ↑ Daily trade volume (millions) + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 0 + 5 + 10 + 15 + 20 + 25 + 30 + 35 + 40 + 45 + 50 + 55 + 60 + 65 + + + ↑ Daily trade volume (millions) + + + + + + + + + + - - - Mar 18 - - - Mar 25 - - - April - - - Apr 08 - - - Apr 15 - - - Apr 22 - - - Apr 29 - - - May 06 - + + Mar 18 + Mar 25 + April + Apr 08 + Apr 15 + Apr 22 + Apr 29 + May 06 diff --git a/test/output/anscombeQuartet.svg b/test/output/anscombeQuartet.svg index 18f7b940fa..23a593cb1b 100644 --- a/test/output/anscombeQuartet.svg +++ b/test/output/anscombeQuartet.svg @@ -13,160 +13,191 @@ white-space: pre; } - - - 4 - - - - 6 - - - - 8 - - - - 10 - - - - 12 - - ↑ y - - - - 1 - - - 2 - - - 3 - - - 4 - series - - - - - 5 - - - - 10 - - - - 15 - - - - - - 5 - - - - 10 - - - - 15 - - - - - - 5 - - - - 10 - - - - 15 - - - - - - 5 - - - - 10 - - - - 15 - x → - - - + + + 1 + + + + + + + + + + + + + + + + + 4 + 6 + 8 + 10 + 12 + + + + + + + + + + + + + 5 + 10 + 15 + + - - - - - - - - - - - + + + + + + + + + + + - - + + + 2 + + + + + + + + + + + + + + + + + + + + 5 + 10 + 15 + + - - - - - - - - - - - + + + + + + + + + + + - - + + + 3 + + + + + + + + + + + + + + + + + + + + 5 + 10 + 15 + + - - - - - - - - - - - + + + + + + + + + + + - - + + + 4 + + + + + + + + + + + + + + + + + + + + 5 + 10 + 15 + + - - - - - - - - - - - + + + + + + + + + + + + + series + + + ↑ y + + + x → + \ No newline at end of file diff --git a/test/output/athletesBinsColors.svg b/test/output/athletesBinsColors.svg index a3b2cc4b02..07b9674d25 100644 --- a/test/output/athletesBinsColors.svg +++ b/test/output/athletesBinsColors.svg @@ -13,69 +13,59 @@ white-space: pre; } - - - 0 - - - 50 - - - 100 - - - 150 - - - 200 - - - 250 - - - 300 - - - 350 - - - 400 - - - 450 - - - 500 - - - 550 - - - 600 - ↑ Frequency + + + + + + + + + + + + + + - - - 40 - - - 60 - - - 80 - - - 100 - - - 120 - - - 140 - - - 160 - weight → + + 0 + 50 + 100 + 150 + 200 + 250 + 300 + 350 + 400 + 450 + 500 + 550 + 600 + + + ↑ Frequency + + + + + + + + + + + + 40 + 60 + 80 + 100 + 120 + 140 + 160 + + + weight → diff --git a/test/output/athletesBirthdays.svg b/test/output/athletesBirthdays.svg index abe4f60a31..5d268ed927 100644 --- a/test/output/athletesBirthdays.svg +++ b/test/output/athletesBirthdays.svg @@ -13,63 +13,52 @@ white-space: pre; } - - - Jan - - - Feb - - - Mar - - - Apr - - - May - - - Jun - - - Jul - - - Aug - - - Sep - - - Oct - - - Nov - - - Dec - + + + + + + + + + + + + + - - - 0 - - - 200 - - - 400 - - - 600 - - - 800 - - - 1,000 - Frequency → + + Jan + Feb + Mar + Apr + May + Jun + Jul + Aug + Sep + Oct + Nov + Dec + + + + + + + + + + + 0 + 200 + 400 + 600 + 800 + 1,000 + + + Frequency → @@ -85,7 +74,20 @@ - 1,0989561,0229621,028961988989961849827897 + + 1,098 + 956 + 1,022 + 962 + 1,028 + 961 + 988 + 989 + 961 + 849 + 827 + 897 + diff --git a/test/output/athletesBoxingHeight.svg b/test/output/athletesBoxingHeight.svg index 0afcaa2f5a..fd1fc53b0f 100644 --- a/test/output/athletesBoxingHeight.svg +++ b/test/output/athletesBoxingHeight.svg @@ -13,894 +13,343 @@ white-space: pre; } - - - 1.5 + + + Africa - - 1.6 + + + + + + + + - - 1.7 + + 1.5 + 1.6 + 1.7 + 1.8 + 1.9 + 2.0 + 2.1 - - 1.8 - - - 1.9 - - - 2.0 + + + ALG + ALG + EGY + MAR + SEY + KEN + TUN + ALG + CPV + CMR + NGR + ALG + MAR + CMR + MAR + TUN + EGY + ALG + NAM + CAF + UGA + MRI + MAR + CMR + EGY + NAM + MRI + ALG + MAR + MAR + MAR + CGO + KEN + ALG + CMR + EGY + ALG + MAR - - 2.1 - ↑ height - - - Africa - - - Americas + + + Americas - - Asia - - - Europe - - - Oceania - continent - - - + - - ALG - - - ALG - - - EGY - - - MAR - - - SEY - - - KEN - - - TUN - - - ALG - - - CPV - - - CMR - - - NGR - - - ALG - - - MAR - - - CMR - - - MAR - - - TUN - - - EGY - - - ALG - - - NAM - - - CAF - - - UGA - - - MRI - - - MAR - - - CMR - - - EGY - - - NAM - - - MRI - - - ALG - - - MAR - - - MAR - - - MAR - - - CGO - - - KEN - - - ALG - - - CMR - - - EGY - - - ALG - - - MAR - + BRA + VEN + ARG + ARG + BRA + USA + CAN + CUB + CAN + PAN + ECU + ECU + USA + COL + USA + USA + VEN + MEX + VEN + CUB + ARG + VEN + USA + DOM + ARG + COL + PUR + CUB + BRA + COL + MEX + COL + BRA + MEX + BRA + ECU + CUB + CUB + ARG + CUB + DOM + MEX + VEN + VEN + CAN + ECU + BRA + USA + MEX + USA + TTO + BRA + MEX + CUB + BRA + BRA + CUB + USA + VEN + ARG + CUB + VEN + CUB + COL - - - - - BRA - - - VEN - - - ARG - - - ARG - - - BRA - - - USA - - - CAN - - - CUB - - - CAN - - - PAN - - - ECU - - - ECU - - - USA - - - COL - - - USA - - - USA - - - VEN - - - MEX - - - VEN - - - CUB - - - ARG - - - VEN - - - USA - - - DOM - - - ARG - - - COL - - - PUR - - - CUB - - - BRA - - - COL - - - MEX - - - COL - - - BRA - - - MEX - - - BRA - - - ECU - - - CUB - - - CUB - - - ARG - - - CUB - - - DOM - - - MEX - - - VEN - - - VEN - - - CAN - - - ECU - - - BRA - - - USA - - - MEX - - - USA - - - TTO - - - BRA - - - MEX - - - CUB - - - BRA - - - BRA - - - CUB - - - USA - - - VEN - - - ARG - - - CUB - - - VEN - - - CUB - - - COL - + + + Asia - - - + - - AZE - - - KAZ - - - KAZ - - - RUS - - - AZE - - - TUR - - - THA - - - RUS - - - RUS - - - TJK - - - ARM - - - JPN - - - TKM - - - RUS - - - ARM - - - UZB - - - TUR - - - UZB - - - KAZ - - - CHN - - - KAZ - - - CHN - - - PHI - - - THA - - - MGL - - - TPE - - - JPN - - - KAZ - - - KAZ - - - IRI - - - UZB - - - AZE - - - MGL - - - KGZ - - - RUS - - - UZB - - - CHN - - - MGL - - - QAT - - - UZB - - - ARM - - - UZB - - - JOR - - - RUS - - - KAZ - - - AZE - - - CHN - - - CHN - - - CHN - - - CHN - - - KAZ - - - AZE - - - IND - - - AZE - - - AZE - - - IND - - - TUR - - - CHN - - - RUS - - - UZB - - - ARM - - - TPE - - - JOR - - - KAZ - - - TUR - - - TUR - - - MGL - - - AZE - - - THA - - - RUS - - - CHN - - - CHN - - - PHI - - - AZE - - - UZB - - - KOR - - - THA - - - TUR - - - UZB - - - UZB - - - IND - - - AZE - - - QAT - - - MGL - - - MGL - - - RUS - - - KAZ - - - RUS - - - ARM - - - RUS - - - IRQ - - - CHN - - - THA - - - AZE - - - UZB - - - KAZ - - - KAZ - + AZE + KAZ + KAZ + RUS + AZE + TUR + THA + RUS + RUS + TJK + ARM + JPN + TKM + RUS + ARM + UZB + TUR + UZB + KAZ + CHN + KAZ + CHN + PHI + THA + MGL + TPE + JPN + KAZ + KAZ + IRI + UZB + AZE + MGL + KGZ + RUS + UZB + CHN + MGL + QAT + UZB + ARM + UZB + JOR + RUS + KAZ + AZE + CHN + CHN + CHN + CHN + KAZ + AZE + IND + AZE + AZE + IND + TUR + CHN + RUS + UZB + ARM + TPE + JOR + KAZ + TUR + TUR + MGL + AZE + THA + RUS + CHN + CHN + PHI + AZE + UZB + KOR + THA + TUR + UZB + UZB + IND + AZE + QAT + MGL + MGL + RUS + KAZ + RUS + ARM + RUS + IRQ + CHN + THA + AZE + UZB + KAZ + KAZ - - + + + Europe + + - - SWE - - - GBR - - - GER - - - GER - - - IRL - - - ITA - - - FRA - - - ITA - - - BUL - - - GER - - - IRL - - - UKR - - - UKR - - - BLR - - - LTU - - - FRA - - - NED - - - GER - - - FRA - - - LTU - - - CRO - - - GBR - - - ITA - - - GER - - - FRA - - - CRO - - - POL - - - HUN - - - ITA - - - GBR - - - GBR - - - IRL - - - GBR - - - GBR - - - IRL - - - GBR - - - ITA - - - FRA - - - IRL - - - IRL - - - ROU - - - BLR - - - FIN - - - GBR - - - UKR - - - GBR - - - NED - - - GBR - - - IRL - - - FRA - - - BLR - - - NED - - - GBR - - - ESP - - - FRA - - - GBR - - - GER - - - BUL - - - FRA - - - FRA - - - BUL - - - IRL - - - HON - - - UKR - - - POL - - - FRA - - - ITA - - - ITA - - - UKR - - - ESP - - - HUN - + SWE + GBR + GER + GER + IRL + ITA + FRA + ITA + BUL + GER + IRL + UKR + UKR + BLR + LTU + FRA + NED + GER + FRA + LTU + CRO + GBR + ITA + GER + FRA + CRO + POL + HUN + ITA + GBR + GBR + IRL + GBR + GBR + IRL + GBR + ITA + FRA + IRL + IRL + ROU + BLR + FIN + GBR + UKR + GBR + NED + GBR + IRL + FRA + BLR + NED + GBR + ESP + FRA + GBR + GER + BUL + FRA + FRA + BUL + IRL + HON + UKR + POL + FRA + ITA + ITA + UKR + ESP + HUN - - + + + Oceania + + - - AUS - - - AUS - - - FSM - - - AUS - - - PNG - + AUS + AUS + FSM + AUS + PNG + + continent + + + ↑ height + \ No newline at end of file diff --git a/test/output/athletesHeightWeight.svg b/test/output/athletesHeightWeight.svg index ef3205a465..02070ae474 100644 --- a/test/output/athletesHeightWeight.svg +++ b/test/output/athletesHeightWeight.svg @@ -13,117 +13,104 @@ white-space: pre; } - - - - 1.25 - - - - 1.30 - - - - 1.35 - - - - 1.40 - - - - 1.45 - - - - 1.50 - - - - 1.55 - - - - 1.60 - - - - 1.65 - - - - 1.70 - - - - 1.75 - - - - 1.80 - - - - 1.85 - - - - 1.90 - - - - 1.95 - - - - 2.00 - - - - 2.05 - - - - 2.10 - - - - 2.15 - - - - 2.20 - ↑ height + + + + + + + + + + + + + + + + + + + + + - - - - 40 - - - - 60 - - - - 80 - - - - 100 - - - - 120 - - - - 140 - - - - 160 - weight → + + + + + + + + + + + + + + + + + + + + + + + + 1.25 + 1.30 + 1.35 + 1.40 + 1.45 + 1.50 + 1.55 + 1.60 + 1.65 + 1.70 + 1.75 + 1.80 + 1.85 + 1.90 + 1.95 + 2.00 + 2.05 + 2.10 + 2.15 + 2.20 + + + ↑ height + + + + + + + + + + + + + + + + + + + + + 40 + 60 + 80 + 100 + 120 + 140 + 160 + + + weight → diff --git a/test/output/athletesHeightWeightBin.svg b/test/output/athletesHeightWeightBin.svg index 1ad0f26da5..2bf28cdab5 100644 --- a/test/output/athletesHeightWeightBin.svg +++ b/test/output/athletesHeightWeightBin.svg @@ -13,81 +13,77 @@ white-space: pre; } - - - - 1.2 - - - - 1.3 - - - - 1.4 - - - - 1.5 - - - - 1.6 - - - - 1.7 - - - - 1.8 - - - - 1.9 - - - - 2.0 - - - - 2.1 - - - - 2.2 - ↑ height + + + + + + + + + + + + - - - - 40 - - - - 60 - - - - 80 - - - - 100 - - - - 120 - - - - 140 - - - - 160 - weight → + + + + + + + + + + + + + + + 1.2 + 1.3 + 1.4 + 1.5 + 1.6 + 1.7 + 1.8 + 1.9 + 2.0 + 2.1 + 2.2 + + + ↑ height + + + + + + + + + + + + + + + + + + + + + 40 + 60 + 80 + 100 + 120 + 140 + 160 + + + weight → diff --git a/test/output/athletesHeightWeightBinStroke.svg b/test/output/athletesHeightWeightBinStroke.svg index 38afde6c1f..4633944613 100644 --- a/test/output/athletesHeightWeightBinStroke.svg +++ b/test/output/athletesHeightWeightBinStroke.svg @@ -13,81 +13,77 @@ white-space: pre; } - - - - 1.2 - - - - 1.3 - - - - 1.4 - - - - 1.5 - - - - 1.6 - - - - 1.7 - - - - 1.8 - - - - 1.9 - - - - 2.0 - - - - 2.1 - - - - 2.2 - ↑ height + + + + + + + + + + + + - - - - 40 - - - - 60 - - - - 80 - - - - 100 - - - - 120 - - - - 140 - - - - 160 - weight → + + + + + + + + + + + + + + + 1.2 + 1.3 + 1.4 + 1.5 + 1.6 + 1.7 + 1.8 + 1.9 + 2.0 + 2.1 + 2.2 + + + ↑ height + + + + + + + + + + + + + + + + + + + + + 40 + 60 + 80 + 100 + 120 + 140 + 160 + + + weight → diff --git a/test/output/athletesHeightWeightSex.svg b/test/output/athletesHeightWeightSex.svg index 7f0482abab..6b6eff9708 100644 --- a/test/output/athletesHeightWeightSex.svg +++ b/test/output/athletesHeightWeightSex.svg @@ -13,81 +13,77 @@ white-space: pre; } - - - - 1.2 - - - - 1.3 - - - - 1.4 - - - - 1.5 - - - - 1.6 - - - - 1.7 - - - - 1.8 - - - - 1.9 - - - - 2.0 - - - - 2.1 - - - - 2.2 - ↑ height + + + + + + + + + + + + - - - - 40 - - - - 60 - - - - 80 - - - - 100 - - - - 120 - - - - 140 - - - - 160 - weight → + + + + + + + + + + + + + + + 1.2 + 1.3 + 1.4 + 1.5 + 1.6 + 1.7 + 1.8 + 1.9 + 2.0 + 2.1 + 2.2 + + + ↑ height + + + + + + + + + + + + + + + + + + + + + 40 + 60 + 80 + 100 + 120 + 140 + 160 + + + weight → diff --git a/test/output/athletesHeightWeightSport.svg b/test/output/athletesHeightWeightSport.svg index 68965510bb..adba5477b5 100644 --- a/test/output/athletesHeightWeightSport.svg +++ b/test/output/athletesHeightWeightSport.svg @@ -13,117 +13,104 @@ white-space: pre; } - - - - 1.25 - - - - 1.30 - - - - 1.35 - - - - 1.40 - - - - 1.45 - - - - 1.50 - - - - 1.55 - - - - 1.60 - - - - 1.65 - - - - 1.70 - - - - 1.75 - - - - 1.80 - - - - 1.85 - - - - 1.90 - - - - 1.95 - - - - 2.00 - - - - 2.05 - - - - 2.10 - - - - 2.15 - - - - 2.20 - ↑ height + + + + + + + + + + + + + + + + + + + + + - - - - 40 - - - - 60 - - - - 80 - - - - 100 - - - - 120 - - - - 140 - - - - 160 - weight → + + + + + + + + + + + + + + + + + + + + + + + + 1.25 + 1.30 + 1.35 + 1.40 + 1.45 + 1.50 + 1.55 + 1.60 + 1.65 + 1.70 + 1.75 + 1.80 + 1.85 + 1.90 + 1.95 + 2.00 + 2.05 + 2.10 + 2.15 + 2.20 + + + ↑ height + + + + + + + + + + + + + + + + + + + + + 40 + 60 + 80 + 100 + 120 + 140 + 160 + + + weight → diff --git a/test/output/athletesNationality.svg b/test/output/athletesNationality.svg index 3866bc5cfa..c75e3a4220 100644 --- a/test/output/athletesNationality.svg +++ b/test/output/athletesNationality.svg @@ -13,93 +13,76 @@ white-space: pre; } - - - USA - - - BRA - - - GER - - - AUS - - - FRA - - - CHN - - - GBR - - - JPN - - - CAN - - - ESP - - - ITA - - - RUS - - - NED - - - POL - - - ARG - - - KOR - - - NZL - - - UKR - - - SWE - - - COL - + + + + + + + + + + + + + + + + + + + + + - - - - 0 - - - - 100 - - - - 200 - - - - 300 - - - - 400 - - - - 500 - Frequency → + + USA + BRA + GER + AUS + FRA + CHN + GBR + JPN + CAN + ESP + ITA + RUS + NED + POL + ARG + KOR + NZL + UKR + SWE + COL + + + + + + + + + + + + + + + + + + + 0 + 100 + 200 + 300 + 400 + 500 + + + Frequency → diff --git a/test/output/athletesSample.svg b/test/output/athletesSample.svg index 473eed4ee2..3f46ef41ae 100644 --- a/test/output/athletesSample.svg +++ b/test/output/athletesSample.svg @@ -13,634 +13,210 @@ white-space: pre; } - - - aquatics - - - archery - - - athletics - - - badminton - - - basketball - - - boxing - - - canoe - - - cycling - - - equestrian - - - fencing - - - football - - - golf - - - gymnastics - - - handball - - - hockey - - - judo - - - modern pentathlon - - - rowing - - - rugby sevens - - - sailing - - - shooting - - - table tennis - - - taekwondo - - - tennis - - - triathlon - - - volleyball - - - weightlifting - - - wrestling - sport - - - - 40 - - - - 60 - - - - 80 - - - - 100 - - - - 120 - - - - 140 - - - - 160 - - weight → - - - - - Aaron Younger - - - Bjorn Hornikel - - - Dusan Mandic - - - Ilia Druzhinin - - - Kosuke Hagino - - - Miguel Ortiz Canavate Ozeki - - - Ryan Pini - - - Yaaqoub Alsaadi - - - Abbey Weitzeil - - - Bronte Barratt - - - Evangelia Papazoglou - - - Jing Zhang - - - Lorena Molinos - - - Natalia Ishchenko - - - Shiwen Ye - - - Yue Cao - - - - - - - Adrian Andres Puentes Perez - - - Adriana Martin - - - - - - - A Jesus Garcia - - - Anthony Zambrano - - - Carl Dohmann - - - Dmitry Kroyter - - - Gil Roberts - - - James Ellington - - - Kapririel Kitson - - - Lukas Melich - - - Miguel Francis - - - Paulo Amotun - - - Ronnie Ash - - - Tarik Langat Akdag - - - Yordan L. O'Farrill - - - Aauri Lorena Bokesa - - - Anna Kornuta - - - Chrisann Gordon - - - Eliane Saholinirina - - - Hanna Knyazyeva-Minenko - - - Julia Takacs - - - Marisol Romero - - - Natthaya Thanaronnawat - - - Rosemary Quispe - - - Yasemin Can - - - - - - - Adam Cwalina - - - Akane Yamaguchi - - - - - - - Adas Juskevicius - - - Nicolas Laprovittola - - - Adriana Moises - - - Oumoul Thiam - - - - - - - - Adam van Koeverden - - - Jordan Wood - - - Stephen Bird - - - Afef Ben Ismail - - - Ursa Kragelj - - - - - - - Aaron Gate - - - Georg Preidler - - - Michael Hepburn - - - Toms Skujins - - - Ahreum Na - - - Katrin Garfoot - - - - - - - Abdelkebir Ouaddar - - - Pedro Tavares de Almeida - - - Adelinde Cornelissen - - - - - - - A Lam Shin - - - Seona Hwang - - - Richard Kruse - - - - - - - Abbubaker Mobara - - - Filipe Baravilala - - - Mathias Hebo Rasmussen - - - Abby Erceg - - - Isabel Kerschowski - - - Rebecca Quinn - - - - - - - Adilson da Silva - - - Aditi Ashok - - - - - - - Aiko Sugihara - - - Laura Zeng - - - Yeon Jae Son - - - Alexander Naddour - - - Se Gwang Ri - - - - - - - Abdulrazzaq Murad - - - Makrem Missaoui - - - Ailly Luciano - - - Louise Sand - - - - - - - Adam Dixon - - - Juan Gilardi - - - Thomas Briels - - - Agustina Albertarrio - - - Kathleen Bam - - - Victoria Zuloaga - - - - - - - Abderrahmane Benamadi - - - Simon Yacoub - - - Abigel Joo - - - Miku Tashiro - - - - - - - Adam Marosi - - - Alice Sotero - - - - - - - Abdelkhalek Elbanna - - - Georgi Bozhilov - - - Matt Langridge - - - Thibault Colard - - - Adelina Bogus - - - Katherine Copeland - - - Weiwei Zhu - - - - - - - Abbie Brown - - - Marina Bravo - - - Akira Ioane - - - Nicolas Bruzzone - - - - - - - Afrodite Zegers - - - Ahmed Ragab - - - Juozas Bernotas - - - Tonci Stipanovic - - - - - - - Abdel Aziz Mehelba - - - Jitu Rai - - - Song Guk Kim - - - Adela Bruns - - - Natallia Kalnysh - - - - - - - Adam Pattantyus - - - Adriana Diaz - - - - - - - Aaron Cook - - - Ainur Yesbergenova - - - - - - - Agnieszka Radwanska - - - Albert Ramos-Vinolas - - - Vasek Pospisil - - - - - - - Aaron Royle - - - Agnieszka Jerzyk - - - - - - - Aaron Russell - - - Kostyantyn Bakun - - - Abdoulkarim Fawziya - - - Kotoki Zayasu - - - - - - - Adrian Edward Zielinski - - - Myeongmok Han - - - Alejandra Garza Garza - - - Yuderqui Maridalia Contreras - - - - - - - Abbos Rakhmonov - - - Ibragim Labazanov - - - Soslan Ramonov - - - Adela Hanzlickova - - - Valeriia Koblova Zholobova - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + aquatics + archery + athletics + badminton + basketball + boxing + canoe + cycling + equestrian + fencing + football + golf + gymnastics + handball + hockey + judo + modern pentathlon + rowing + rugby sevens + sailing + shooting + table tennis + taekwondo + tennis + triathlon + volleyball + weightlifting + wrestling + + + sport + + + + + + + + + + + + + + + + + + + + + 40 + 60 + 80 + 100 + 120 + 140 + 160 + + + weight → + + + A Jesus Garcia + Aichen Wang + Alejandro Valverde Belmonte + Alexander Sigurbjornsson + Alin George Moldoveanu + Amas Daniel + Bachir Mahamat + Ben Kanute + Changrui Xue + Chun Hing Chan + Craig Miller + Danell Leyva + Davie Selke + Dong Keun Lee + Eduard Popp + Emanuel Silva + Erick Barrondo + Evan Van Moerkerke + Filip Dvorak + Frank Chamizo Marquez + Gauthier Grumier + Gregory Bauge + Hersony Canelon + Jack Green + Javier Garcia Gadea + Jeroen Dubbeldam + Joe Kovacs + Jordan Coelho + Kevin Staut + Kleber da Silva Ramos + Kurt Couto + Lomano Lemeki + Luguelin Santos + Marc Zwiebler + Markus Thormeyer + Matthew Glaetzer + Mehdi Marzouki + Michael Perez + Moises Duque + Myong Hyok Kim + Nic Woods + Pablo Herrera Allepuz + Paul Kipngetich Tanui + Pieter-Jan Postma + Raul Hernandez Hidalgo + Ricardas Nekriosius + Robert van der Horst + Ryan Bailie + Sam Webster + Seabelo Senatla + Serguey Torres + Simone Giannelli + Soslan Daurov + Stephen Bird + Taras Mishchuk + Theo Piniau + Tim Nedow + Tontowi Ahmad + Uvis Kalnins + Vicenc Ruiz + Will Brown + Yosuke Nakayama + Yuri Floriani + Ziv Kalontarov + Adela Hanzlickova + Anastasiia Lysenko + Angelique Kerber + Annika Beck + Aria Fischer + Ashlyn Harris + Birgit Michels + Brenda Flores + Caitlin van Sickle + Carolina Rodriguez + Chloe Leurquin + Daria Gavrilova + Diana Martin + Elena-Lavinia Tarlea + Farida Osman + Gil Cohen + Hye-Song Kim + Ilse Paulis + Isabel Kerschowski + Jamile Samuel + Jieni Shao + Julie Johnston + Kamia Yousufi + Katarzyna Krawczyk + Keesja Gofers + Leidy Asprilla + Liliyana Natsir + Maaike Head + Makenzie Fischer + Maria Casado + Mariia Shurochkina + Maryia Papova + Miho Yoshioka + Mirela Demireva + Natalia Vorobeva + Nikkita Holder + Nur Tatar + Olivia Schough + Persis William-Mensah + Rabia Guelec + Rosa Godoy + Sapsiree Taerattanachai + Shijie Qieyang + Svetlana Romashina + Vitoria Cristina Rosa + Xue Li + Yekaterina Nemich \ No newline at end of file diff --git a/test/output/athletesSampleFacet.svg b/test/output/athletesSampleFacet.svg new file mode 100644 index 0000000000..f9ef88bb65 --- /dev/null +++ b/test/output/athletesSampleFacet.svg @@ -0,0 +1,589 @@ + + + + + aquatics + + + + + + + + + + + + Evan Van Moerkerke + Javier Garcia Gadea + Jordan Coelho + Markus Thormeyer + Mehdi Marzouki + Uvis Kalnins + Ziv Kalontarov + Aria Fischer + Farida Osman + Keesja Gofers + Makenzie Fischer + Mariia Shurochkina + Svetlana Romashina + Yekaterina Nemich + + + + + archery + + + + + + + + + + + + + + athletics + + + + + + + + + + + + A Jesus Garcia + Bachir Mahamat + Changrui Xue + Erick Barrondo + Jack Green + Joe Kovacs + Kurt Couto + Luguelin Santos + Paul Kipngetich Tanui + Theo Piniau + Tim Nedow + Yuri Floriani + Brenda Flores + Diana Martin + Hye-Song Kim + Jamile Samuel + Kamia Yousufi + Mirela Demireva + Nikkita Holder + Persis William-Mensah + Rosa Godoy + Shijie Qieyang + Vitoria Cristina Rosa + + + + + badminton + + + + + + + + + + + + Dong Keun Lee + Marc Zwiebler + Tontowi Ahmad + Birgit Michels + Liliyana Natsir + Sapsiree Taerattanachai + + + + + basketball + + + + + + + + + + + + Maryia Papova + + + + + boxing + + + + + + + + + + + + + + canoe + + + + + + + + + + + + Emanuel Silva + Filip Dvorak + Ricardas Nekriosius + Serguey Torres + Stephen Bird + Taras Mishchuk + + + + + cycling + + + + + + + + + + + + Alejandro Valverde Belmonte + Chun Hing Chan + Gregory Bauge + Hersony Canelon + Kleber da Silva Ramos + Matthew Glaetzer + Sam Webster + + + + + equestrian + + + + + + + + + + + + Jeroen Dubbeldam + Kevin Staut + + + + + fencing + + + + + + + + + + + + Gauthier Grumier + + + + + football + + + + + + + + + + + + Davie Selke + Michael Perez + Ashlyn Harris + Isabel Kerschowski + Julie Johnston + Leidy Asprilla + Olivia Schough + + + + + golf + + + + + + + + + + + + Chloe Leurquin + + + + + gymnastics + + + + + + + + + + + + Carolina Rodriguez + Danell Leyva + + + + + handball + + + + + + + + + + + + + + hockey + + + + + + + + + + + + Nic Woods + Robert van der Horst + Vicenc Ruiz + Caitlin van Sickle + + + + + judo + + + + + + + + + + + + + + modern pentathlon + + + + + + + + + + + + + + rowing + + + + + + + + + + + + Alexander Sigurbjornsson + Raul Hernandez Hidalgo + Elena-Lavinia Tarlea + Ilse Paulis + Maaike Head + + + + + rugby sevens + + + + + + + + + + + + Maria Casado + Lomano Lemeki + Moises Duque + Seabelo Senatla + + + + + sailing + + + + + + + + + + + + Gil Cohen + Miho Yoshioka + Aichen Wang + Pieter-Jan Postma + + + + + shooting + + + + + + + + + + + + Alin George Moldoveanu + Will Brown + + + + + table tennis + + + + + + + + + + + + Jieni Shao + Xue Li + + + + + taekwondo + + + + + + + + + + + + Nur Tatar + Rabia Guelec + + + + + tennis + + + + + + + + + + + + Angelique Kerber + Annika Beck + Daria Gavrilova + + + + + triathlon + + + + + + + + + + + + Ben Kanute + Ryan Bailie + + + + + volleyball + + + + + + + + + + + + Pablo Herrera Allepuz + Simone Giannelli + + + + + weightlifting + + + + + + + + + + + + Myong Hyok Kim + Yosuke Nakayama + Anastasiia Lysenko + + + + + wrestling + + + + + + + + + + + + + + + + + + + + + 40 + 60 + 80 + 100 + 120 + 140 + 160 + + + Amas Daniel + Craig Miller + Eduard Popp + Frank Chamizo Marquez + Soslan Daurov + Adela Hanzlickova + Katarzyna Krawczyk + Natalia Vorobeva + + + + sport + + + weight → + + \ No newline at end of file diff --git a/test/output/athletesSexWeight.svg b/test/output/athletesSexWeight.svg index 03d7dfc5ad..4cb0ee8abd 100644 --- a/test/output/athletesSexWeight.svg +++ b/test/output/athletesSexWeight.svg @@ -13,74 +13,68 @@ white-space: pre; } - - - - 0 - - - - 100 - - - - 200 - - - - 300 - - - - 400 - - - - 500 - - - - 600 - - - - 700 - - - - 800 - - - - 900 - - - - 1,000 - ↑ Frequency + + + + + + + + + + + + + + + + + + + + + + + + + + + + 0 + 100 + 200 + 300 + 400 + 500 + 600 + 700 + 800 + 900 + 1,000 + + + ↑ Frequency + + + + + + + + + + + + 40 + 60 + 80 + 100 + 120 + 140 + 160 - - - 40 - - - 60 - - - 80 - - - 100 - - - 120 - - - 140 - - - 160 - weight → + + weight → diff --git a/test/output/athletesSportSex.svg b/test/output/athletesSportSex.svg index 1c6f71358f..800f0b6ea0 100644 --- a/test/output/athletesSportSex.svg +++ b/test/output/athletesSportSex.svg @@ -13,137 +13,107 @@ white-space: pre; } - - - boxing - - - wrestling - - - canoe - - - cycling - - - equestrian - - - shooting - - - judo - - - rowing - - - weightlifting - - - sailing - - - football - - - tennis - - - athletics - - - golf - - - rugby sevens - - - aquatics - - - handball - - - archery - - - badminton - - - basketball - - - hockey - - - modern pentathlon - - - table tennis - - - taekwondo - - - triathlon - - - volleyball - - - fencing - - - gymnastics - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - 0 - - - - 10 - - - - 20 - - - - 30 - - - - 40 - - - - 50 - - - - 60 - - - - 70 - - - - 80 - - - - 90 - - - - 100 - Women (%) → + + boxing + wrestling + canoe + cycling + equestrian + shooting + judo + rowing + weightlifting + sailing + football + tennis + athletics + golf + rugby sevens + aquatics + handball + archery + badminton + basketball + hockey + modern pentathlon + table tennis + taekwondo + triathlon + volleyball + fencing + gymnastics + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 0 + 10 + 20 + 30 + 40 + 50 + 60 + 70 + 80 + 90 + 100 + + + Women (%) → diff --git a/test/output/athletesSportWeight.svg b/test/output/athletesSportWeight.svg index e26f008b22..7371cc93c6 100644 --- a/test/output/athletesSportWeight.svg +++ b/test/output/athletesSportWeight.svg @@ -13,1063 +13,1308 @@ white-space: pre; } - - - aquatics + + + aquatics - - archery + + + + + + + + - - athletics - - - badminton - - - basketball - - - boxing - - - canoe - - - cycling - - - equestrian - - - fencing - - - football - - - golf - - - gymnastics - - - handball - - - hockey - - - judo - - - modern pentathlon - - - rowing - - - rugby sevens - - - sailing - - - shooting - - - table tennis - - - taekwondo - - - tennis - - - triathlon - - - volleyball - - - weightlifting + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - wrestling - sport - - - - - 40 - - - - 60 - - - - 80 - - - - 100 - - - - 120 - - - - 140 - - - - 160 - - weight → + + archery + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + athletics + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + badminton + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + basketball + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + boxing + + + + + + + + + + + + + + canoe + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + - + + cycling + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + equestrian + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + fencing + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + football + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + golf + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + gymnastics + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + handball + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + hockey + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + judo + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + modern pentathlon + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + rowing + + + + + + + + + + - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + rugby sevens + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + sailing + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + shooting + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + table tennis + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + taekwondo + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + tennis + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + triathlon + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + volleyball + + + + + + + + + + - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + weightlifting + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + wrestling + + + + + + + + + + + + + + + + + + + + + + 40 + 60 + 80 + 100 + 120 + 140 + 160 - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + sport + + + weight → + \ No newline at end of file diff --git a/test/output/athletesWeight.svg b/test/output/athletesWeight.svg index d9fd82fdfb..82b06898f5 100644 --- a/test/output/athletesWeight.svg +++ b/test/output/athletesWeight.svg @@ -13,69 +13,59 @@ white-space: pre; } - - - 0 - - - 50 - - - 100 - - - 150 - - - 200 - - - 250 - - - 300 - - - 350 - - - 400 - - - 450 - - - 500 - - - 550 - - - 600 - ↑ Frequency + + + + + + + + + + + + + + - - - 40 - - - 60 - - - 80 - - - 100 - - - 120 - - - 140 - - - 160 - weight → + + 0 + 50 + 100 + 150 + 200 + 250 + 300 + 350 + 400 + 450 + 500 + 550 + 600 + + + ↑ Frequency + + + + + + + + + + + + 40 + 60 + 80 + 100 + 120 + 140 + 160 + + + weight → diff --git a/test/output/athletesWeightCumulative.svg b/test/output/athletesWeightCumulative.svg index b195fa9774..2ba43b5b8a 100644 --- a/test/output/athletesWeightCumulative.svg +++ b/test/output/athletesWeightCumulative.svg @@ -13,63 +13,55 @@ white-space: pre; } - - - 0 - - - 1,000 - - - 2,000 - - - 3,000 - - - 4,000 - - - 5,000 - - - 6,000 - - - 7,000 - - - 8,000 - - - 9,000 - - - 10,000 - ↑ Frequency + + + + + + + + + + + + - - - 40 - - - 60 - - - 80 - - - 100 - - - 120 - - - 140 - - - 160 - weight → + + 0 + 1,000 + 2,000 + 3,000 + 4,000 + 5,000 + 6,000 + 7,000 + 8,000 + 9,000 + 10,000 + + + ↑ Frequency + + + + + + + + + + + + 40 + 60 + 80 + 100 + 120 + 140 + 160 + + + weight → diff --git a/test/output/availability.svg b/test/output/availability.svg index 4e971c9747..b153c1f0a3 100644 --- a/test/output/availability.svg +++ b/test/output/availability.svg @@ -13,45 +13,40 @@ white-space: pre; } - - - 0 - - - 1 - - - 2 - - - 3 - - - 4 - - - 5 - ↑ value + + + + + + + - - - 2020 - - - April - - - July - - - October - - - 2021 - - - April - + + 0 + 1 + 2 + 3 + 4 + 5 + + + ↑ value + + + + + + + + + + + 2020 + April + July + October + 2021 + April diff --git a/test/output/axisLabelBoth.svg b/test/output/axisLabelBoth.svg new file mode 100644 index 0000000000..70483a5fbb --- /dev/null +++ b/test/output/axisLabelBoth.svg @@ -0,0 +1,114 @@ + + + + + + + + + + + + + + + + + 0.0 + 0.1 + 0.2 + 0.3 + 0.4 + 0.5 + 0.6 + 0.7 + 0.8 + 0.9 + 1.0 + + + y → + + + + + + + + + + + + + + + + 0.0 + 0.1 + 0.2 + 0.3 + 0.4 + 0.5 + 0.6 + 0.7 + 0.8 + 0.9 + 1.0 + + + + + + + + + + + 0.0 + 0.2 + 0.4 + 0.6 + 0.8 + 1.0 + + + x → + + + + + + + + + + + 0.0 + 0.2 + 0.4 + 0.6 + 0.8 + 1.0 + + + + + + + + + + \ No newline at end of file diff --git a/test/output/axisLabelBothReverse.svg b/test/output/axisLabelBothReverse.svg new file mode 100644 index 0000000000..526d2d59fd --- /dev/null +++ b/test/output/axisLabelBothReverse.svg @@ -0,0 +1,114 @@ + + + + + + + + + + + + + + + + + 1.0 + 0.9 + 0.8 + 0.7 + 0.6 + 0.5 + 0.4 + 0.3 + 0.2 + 0.1 + 0.0 + + + ← y + + + + + + + + + + + + + + + + 1.0 + 0.9 + 0.8 + 0.7 + 0.6 + 0.5 + 0.4 + 0.3 + 0.2 + 0.1 + 0.0 + + + + + + + + + + + 1.0 + 0.8 + 0.6 + 0.4 + 0.2 + 0.0 + + + ← x + + + + + + + + + + + 1.0 + 0.8 + 0.6 + 0.4 + 0.2 + 0.0 + + + + + + + + + + \ No newline at end of file diff --git a/test/output/axisLabelX.svg b/test/output/axisLabelX.svg new file mode 100644 index 0000000000..11d858d13e --- /dev/null +++ b/test/output/axisLabelX.svg @@ -0,0 +1,87 @@ + + + + + + + + + + + + + + + + + + 0.0 + 0.1 + 0.2 + 0.3 + 0.4 + 0.5 + 0.6 + 0.7 + 0.8 + 0.9 + 1.0 + + + top-left + + + top-center + + + top-right + + + + + + + + + + + + + + + + 0.0 + 0.1 + 0.2 + 0.3 + 0.4 + 0.5 + 0.6 + 0.7 + 0.8 + 0.9 + 1.0 + + + bottom-left + + + bottom-center + + + bottom-right + + \ No newline at end of file diff --git a/test/output/axisLabelY.svg b/test/output/axisLabelY.svg new file mode 100644 index 0000000000..3138af7481 --- /dev/null +++ b/test/output/axisLabelY.svg @@ -0,0 +1,87 @@ + + + + + + + + + + + + + + + + + + 0.0 + 0.1 + 0.2 + 0.3 + 0.4 + 0.5 + 0.6 + 0.7 + 0.8 + 0.9 + 1.0 + + + left-top + + + left-center + + + left-bottom + + + + + + + + + + + + + + + + 0.0 + 0.1 + 0.2 + 0.3 + 0.4 + 0.5 + 0.6 + 0.7 + 0.8 + 0.9 + 1.0 + + + right-top + + + right-center + + + right-bottom + + \ No newline at end of file diff --git a/test/output/ballotStatusRace.svg b/test/output/ballotStatusRace.svg index fae40f1d94..59b1b21a96 100644 --- a/test/output/ballotStatusRace.svg +++ b/test/output/ballotStatusRace.svg @@ -13,173 +13,170 @@ white-space: pre; } - - - WHITE + + + WHITE - - UNDESIGNATED + + + + + - - ASIAN - - - OTHER - - - TWO or MORE RACES + + 79.0% + 0.4% + 20.5% - - INDIAN AMERICAN or ALASKA NATIVE + + - - BLACK or AFRICAN AMERICAN + + + + UNDESIGNATED - - NATIVE HAWAIIAN or PACIFIC ISLANDER + + + + + - - - - 0 - - - - 20 - - - - 40 - - - - 60 - - Frequency (%) → - - - - 79.0% - - - 0.4% - - - 20.5% - + 78.3% + 0.6% + 21.1% - + - - - - 78.3% - - - 0.6% - - - 21.1% - + + + ASIAN - - + + + + + - - - - 77.9% - - - 21.5% - - - 0.6% - + 77.9% + 21.5% + 0.6% - + - + + + OTHER + + + + + + + - - 74.1% - - - 0.8% - - - 25.1% - + 74.1% + 0.8% + 25.1% - + - + + + TWO or MORE RACES + + + + + + + - - 73.9% - - - 25.3% - - - 0.8% - + 73.9% + 25.3% + 0.8% - + - + + + INDIAN AMERICAN or ALASKA NATIVE + + + + + + + - - 25.5% - - - 72.2% - - - 2.3% - + 25.5% + 72.2% + 2.3% - + - + + + BLACK or AFRICAN AMERICAN + + + + + + + - - 67.4% - - - 31.5% - - - 1.1% - + 67.4% + 31.5% + 1.1% - + - + + + NATIVE HAWAIIAN or PACIFIC ISLANDER + + + + + + + + + + + + + + + 0 + 20 + 40 + 60 + - - 41.7% - - - 58.3% - + 41.7% + 58.3% - + + + Frequency (%) → + \ No newline at end of file diff --git a/test/output/bandClip.svg b/test/output/bandClip.svg index 6c24b791e8..9212b5a80f 100644 --- a/test/output/bandClip.svg +++ b/test/output/bandClip.svg @@ -13,33 +13,35 @@ white-space: pre; } - - - A - - - B - - - C - + + + + - - - A - - - B - - - C - + + A + B + C + + + + + + + + A + B + C - ABC + + A + B + C + \ No newline at end of file diff --git a/test/output/bandClip2.svg b/test/output/bandClip2.svg index 4597e86982..c04df8793b 100644 --- a/test/output/bandClip2.svg +++ b/test/output/bandClip2.svg @@ -13,77 +13,74 @@ white-space: pre; } - - - - 0 - - - - 1 - - - - 2 - - - - 3 - - - - 4 - - - - 5 - - - - 6 - - - - 7 - - - - 8 - - - - 9 - - - - 10 - ↑ Count + + + + + + + + + + + + - - - - 2022-12-01 - - - - 2022-12-02 - - - - 2022-12-03 - - - - 2022-12-04 - - - - 2022-12-05 - - - - 2022-12-06 - Date + + + + + + + + + + + + + + + 0 + 1 + 2 + 3 + 4 + 5 + 6 + 7 + 8 + 9 + 10 + + + ↑ Count + + + + + + + + + + + + + + + + + + + 2022-12-01 + 2022-12-02 + 2022-12-03 + 2022-12-04 + 2022-12-05 + 2022-12-06 + + + Date diff --git a/test/output/beckerBarley.svg b/test/output/beckerBarley.svg index ebcd8ae1a7..9843c8df67 100644 --- a/test/output/beckerBarley.svg +++ b/test/output/beckerBarley.svg @@ -13,456 +13,469 @@ white-space: pre; } - - - Waseca - - - Crookston - - - Morris - - - University Farm - - - Duluth - - - Grand Rapids - site - - - - 10 - - - - 20 - - - - 30 - - - - 40 - - - - 50 - - - - 60 - - - - 70 - - yield → - - - - - Trebi - - - - Wisconsin No. 38 - - - - No. 457 - - - - Glabron - - - - Peatland - - - - Velvet - - - - No. 475 - - - - Manchuria - - - - No. 462 - - - - Svansota - - - - - - Trebi - - - - Wisconsin No. 38 - - - - No. 457 - - - - Glabron - - - - Peatland - - - - Velvet - - - - No. 475 - - - - Manchuria - - - - No. 462 - - - - Svansota - - - - - - Trebi - - - - Wisconsin No. 38 - - - - No. 457 - - - - Glabron - - - - Peatland - - - - Velvet - - - - No. 475 - - - - Manchuria - - - - No. 462 - - - - Svansota - - - - - - Trebi - - - - Wisconsin No. 38 - - - - No. 457 - - - - Glabron - - - - Peatland - - - - Velvet - - - - No. 475 - - - - Manchuria - - - - No. 462 - - - - Svansota - variety - - - - - Trebi - - - - Wisconsin No. 38 - - - - No. 457 - - - - Glabron - - - - Peatland - - - - Velvet - - - - No. 475 - - - - Manchuria - - - - No. 462 - - - - Svansota - - - - - - Trebi - - - - Wisconsin No. 38 - - - - No. 457 - - - - Glabron - - - - Peatland - - - - Velvet - - - - No. 475 - - - - Manchuria - - - - No. 462 - - - - Svansota - - - - + + + Waseca + + + + + + + + + + + + + + + + + + + + + + + + + + + Trebi + Wisconsin No. 38 + No. 457 + Glabron + Peatland + Velvet + No. 475 + Manchuria + No. 462 + Svansota + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + - - + + + Crookston + + + + + + + + + + + + + + + + + + + + + + + + + + + Trebi + Wisconsin No. 38 + No. 457 + Glabron + Peatland + Velvet + No. 475 + Manchuria + No. 462 + Svansota + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + - - + + + Morris + + + + + + + + + + + + + + + + + + + + + + + + + + + Trebi + Wisconsin No. 38 + No. 457 + Glabron + Peatland + Velvet + No. 475 + Manchuria + No. 462 + Svansota + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + - - + + + University Farm + + + + + + + + + + + + + + + + + + + + + + + + + + + Trebi + Wisconsin No. 38 + No. 457 + Glabron + Peatland + Velvet + No. 475 + Manchuria + No. 462 + Svansota + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + - - + + + Duluth + + + + + + + + + + + + + + + + + + + + + + + + + + + Trebi + Wisconsin No. 38 + No. 457 + Glabron + Peatland + Velvet + No. 475 + Manchuria + No. 462 + Svansota + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + - - + + + Grand Rapids + + + + + + + + + + + + + + + + + + + + + + + + + + + Trebi + Wisconsin No. 38 + No. 457 + Glabron + Peatland + Velvet + No. 475 + Manchuria + No. 462 + Svansota + + + + + + + + + + + + + + + + + + + + + 10 + 20 + 30 + 40 + 50 + 60 + 70 + + - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + site + + + variety + + + yield → + \ No newline at end of file diff --git a/test/output/bin1m.svg b/test/output/bin1m.svg index ae3e666de3..12449de3d3 100644 --- a/test/output/bin1m.svg +++ b/test/output/bin1m.svg @@ -13,84 +13,66 @@ white-space: pre; } - - - 0 - - - 500 - - - 1,000 - - - 1,500 - - - 2,000 - - - 2,500 - - - 3,000 - - - 3,500 - - - 4,000 - - - 4,500 - - - 5,000 - - - 5,500 - ↑ Frequency + + + + + + + + + + + + + - - - 2020 - - - February - - - March - - - April - - - May - - - June - - - July - - - August - - - September - - - October - - - November - - - December - - - 2021 - + + 0 + 500 + 1,000 + 1,500 + 2,000 + 2,500 + 3,000 + 3,500 + 4,000 + 4,500 + 5,000 + 5,500 + + + ↑ Frequency + + + + + + + + + + + + + + + + + + 2020 + February + March + April + May + June + July + August + September + October + November + December + 2021 diff --git a/test/output/binStrings.svg b/test/output/binStrings.svg index c283079adf..0856d3c6ed 100644 --- a/test/output/binStrings.svg +++ b/test/output/binStrings.svg @@ -13,90 +13,70 @@ white-space: pre; } - - - 0.0 - - - 0.2 - - - 0.4 - - - 0.6 - - - 0.8 - - - 1.0 - - - 1.2 - - - 1.4 - - - 1.6 - - - 1.8 - - - 2.0 - - - 2.2 - - - 2.4 - - - 2.6 - - - 2.8 - - - 3.0 - ↑ Frequency + + + + + + + + + + + + + + + + + - - - 5 - - - 6 - - - 7 - - - 8 - - - 9 - - - 10 - - - 11 - - - 12 - - - 13 - - - 14 - - - 15 - + + 0.0 + 0.2 + 0.4 + 0.6 + 0.8 + 1.0 + 1.2 + 1.4 + 1.6 + 1.8 + 2.0 + 2.2 + 2.4 + 2.6 + 2.8 + 3.0 + + + ↑ Frequency + + + + + + + + + + + + + + + + 5 + 6 + 7 + 8 + 9 + 10 + 11 + 12 + 13 + 14 + 15 diff --git a/test/output/binTimestamps.svg b/test/output/binTimestamps.svg index 524017402f..dab9e7e3fd 100644 --- a/test/output/binTimestamps.svg +++ b/test/output/binTimestamps.svg @@ -13,66 +13,54 @@ white-space: pre; } - - - 0.0 - - - 0.1 - - - 0.2 - - - 0.3 - - - 0.4 - - - 0.5 - - - 0.6 - - - 0.7 - - - 0.8 - - - 0.9 - - - 1.0 - ↑ Frequency + + + + + + + + + + + + - - - 2021 - - - Sat 02 - - - Jan 03 - - - Mon 04 - - - Tue 05 - - - Wed 06 - - - Thu 07 - - - Fri 08 - + + 0.0 + 0.1 + 0.2 + 0.3 + 0.4 + 0.5 + 0.6 + 0.7 + 0.8 + 0.9 + 1.0 + + + ↑ Frequency + + + + + + + + + + + + + 2021 + Sat 02 + Jan 03 + Mon 04 + Tue 05 + Wed 06 + Thu 07 + Fri 08 diff --git a/test/output/boxplot.svg b/test/output/boxplot.svg index ea6c6d23c6..1a52874cd4 100644 --- a/test/output/boxplot.svg +++ b/test/output/boxplot.svg @@ -13,31 +13,25 @@ white-space: pre; } - - - 0 - - - 1 - - - 2 - - - 3 - - - 4 - - - 5 - - - 6 - - - 7 - + + + + + + + + + + + + 0 + 1 + 2 + 3 + 4 + 5 + 6 + 7 diff --git a/test/output/caltrain.html b/test/output/caltrain.html index 1da9f0007d..3305eae204 100644 --- a/test/output/caltrain.html +++ b/test/output/caltrain.html @@ -51,11 +51,116 @@ white-space: pre; } - Northbound - Southbound - 5a8p9p10p11p8a9a5p6p10a11a12p1p2p3p4p6a7a7p12a - 010101010105050506061011111116161616162123232324242436363636384141414141415454 - 010101020303030303030312121218181821252525262626263636363838384449495151515757 + + Northbound + + + Southbound + + + 5a + 8p + 9p + 10p + 11p + 8a + 9a + 5p + 6p + 10a + 11a + 12p + 1p + 2p + 3p + 4p + 6a + 7a + 7p + 12a + + + 01 + 01 + 01 + 01 + 01 + 05 + 05 + 05 + 06 + 06 + 10 + 11 + 11 + 11 + 16 + 16 + 16 + 16 + 16 + 21 + 23 + 23 + 23 + 24 + 24 + 24 + 36 + 36 + 36 + 36 + 38 + 41 + 41 + 41 + 41 + 41 + 41 + 54 + 54 + + + 01 + 01 + 01 + 02 + 03 + 03 + 03 + 03 + 03 + 03 + 03 + 12 + 12 + 12 + 18 + 18 + 18 + 21 + 25 + 25 + 25 + 26 + 26 + 26 + 26 + 36 + 36 + 36 + 38 + 38 + 38 + 44 + 49 + 49 + 51 + 51 + 51 + 57 + 57 + diff --git a/test/output/caltrainDirection.svg b/test/output/caltrainDirection.svg index e9f7a1fba7..a29db0b289 100644 --- a/test/output/caltrainDirection.svg +++ b/test/output/caltrainDirection.svg @@ -13,128 +13,121 @@ white-space: pre; } - - - B + + + B - - L - - - N + + + + + + + + + + + + + + + + + - - - 06 AM - - - 09 AM - - - 12 PM - - - 03 PM - - - 06 PM - - - 09 PM + + + L - - 12 AM - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + N + + + + + + + + + + + + 06 AM + 09 AM + 12 PM + 03 PM + 06 PM + 09 PM + 12 AM - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + \ No newline at end of file diff --git a/test/output/carsDodge.svg b/test/output/carsDodge.svg index 030861b011..5583765dc2 100644 --- a/test/output/carsDodge.svg +++ b/test/output/carsDodge.svg @@ -13,29 +13,27 @@ white-space: pre; } - - - - 2,000 - - - 2,500 - - - 3,000 - - - 3,500 - - - 4,000 - - - 4,500 - - - 5,000 - weight (lb) → + + + + + + + + + + + + 2,000 + 2,500 + 3,000 + 3,500 + 4,000 + 4,500 + 5,000 + + + weight (lb) → diff --git a/test/output/carsHexbin.html b/test/output/carsHexbin.html index ceab45ff29..2ae76c4a0d 100644 --- a/test/output/carsHexbin.html +++ b/test/output/carsHexbin.html @@ -16,18 +16,23 @@ - 2,000 + + 2,000 - 3,000 + + 3,000 - 4,000 + + 4,000 - 5,000 + + 5,000 - weight (lb) + + weight (lb) - - - 10 - - - 15 - - - 20 - - - 25 - - - 30 - - - 35 - - - 40 - - - 45 - ↑ economy (mpg) + + + + + + + + + - - - 100 - - - 150 - - - 200 - - - 250 - - - 300 - - - 350 - - - 400 - - - 450 - displacement (cc) → + + 10 + 15 + 20 + 25 + 30 + 35 + 40 + 45 + + + ↑ economy (mpg) + + + + + + + + + + + + + 100 + 150 + 200 + 250 + 300 + 350 + 400 + 450 + + + displacement (cc) → diff --git a/test/output/carsJitter.html b/test/output/carsJitter.html index c6b97a893f..5b03ba2d94 100644 --- a/test/output/carsJitter.html +++ b/test/output/carsJitter.html @@ -16,18 +16,23 @@ - 50 + + 50 - 100 + + 100 - 150 + + 150 - 200 + + 200 - power (hp) + + power (hp) - - - - 8 - - - - 6 - - - - 5 - - - - 4 - - - - 3 - cylinders + + + + + + - - - 1,500 - - - 2,000 - - - 2,500 - - - 3,000 - - - 3,500 - - - 4,000 - - - 4,500 - - - 5,000 - - - 5,500 - weight (lb) → + + + + + + + + + 8 + 6 + 5 + 4 + 3 + + + cylinders + + + + + + + + + + + + + + 1,500 + 2,000 + 2,500 + 3,000 + 3,500 + 4,000 + 4,500 + 5,000 + 5,500 + + + weight (lb) → diff --git a/test/output/carsMpg.svg b/test/output/carsMpg.svg index 2f7f8790e6..5d6cb178bc 100644 --- a/test/output/carsMpg.svg +++ b/test/output/carsMpg.svg @@ -13,88 +13,77 @@ white-space: pre; } - - - - 0 - - - - 5 - - - - 10 - - - - 15 - - - - 20 - - - - 25 - - - - 30 - - - - 35 - - - - 40 - - - - 45 - ↑ economy (mpg) + + + + + + + + + + + - - - 70 - - - 71 - - - 72 - - - 73 - - - 74 - - - 75 - - - 76 - - - 77 - - - 78 - - - 79 - - - 80 - - - 81 - - - 82 - year + + + + + + + + + + + + + + 0 + 5 + 10 + 15 + 20 + 25 + 30 + 35 + 40 + 45 + + + ↑ economy (mpg) + + + + + + + + + + + + + + + + + + 70 + 71 + 72 + 73 + 74 + 75 + 76 + 77 + 78 + 79 + 80 + 81 + 82 + + + year diff --git a/test/output/carsParcoords.svg b/test/output/carsParcoords.svg index 09068961c0..b6eb73b26c 100644 --- a/test/output/carsParcoords.svg +++ b/test/output/carsParcoords.svg @@ -13,28 +13,23 @@ white-space: pre; } - - - economy (mpg) - - - cylinders - - - displacement (cc) - - - power (hp) - - - weight (lb) - - - 0-60 mph (s) - - - year - + + + + + + + + + + + economy (mpg) + cylinders + displacement (cc) + power (hp) + weight (lb) + 0-60 mph (s) + year @@ -450,5 +445,60 @@ - 101520253035404534567810015020025030035040045060801001201401601802002202,0002,5003,0003,5004,0004,5005,0008101214161820222470727476788082 + + 10 + 15 + 20 + 25 + 30 + 35 + 40 + 45 + 3 + 4 + 5 + 6 + 7 + 8 + 100 + 150 + 200 + 250 + 300 + 350 + 400 + 450 + 60 + 80 + 100 + 120 + 140 + 160 + 180 + 200 + 220 + 2,000 + 2,500 + 3,000 + 3,500 + 4,000 + 4,500 + 5,000 + 8 + 10 + 12 + 14 + 16 + 18 + 20 + 22 + 24 + 70 + 72 + 74 + 76 + 78 + 80 + 82 + \ No newline at end of file diff --git a/test/output/clamp.svg b/test/output/clamp.svg index 646f39d9f7..0247b29d4f 100644 --- a/test/output/clamp.svg +++ b/test/output/clamp.svg @@ -13,34 +13,27 @@ white-space: pre; } - - - 2006 - - - April - - - July - - - October - - - 2007 - - - April - - - July - - - October - - - 2008 - + + + + + + + + + + + + + 2006 + April + July + October + 2007 + April + July + October + 2008 diff --git a/test/output/collapsedHistogram.svg b/test/output/collapsedHistogram.svg index 7c06f06024..5a9c77549e 100644 --- a/test/output/collapsedHistogram.svg +++ b/test/output/collapsedHistogram.svg @@ -13,60 +13,50 @@ white-space: pre; } - - - 0.0 - - - 0.2 - - - 0.4 - - - 0.6 - - - 0.8 - - - 1.0 - - - 1.2 - - - 1.4 - - - 1.6 - - - 1.8 - - - 2.0 - - - 2.2 - - - 2.4 - - - 2.6 - - - 2.8 - - - 3.0 - ↑ Frequency + + + + + + + + + + + + + + + + + - - - 1 - + + 0.0 + 0.2 + 0.4 + 0.6 + 0.8 + 1.0 + 1.2 + 1.4 + 1.6 + 1.8 + 2.0 + 2.2 + 2.4 + 2.6 + 2.8 + 3.0 + + + ↑ Frequency + + + + + + 1 diff --git a/test/output/colorLegendDiverging.svg b/test/output/colorLegendDiverging.svg index fe98cfbdbb..8efbac6aad 100644 --- a/test/output/colorLegendDiverging.svg +++ b/test/output/colorLegendDiverging.svg @@ -16,19 +16,25 @@ - −10% + + −10% - −5% + + −5% - +0% + + +0% - +5% + + +5% - +10% + + +10% - Daily change + + Daily change \ No newline at end of file diff --git a/test/output/colorLegendDivergingPivot.svg b/test/output/colorLegendDivergingPivot.svg index 6a79c777f3..dfcf2b1b6a 100644 --- a/test/output/colorLegendDivergingPivot.svg +++ b/test/output/colorLegendDivergingPivot.svg @@ -16,19 +16,24 @@ - 1 + + 1 - 2 + + 2 - 3 + + 3 - 4 + + 4 - 5 + + 5 \ No newline at end of file diff --git a/test/output/colorLegendDivergingPivotAsymmetric.svg b/test/output/colorLegendDivergingPivotAsymmetric.svg index 59cb76488e..ff416f9e03 100644 --- a/test/output/colorLegendDivergingPivotAsymmetric.svg +++ b/test/output/colorLegendDivergingPivotAsymmetric.svg @@ -16,16 +16,20 @@ - 1 + + 1 - 2 + + 2 - 3 + + 3 - 4 + + 4 \ No newline at end of file diff --git a/test/output/colorLegendDivergingSqrt.svg b/test/output/colorLegendDivergingSqrt.svg index 0f88f9649c..d85093e11d 100644 --- a/test/output/colorLegendDivergingSqrt.svg +++ b/test/output/colorLegendDivergingSqrt.svg @@ -16,19 +16,25 @@ - −10% + + −10% - −5% + + −5% - +0% + + +0% - +5% + + +5% - +10% + + +10% - Daily change + + Daily change \ No newline at end of file diff --git a/test/output/colorLegendImplicitLabel.svg b/test/output/colorLegendImplicitLabel.svg index 94ba7c13cd..1b72a9d134 100644 --- a/test/output/colorLegendImplicitLabel.svg +++ b/test/output/colorLegendImplicitLabel.svg @@ -16,19 +16,25 @@ - 0 + + 0 - 20 + + 20 - 40 + + 40 - 60 + + 60 - 80 + + 80 - thing + + thing \ No newline at end of file diff --git a/test/output/colorLegendInterpolate.svg b/test/output/colorLegendInterpolate.svg index 04b4e30ec0..4d51357bf2 100644 --- a/test/output/colorLegendInterpolate.svg +++ b/test/output/colorLegendInterpolate.svg @@ -16,22 +16,28 @@ - 0 + + 0 - 2 + + 2 - 4 + + 4 - 6 + + 6 - 8 + + 8 - 10 + + 10 \ No newline at end of file diff --git a/test/output/colorLegendInterpolateSqrt.svg b/test/output/colorLegendInterpolateSqrt.svg index 36f50d537a..327c231b27 100644 --- a/test/output/colorLegendInterpolateSqrt.svg +++ b/test/output/colorLegendInterpolateSqrt.svg @@ -16,22 +16,28 @@ - 0 + + 0 - 2 + + 2 - 4 + + 4 - 6 + + 6 - 8 + + 8 - 10 + + 10 \ No newline at end of file diff --git a/test/output/colorLegendLabelBoth.svg b/test/output/colorLegendLabelBoth.svg index 9dcdbc87eb..7c96c16cfd 100644 --- a/test/output/colorLegendLabelBoth.svg +++ b/test/output/colorLegendLabelBoth.svg @@ -16,22 +16,29 @@ - 0 + + 0 - 2 + + 2 - 4 + + 4 - 6 + + 6 - 8 + + 8 - 10 + + 10 - Legend + + Legend \ No newline at end of file diff --git a/test/output/colorLegendLabelLegend.svg b/test/output/colorLegendLabelLegend.svg index 9dcdbc87eb..7c96c16cfd 100644 --- a/test/output/colorLegendLabelLegend.svg +++ b/test/output/colorLegendLabelLegend.svg @@ -16,22 +16,29 @@ - 0 + + 0 - 2 + + 2 - 4 + + 4 - 6 + + 6 - 8 + + 8 - 10 + + 10 - Legend + + Legend \ No newline at end of file diff --git a/test/output/colorLegendLabelScale.svg b/test/output/colorLegendLabelScale.svg index ec93e9e2b2..779f131b25 100644 --- a/test/output/colorLegendLabelScale.svg +++ b/test/output/colorLegendLabelScale.svg @@ -16,22 +16,29 @@ - 0 + + 0 - 2 + + 2 - 4 + + 4 - 6 + + 6 - 8 + + 8 - 10 + + 10 - Scale + + Scale \ No newline at end of file diff --git a/test/output/colorLegendLinear.svg b/test/output/colorLegendLinear.svg index 2966023882..0a3c67929a 100644 --- a/test/output/colorLegendLinear.svg +++ b/test/output/colorLegendLinear.svg @@ -16,22 +16,28 @@ - 0 + + 0 - 2 + + 2 - 4 + + 4 - 6 + + 6 - 8 + + 8 - 10 + + 10 \ No newline at end of file diff --git a/test/output/colorLegendLinearNoTicks.svg b/test/output/colorLegendLinearNoTicks.svg index 3770d75ca1..4c90fe2103 100644 --- a/test/output/colorLegendLinearNoTicks.svg +++ b/test/output/colorLegendLinearNoTicks.svg @@ -16,22 +16,28 @@ - + + - + + - + + - + + - + + - + + \ No newline at end of file diff --git a/test/output/colorLegendLinearTruncatedScheme.svg b/test/output/colorLegendLinearTruncatedScheme.svg index e57b73d9fd..64affb8a8b 100644 --- a/test/output/colorLegendLinearTruncatedScheme.svg +++ b/test/output/colorLegendLinearTruncatedScheme.svg @@ -16,22 +16,28 @@ - 0.0 + + 0.0 - 0.2 + + 0.2 - 0.4 + + 0.4 - 0.6 + + 0.6 - 0.8 + + 0.8 - 1.0 + + 1.0 \ No newline at end of file diff --git a/test/output/colorLegendLog.svg b/test/output/colorLegendLog.svg index 056e328340..efc3552dfe 100644 --- a/test/output/colorLegendLog.svg +++ b/test/output/colorLegendLog.svg @@ -16,34 +16,44 @@ - 1 + + 1 - 2 + + 2 - 3 + + 3 - + + - + + - + + - + + - + + - + + - 10 + + 10 \ No newline at end of file diff --git a/test/output/colorLegendLogTicks.svg b/test/output/colorLegendLogTicks.svg index 2fec47899a..dbeb20f772 100644 --- a/test/output/colorLegendLogTicks.svg +++ b/test/output/colorLegendLogTicks.svg @@ -16,34 +16,44 @@ - 1 + + 1 - 2 + + 2 - 3 + + 3 - 4 + + 4 - 5 + + 5 - 6 + + 6 - 7 + + 7 - 8 + + 8 - 9 + + 9 - 10 + + 10 \ No newline at end of file diff --git a/test/output/colorLegendMargins.svg b/test/output/colorLegendMargins.svg index 740549c65c..360ccdd3cb 100644 --- a/test/output/colorLegendMargins.svg +++ b/test/output/colorLegendMargins.svg @@ -16,13 +16,17 @@ - 0 + + 0 - 5 + + 5 - 10 + + 10 - I feel blue + + I feel blue \ No newline at end of file diff --git a/test/output/colorLegendOrdinalRamp.svg b/test/output/colorLegendOrdinalRamp.svg index 4072e462b8..521a0a0ee5 100644 --- a/test/output/colorLegendOrdinalRamp.svg +++ b/test/output/colorLegendOrdinalRamp.svg @@ -27,34 +27,44 @@ - A + + A - B + + B - C + + C - D + + D - E + + E - F + + F - G + + G - H + + H - I + + I - J + + J \ No newline at end of file diff --git a/test/output/colorLegendOrdinalRampTickSize.svg b/test/output/colorLegendOrdinalRampTickSize.svg index f2bafcefa4..2a7b51ef5c 100644 --- a/test/output/colorLegendOrdinalRampTickSize.svg +++ b/test/output/colorLegendOrdinalRampTickSize.svg @@ -24,25 +24,33 @@ - <20 + + <20 - 20-29 + + 20-29 - 30-39 + + 30-39 - 40-49 + + 40-49 - 50-59 + + 50-59 - 60-69 + + 60-69 - ≥70 + + ≥70 - Age (years) + + Age (years) \ No newline at end of file diff --git a/test/output/colorLegendOrdinalReverseRamp.svg b/test/output/colorLegendOrdinalReverseRamp.svg index 615d05110d..07024e6f12 100644 --- a/test/output/colorLegendOrdinalReverseRamp.svg +++ b/test/output/colorLegendOrdinalReverseRamp.svg @@ -27,34 +27,44 @@ - J + + J - I + + I - H + + H - G + + G - F + + F - E + + E - D + + D - C + + C - B + + B - A + + A \ No newline at end of file diff --git a/test/output/colorLegendOrdinalSchemeRamp.svg b/test/output/colorLegendOrdinalSchemeRamp.svg index 11949d1986..2a2c2237a4 100644 --- a/test/output/colorLegendOrdinalSchemeRamp.svg +++ b/test/output/colorLegendOrdinalSchemeRamp.svg @@ -27,34 +27,44 @@ - A + + A - B + + B - C + + C - D + + D - E + + E - F + + F - G + + G - H + + H - I + + I - J + + J \ No newline at end of file diff --git a/test/output/colorLegendOrdinalTicks.svg b/test/output/colorLegendOrdinalTicks.svg index 7c9c9398ff..e0cfc4cac9 100644 --- a/test/output/colorLegendOrdinalTicks.svg +++ b/test/output/colorLegendOrdinalTicks.svg @@ -22,13 +22,16 @@ - 0 + + 0 - 1 + + 1 - 4 + + 4 \ No newline at end of file diff --git a/test/output/colorLegendQuantile.svg b/test/output/colorLegendQuantile.svg index acd341ba27..7f483cd5dc 100644 --- a/test/output/colorLegendQuantile.svg +++ b/test/output/colorLegendQuantile.svg @@ -24,22 +24,29 @@ - 200 + + 200 - 800 + + 800 - 1,800 + + 1,800 - 3,201 + + 3,201 - 5,001 + + 5,001 - 7,201 + + 7,201 - Inferno + + Inferno \ No newline at end of file diff --git a/test/output/colorLegendQuantileImplicit.svg b/test/output/colorLegendQuantileImplicit.svg index acd341ba27..7f483cd5dc 100644 --- a/test/output/colorLegendQuantileImplicit.svg +++ b/test/output/colorLegendQuantileImplicit.svg @@ -24,22 +24,29 @@ - 200 + + 200 - 800 + + 800 - 1,800 + + 1,800 - 3,201 + + 3,201 - 5,001 + + 5,001 - 7,201 + + 7,201 - Inferno + + Inferno \ No newline at end of file diff --git a/test/output/colorLegendQuantitative.svg b/test/output/colorLegendQuantitative.svg index 2966023882..0a3c67929a 100644 --- a/test/output/colorLegendQuantitative.svg +++ b/test/output/colorLegendQuantitative.svg @@ -16,22 +16,28 @@ - 0 + + 0 - 2 + + 2 - 4 + + 4 - 6 + + 6 - 8 + + 8 - 10 + + 10 \ No newline at end of file diff --git a/test/output/colorLegendQuantitativeScheme.svg b/test/output/colorLegendQuantitativeScheme.svg index 438418e60e..514f2a7495 100644 --- a/test/output/colorLegendQuantitativeScheme.svg +++ b/test/output/colorLegendQuantitativeScheme.svg @@ -16,22 +16,28 @@ - 0.0 + + 0.0 - 0.2 + + 0.2 - 0.4 + + 0.4 - 0.6 + + 0.6 - 0.8 + + 0.8 - 1.0 + + 1.0 \ No newline at end of file diff --git a/test/output/colorLegendQuantize.svg b/test/output/colorLegendQuantize.svg index 82ba4d62b1..12abb3a389 100644 --- a/test/output/colorLegendQuantize.svg +++ b/test/output/colorLegendQuantize.svg @@ -25,25 +25,33 @@ - 20 + + 20 - 40 + + 40 - 60 + + 60 - 80 + + 80 - 100 + + 100 - 120 + + 120 - 140 + + 140 - quantize scale + + quantize scale \ No newline at end of file diff --git a/test/output/colorLegendQuantizeDescending.svg b/test/output/colorLegendQuantizeDescending.svg index c22a7f594c..cbd41c0d34 100644 --- a/test/output/colorLegendQuantizeDescending.svg +++ b/test/output/colorLegendQuantizeDescending.svg @@ -25,25 +25,33 @@ - 140 + + 140 - 120 + + 120 - 100 + + 100 - 80 + + 80 - 60 + + 60 - 40 + + 40 - 20 + + 20 - quantize descending + + quantize descending \ No newline at end of file diff --git a/test/output/colorLegendQuantizeDescendingReversed.svg b/test/output/colorLegendQuantizeDescendingReversed.svg index e58b9b761f..0e0e66ab77 100644 --- a/test/output/colorLegendQuantizeDescendingReversed.svg +++ b/test/output/colorLegendQuantizeDescendingReversed.svg @@ -22,16 +22,21 @@ - 8 + + 8 - 6 + + 6 - 4 + + 4 - 2 + + 2 - quantize descending reversed + + quantize descending reversed \ No newline at end of file diff --git a/test/output/colorLegendQuantizeRange.svg b/test/output/colorLegendQuantizeRange.svg index 06839cb4e6..e7695ca363 100644 --- a/test/output/colorLegendQuantizeRange.svg +++ b/test/output/colorLegendQuantizeRange.svg @@ -22,16 +22,21 @@ - 29.6 + + 29.6 - 58.2 + + 58.2 - 86.8 + + 86.8 - 115.4 + + 115.4 - quantize scale + + quantize scale \ No newline at end of file diff --git a/test/output/colorLegendQuantizeReverse.svg b/test/output/colorLegendQuantizeReverse.svg index e386aab98e..2bcc4fba38 100644 --- a/test/output/colorLegendQuantizeReverse.svg +++ b/test/output/colorLegendQuantizeReverse.svg @@ -25,25 +25,33 @@ - -40 + + -40 - -20 + + -20 - 0 + + 0 - 20 + + 20 - 40 + + 40 - 60 + + 60 - 80 + + 80 - quantize reversed + + quantize reversed \ No newline at end of file diff --git a/test/output/colorLegendSqrt.svg b/test/output/colorLegendSqrt.svg index 36f50d537a..327c231b27 100644 --- a/test/output/colorLegendSqrt.svg +++ b/test/output/colorLegendSqrt.svg @@ -16,22 +16,28 @@ - 0 + + 0 - 2 + + 2 - 4 + + 4 - 6 + + 6 - 8 + + 8 - 10 + + 10 \ No newline at end of file diff --git a/test/output/colorLegendSqrtPiecewise.svg b/test/output/colorLegendSqrtPiecewise.svg index 431e48ecdb..0aaf7464a1 100644 --- a/test/output/colorLegendSqrtPiecewise.svg +++ b/test/output/colorLegendSqrtPiecewise.svg @@ -16,19 +16,24 @@ - −100 + + −100 - −50 + + −50 - 0 + + 0 - 50 + + 50 - 100 + + 100 \ No newline at end of file diff --git a/test/output/colorLegendThreshold.svg b/test/output/colorLegendThreshold.svg index ded6170848..546f436e4b 100644 --- a/test/output/colorLegendThreshold.svg +++ b/test/output/colorLegendThreshold.svg @@ -27,31 +27,41 @@ - 1 + + 1 - 2 + + 2 - 3 + + 3 - 4 + + 4 - 5 + + 5 - 6 + + 6 - 7 + + 7 - 8 + + 8 - 9 + + 9 - Viridis + + Viridis \ No newline at end of file diff --git a/test/output/colorLegendThresholdTickSize.svg b/test/output/colorLegendThresholdTickSize.svg index 2e38da5e45..7a9d44ea67 100644 --- a/test/output/colorLegendThresholdTickSize.svg +++ b/test/output/colorLegendThresholdTickSize.svg @@ -26,28 +26,37 @@ - 2.5 + + 2.5 - 3.1 + + 3.1 - 3.5 + + 3.5 - 3.9 + + 3.9 - 6 + + 6 - 7 + + 7 - 8 + + 8 - 9.5 + + 9.5 - Unemployment rate (%) + + Unemployment rate (%) \ No newline at end of file diff --git a/test/output/colorSchemesQuantitative.html b/test/output/colorSchemesQuantitative.html index 80b1c4a154..9161178809 100644 --- a/test/output/colorSchemesQuantitative.html +++ b/test/output/colorSchemesQuantitative.html @@ -14,7 +14,8 @@ } - brbg + + brbg - prgn + + prgn - piyg + + piyg - puor + + puor - rdbu + + rdbu - rdgy + + rdgy - rdylbu + + rdylbu - rdylgn + + rdylgn - spectral + + spectral - burd + + burd - buylrd + + buylrd - blues + + blues - greens + + greens - greys + + greys - purples + + purples - reds + + reds - oranges + + oranges - turbo + + turbo - viridis + + viridis - magma + + magma - inferno + + inferno - plasma + + plasma - cividis + + cividis - cubehelix + + cubehelix - warm + + warm - cool + + cool - bugn + + bugn - bupu + + bupu - gnbu + + gnbu - orrd + + orrd - pubugn + + pubugn - pubu + + pubu - purd + + purd - rdpu + + rdpu - ylgnbu + + ylgnbu - ylgn + + ylgn - ylorbr + + ylorbr - ylorrd + + ylorrd - rainbow + + rainbow - sinebow + + sinebow \ No newline at end of file diff --git a/test/output/countryCentroids.svg b/test/output/countryCentroids.svg index f1df39ff01..06d2c1cc95 100644 --- a/test/output/countryCentroids.svg +++ b/test/output/countryCentroids.svg @@ -198,7 +198,357 @@ - 242834732124840398860598360032152180706404729148332214643044238578304260626710426484858076068604170591188558340222320084862328740250218630388192716072516686466478204562566120768288384324624430694854140178266226894454508748024108376422450275270788012400784634414368512548116764418104704408410496356050064524586004762417795364760051752112804616040348498642440428233276100300792008191756442056528620724372540090554036144156158380208826352031268608458096705246703203232392600887682010196504818434231262800646070807688499780728 - 242834732124840398860598360032152180706404729148332214643044238578304260626710426484858076068604170591188558340222320084862328740250218630388192716072516686466478204562566120768288384324624430694854140178266226894454508748024108376422450275270788012400784634414368512548116764418104704408410496356050064524586004762417795364760051752112804616040348498642440428233276100300792008191756442056528620724372540090554036144156158380208826352031268608458096705246703203232392600887682010196504818434231262800646070807688499780728 + + 242 + 834 + 732 + 124 + 840 + 398 + 860 + 598 + 360 + 032 + 152 + 180 + 706 + 404 + 729 + 148 + 332 + 214 + 643 + 044 + 238 + 578 + 304 + 260 + 626 + 710 + 426 + 484 + 858 + 076 + 068 + 604 + 170 + 591 + 188 + 558 + 340 + 222 + 320 + 084 + 862 + 328 + 740 + 250 + 218 + 630 + 388 + 192 + 716 + 072 + 516 + 686 + 466 + 478 + 204 + 562 + 566 + 120 + 768 + 288 + 384 + 324 + 624 + 430 + 694 + 854 + 140 + 178 + 266 + 226 + 894 + 454 + 508 + 748 + 024 + 108 + 376 + 422 + 450 + 275 + 270 + 788 + 012 + 400 + 784 + 634 + 414 + 368 + 512 + 548 + 116 + 764 + 418 + 104 + 704 + 408 + 410 + 496 + 356 + 050 + 064 + 524 + 586 + 004 + 762 + 417 + 795 + 364 + 760 + 051 + 752 + 112 + 804 + 616 + 040 + 348 + 498 + 642 + 440 + 428 + 233 + 276 + 100 + 300 + 792 + 008 + 191 + 756 + 442 + 056 + 528 + 620 + 724 + 372 + 540 + 090 + 554 + 036 + 144 + 156 + 158 + 380 + 208 + 826 + 352 + 031 + 268 + 608 + 458 + 096 + 705 + 246 + 703 + 203 + 232 + 392 + 600 + 887 + 682 + 010 + 196 + 504 + 818 + 434 + 231 + 262 + 800 + 646 + 070 + 807 + 688 + 499 + 780 + 728 + + + 242 + 834 + 732 + 124 + 840 + 398 + 860 + 598 + 360 + 032 + 152 + 180 + 706 + 404 + 729 + 148 + 332 + 214 + 643 + 044 + 238 + 578 + 304 + 260 + 626 + 710 + 426 + 484 + 858 + 076 + 068 + 604 + 170 + 591 + 188 + 558 + 340 + 222 + 320 + 084 + 862 + 328 + 740 + 250 + 218 + 630 + 388 + 192 + 716 + 072 + 516 + 686 + 466 + 478 + 204 + 562 + 566 + 120 + 768 + 288 + 384 + 324 + 624 + 430 + 694 + 854 + 140 + 178 + 266 + 226 + 894 + 454 + 508 + 748 + 024 + 108 + 376 + 422 + 450 + 275 + 270 + 788 + 012 + 400 + 784 + 634 + 414 + 368 + 512 + 548 + 116 + 764 + 418 + 104 + 704 + 408 + 410 + 496 + 356 + 050 + 064 + 524 + 586 + 004 + 762 + 417 + 795 + 364 + 760 + 051 + 752 + 112 + 804 + 616 + 040 + 348 + 498 + 642 + 440 + 428 + 233 + 276 + 100 + 300 + 792 + 008 + 191 + 756 + 442 + 056 + 528 + 620 + 724 + 372 + 540 + 090 + 554 + 036 + 144 + 156 + 158 + 380 + 208 + 826 + 352 + 031 + 268 + 608 + 458 + 096 + 705 + 246 + 703 + 203 + 232 + 392 + 600 + 887 + 682 + 010 + 196 + 504 + 818 + 434 + 231 + 262 + 800 + 646 + 070 + 807 + 688 + 499 + 780 + 728 + \ No newline at end of file diff --git a/test/output/covidIhmeProjectedDeaths.svg b/test/output/covidIhmeProjectedDeaths.svg index 78c6ae43d4..f2c9c78991 100644 --- a/test/output/covidIhmeProjectedDeaths.svg +++ b/test/output/covidIhmeProjectedDeaths.svg @@ -13,231 +13,187 @@ white-space: pre; } - - - - 1 - - - - 2 - - - - 3 - - - - 4 - - - - 5 - - - - - - - - - - - - - - - - - - - - 10 - - - - 20 - - - - 30 - - - - 40 - - - - 50 - - - - - - - - - - - - - - - - - - - - 100 - - - - 200 - - - - 300 - - - - 400 - - - - 500 - - - - - - - - - - - - - - - - - - - - 1,000 - - - - 2,000 - - - - 3,000 - - - - 4,000 - ↑ Deaths per day to COVID-19 (projected) + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - March - - - - Mar 08 - - - - Mar 15 - - - - Mar 22 - - - - Mar 29 - - - - Apr 05 - - - - Apr 12 - - - - Apr 19 - - - - Apr 26 - - - - May 03 - - - - May 10 - - - - May 17 - - - - May 24 - - - - May 31 - - - - Jun 07 - - - - Jun 14 - - - - Jun 21 - - - - Jun 28 - - - - Jul 05 - - - - Jul 12 - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 1 + 2 + 3 + 4 + 5 + + + + + 10 + 20 + 30 + 40 + 50 + + + + + 100 + 200 + 300 + 400 + 500 + + + + + 1,000 + 2,000 + 3,000 + 4,000 + + + ↑ Deaths per day to COVID-19 (projected) + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 01March + 08 + 15 + 22 + 29 + 05April + 12 + 19 + 26 + 03May + 10 + 17 + 24 + 31 + 07June + 14 + 21 + 28 + 05July + 12 - - cone of uncertainty - + cone of uncertainty - - actual data - + actual data - - projected values - + projected values - 900 + + 900 + \ No newline at end of file diff --git a/test/output/crimeanWarArrow.svg b/test/output/crimeanWarArrow.svg index 11e9bea238..6cbdd9b0e8 100644 --- a/test/output/crimeanWarArrow.svg +++ b/test/output/crimeanWarArrow.svg @@ -13,75 +13,60 @@ white-space: pre; } - - - 0 - - - 200 - - - 400 - - - 600 - - - 800 - - - 1,000 - - - 1,200 - - - 1,400 - - - 1,600 - - - 1,800 - - - 2,000 - - - 2,200 - - - 2,400 - - - 2,600 - ↑ deaths + + + + + + + + + + + + + + + - - - Apr - - - Jul - - - Oct - - - Jan - - - Apr - - - Jul - - - Oct - - - Jan - + + 0 + 200 + 400 + 600 + 800 + 1,000 + 1,200 + 1,400 + 1,600 + 1,800 + 2,000 + 2,200 + 2,400 + 2,600 + + + ↑ deaths + + + + + + + + + + + + + Apr + Jul + Oct + Jan + Apr + Jul + Oct + Jan diff --git a/test/output/crimeanWarLine.svg b/test/output/crimeanWarLine.svg index b900cc2715..8a4581d3f4 100644 --- a/test/output/crimeanWarLine.svg +++ b/test/output/crimeanWarLine.svg @@ -13,75 +13,60 @@ white-space: pre; } - - - 0 - - - 200 - - - 400 - - - 600 - - - 800 - - - 1,000 - - - 1,200 - - - 1,400 - - - 1,600 - - - 1,800 - - - 2,000 - - - 2,200 - - - 2,400 - - - 2,600 - ↑ deaths + + + + + + + + + + + + + + + - - - Apr - - - Jul - - - Oct - - - Jan - - - Apr - - - Jul - - - Oct - - - Jan - + + 0 + 200 + 400 + 600 + 800 + 1,000 + 1,200 + 1,400 + 1,600 + 1,800 + 2,000 + 2,200 + 2,400 + 2,600 + + + ↑ deaths + + + + + + + + + + + + + Apr + Jul + Oct + Jan + Apr + Jul + Oct + Jan diff --git a/test/output/crimeanWarOverlapped.svg b/test/output/crimeanWarOverlapped.svg index 9682bdff9b..c8ce87e509 100644 --- a/test/output/crimeanWarOverlapped.svg +++ b/test/output/crimeanWarOverlapped.svg @@ -13,78 +13,62 @@ white-space: pre; } - - - 0 - - - 200 - - - 400 - - - 600 - - - 800 - - - 1,000 - - - 1,200 - - - 1,400 - - - 1,600 - - - 1,800 - - - 2,000 - - - 2,200 - - - 2,400 - - - 2,600 - ↑ deaths + + + + + + + + + + + + + + + - - - Apr - - - Jul - - - Oct - - - Jan - - - Apr - - - Jul - - - Oct - - - Jan - - - Apr - + + 0 + 200 + 400 + 600 + 800 + 1,000 + 1,200 + 1,400 + 1,600 + 1,800 + 2,000 + 2,200 + 2,400 + 2,600 + + + ↑ deaths + + + + + + + + + + + + + + Apr + Jul + Oct + Jan + Apr + Jul + Oct + Jan + Apr diff --git a/test/output/crimeanWarStacked.svg b/test/output/crimeanWarStacked.svg index 7a80e10444..7ac0a49b7c 100644 --- a/test/output/crimeanWarStacked.svg +++ b/test/output/crimeanWarStacked.svg @@ -13,57 +13,48 @@ white-space: pre; } - - - 0 - - - 500 - - - 1,000 - - - 1,500 - - - 2,000 - - - 2,500 - - - 3,000 - ↑ deaths + + + + + + + + - - - Apr - - - Jul - - - Oct - - - Jan - - - Apr - - - Jul - - - Oct - - - Jan - - - Apr - + + 0 + 500 + 1,000 + 1,500 + 2,000 + 2,500 + 3,000 + + + ↑ deaths + + + + + + + + + + + + + + Apr + Jul + Oct + Jan + Apr + Jul + Oct + Jan + Apr diff --git a/test/output/d3Survey2015Comfort.svg b/test/output/d3Survey2015Comfort.svg index 1e97097915..00de2f47c7 100644 --- a/test/output/d3Survey2015Comfort.svg +++ b/test/output/d3Survey2015Comfort.svg @@ -13,68 +13,64 @@ white-space: pre; } - - - I looked at some examples! - - - I've forked a bl.ock or two - - - selectAll(".answers").enter() - - - Someone told me I should learn it... - - - - How comfortable are you with d3 now? + + + + + + - - - - 0 - - - - 10 - - - - 20 - - - - 30 - - - - 40 - - - - 50 - - - - 60 - - - - 70 - - - - 80 - - - - 90 - - - - 100 - Frequency (%) → + + I looked at some examples! + I've forked a bl.ock or two + selectAll(".answers").enter() + Someone told me I should learn it... + + + + How comfortable are you with d3 now? + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 0 + 10 + 20 + 30 + 40 + 50 + 60 + 70 + 80 + 90 + 100 + + + Frequency (%) → diff --git a/test/output/d3Survey2015Why.svg b/test/output/d3Survey2015Why.svg index 4df5938c81..59adba0ba4 100644 --- a/test/output/d3Survey2015Why.svg +++ b/test/output/d3Survey2015Why.svg @@ -13,98 +13,84 @@ white-space: pre; } - - - For work - - - For fun - - - To express myself - - - To get a job - - - For school - - - - - - I think digital interactive systems tha explain complex systems visually are the future - - - Tableau to D3 - - - for my own projects - - - improve as a product designer - - - to address visual learners - - - to do vis on the web - - - to give back to the dataviz community - - - to understand data better - - - to work with open data - Why do you want to learn d3? + + + + + + + + + + + + + + + + - - - - 0 - - - - 10 - - - - 20 - - - - 30 - - - - 40 - - - - 50 - - - - 60 - - - - 70 - - - - 80 - - - - 90 - - - - 100 - Frequency (%) → + + For work + For fun + To express myself + To get a job + For school + + I think digital interactive systems tha explain complex systems visually are the future + Tableau to D3 + for my own projects + improve as a product designer + to address visual learners + to do vis on the web + to give back to the dataviz community + to understand data better + to work with open data + + + Why do you want to learn d3? + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 0 + 10 + 20 + 30 + 40 + 50 + 60 + 70 + 80 + 90 + 100 + + + Frequency (%) → diff --git a/test/output/darkerDodge.svg b/test/output/darkerDodge.svg index 038b00e89c..885cbdf99f 100644 --- a/test/output/darkerDodge.svg +++ b/test/output/darkerDodge.svg @@ -13,37 +13,29 @@ white-space: pre; } - - - 0 - - - 1 - - - 2 - - - 3 - - - 4 - - - 5 - - - 6 - - - 7 - - - 8 - - - 9 - + + + + + + + + + + + + + + 0 + 1 + 2 + 3 + 4 + 5 + 6 + 7 + 8 + 9 diff --git a/test/output/decathlon.html b/test/output/decathlon.html index 4275a6ed53..6568116ab6 100644 --- a/test/output/decathlon.html +++ b/test/output/decathlon.html @@ -65,65 +65,65 @@ white-space: pre; } - - - - 10.3 - - - - 10.4 - - - - 10.5 - - - - 10.6 - - - - 10.7 - - - - 10.8 - - - - 10.9 - - - - 11.0 - - - - 11.1 - ↑ 100 Meters + + + + + + + + + + - - - - 7.2 - - - - 7.4 - - - - 7.6 - - - - 7.8 - - - - 8.0 - Long Jump → + + + + + + + + + + + + + 10.3 + 10.4 + 10.5 + 10.6 + 10.7 + 10.8 + 10.9 + 11.0 + 11.1 + + + ↑ 100 Meters + + + + + + + + + + + + + + + + + 7.2 + 7.4 + 7.6 + 7.8 + 8.0 + + + Long Jump → diff --git a/test/output/diamondsBoxplot.svg b/test/output/diamondsBoxplot.svg index 173903773c..7025dcbc99 100644 --- a/test/output/diamondsBoxplot.svg +++ b/test/output/diamondsBoxplot.svg @@ -13,60 +13,53 @@ white-space: pre; } - - - IF - - - VVS1 - - - VVS2 - - - VS1 - - - VS2 - - - SI1 - - - I1 - - - SI2 - clarity + + + + + + + + + - - - 2,000 - - - 4,000 - - - 6,000 - - - 8,000 - - - 10,000 - - - 12,000 - - - 14,000 - - - 16,000 - - - 18,000 - price → + + IF + VVS1 + VVS2 + VS1 + VS2 + SI1 + I1 + SI2 + + + clarity + + + + + + + + + + + + + + 2,000 + 4,000 + 6,000 + 8,000 + 10,000 + 12,000 + 14,000 + 16,000 + 18,000 + + + price → diff --git a/test/output/diamondsCaratPrice.svg b/test/output/diamondsCaratPrice.svg index 66c767f330..174e882d5c 100644 --- a/test/output/diamondsCaratPrice.svg +++ b/test/output/diamondsCaratPrice.svg @@ -13,96 +13,77 @@ white-space: pre; } - - - 1,000 - - - 2,000 - - - 3,000 - - - 4,000 - - - 5,000 - - - 6,000 - - - 7,000 - - - 8,000 - - - 9,000 - - - 10,000 - - - 11,000 - - - 12,000 - - - 13,000 - - - 14,000 - - - 15,000 - - - 16,000 - - - 17,000 - - - 18,000 - - - 19,000 - ↑ price + + + + + + + + + + + + + + + + + + + + - - - 0.5 - - - 1.0 - - - 1.5 - - - 2.0 - - - 2.5 - - - 3.0 - - - 3.5 - - - 4.0 - - - 4.5 - - - 5.0 - carat → + + 1,000 + 2,000 + 3,000 + 4,000 + 5,000 + 6,000 + 7,000 + 8,000 + 9,000 + 10,000 + 11,000 + 12,000 + 13,000 + 14,000 + 15,000 + 16,000 + 17,000 + 18,000 + 19,000 + + + ↑ price + + + + + + + + + + + + + + + 0.5 + 1.0 + 1.5 + 2.0 + 2.5 + 3.0 + 3.5 + 4.0 + 4.5 + 5.0 + + + carat → diff --git a/test/output/diamondsCaratPriceDots.svg b/test/output/diamondsCaratPriceDots.svg index 9c289ce6f9..a047134980 100644 --- a/test/output/diamondsCaratPriceDots.svg +++ b/test/output/diamondsCaratPriceDots.svg @@ -13,121 +13,107 @@ white-space: pre; } - - - - 1,000 - - - - 2,000 - - - - 3,000 - - - - 4,000 - - - - 5,000 - - - - 6,000 - - - - 7,000 - - - - 8,000 - - - - 9,000 - - - - 10,000 - - - - 11,000 - - - - 12,000 - - - - 13,000 - - - - 14,000 - - - - 15,000 - - - - 16,000 - - - - 17,000 - - - - 18,000 - ↑ Price ($) + + + + + + + + + + + + + + + + + + + - - - - 0.5 - - - - 1.0 - - - - 1.5 - - - - 2.0 - - - - 2.5 - - - - 3.0 - - - - 3.5 - - - - 4.0 - - - - 4.5 - - - - 5.0 - Carats → + + + + + + + + + + + + + + + + + + + + + + 1,000 + 2,000 + 3,000 + 4,000 + 5,000 + 6,000 + 7,000 + 8,000 + 9,000 + 10,000 + 11,000 + 12,000 + 13,000 + 14,000 + 15,000 + 16,000 + 17,000 + 18,000 + + + ↑ Price ($) + + + + + + + + + + + + + + + + + + + + + + + + + + + 0.5 + 1.0 + 1.5 + 2.0 + 2.5 + 3.0 + 3.5 + 4.0 + 4.5 + 5.0 + + + Carats → diff --git a/test/output/diamondsCaratSampling.svg b/test/output/diamondsCaratSampling.svg index 682c8246a4..454163d940 100644 --- a/test/output/diamondsCaratSampling.svg +++ b/test/output/diamondsCaratSampling.svg @@ -13,66 +13,57 @@ white-space: pre; } - - - 2,000 - - - 4,000 - - - 6,000 - - - 8,000 - - - 10,000 - - - 12,000 - - - 14,000 - - - 16,000 - - - 18,000 - ↑ price + + + + + + + + + + - - - 0.5 - - - 1.0 - - - 1.5 - - - 2.0 - - - 2.5 - - - 3.0 - - - 3.5 - - - 4.0 - - - 4.5 - - - 5.0 - carat → + + 2,000 + 4,000 + 6,000 + 8,000 + 10,000 + 12,000 + 14,000 + 16,000 + 18,000 + + + ↑ price + + + + + + + + + + + + + + + 0.5 + 1.0 + 1.5 + 2.0 + 2.5 + 3.0 + 3.5 + 4.0 + 4.5 + 5.0 + + + carat → diff --git a/test/output/documentationLinks.svg b/test/output/documentationLinks.svg index 558a76c4b7..1bf81d1de9 100644 --- a/test/output/documentationLinks.svg +++ b/test/output/documentationLinks.svg @@ -13,120 +13,95 @@ white-space: pre; } - - - Observable Plot - - - Marks - - - Scales - - - Transforms - - - Facets - - - Area Mark - - - Bar Mark - - - Cell Mark - - - Dot Mark - - - Image Mark - - - Line Mark - - - Link Mark - - - Rect Mark - - - Rule Mark - - - Text Mark - - - Tick Mark - - - Frame Mark - - - Group Transform - - - Bin Transform - - - Stack Transform - - - Map Transform - - - Window Transform - - - Select Transform - - - Interval Transform - - - Legends - + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - 0 - - - - 5 - - - - 10 - - - - 15 - - - - 20 - - - - 25 - - - - 30 - - - - 35 - - - - 40 - likes → + + Observable Plot + Marks + Scales + Transforms + Facets + Area Mark + Bar Mark + Cell Mark + Dot Mark + Image Mark + Line Mark + Link Mark + Rect Mark + Rule Mark + Text Mark + Tick Mark + Frame Mark + Group Transform + Bin Transform + Stack Transform + Map Transform + Window Transform + Select Transform + Interval Transform + Legends + + + + + + + + + + + + + + + + + + + + + + + + + 0 + 5 + 10 + 15 + 20 + 25 + 30 + 35 + 40 + + + likes → @@ -179,7 +154,33 @@ - ⚡︎ 296 16 18 6 10 3 9 17 5 11 8 2 2 4 5 1 3 7 12 13 6 3 6 7 18 + + ⚡︎ 296 + 16 + 18 + 6 + 10 + 3 + 9 + 17 + 5 + 11 + 8 + 2 + 2 + 4 + 5 + 1 + 3 + 7 + 12 + 13 + 6 + 3 + 6 + 7 + 18 + diff --git a/test/output/dodgeRule.svg b/test/output/dodgeRule.svg index b9b7312edf..65a2e3c45a 100644 --- a/test/output/dodgeRule.svg +++ b/test/output/dodgeRule.svg @@ -13,40 +13,31 @@ white-space: pre; } - - - 1.0 - - - 1.2 - - - 1.4 - - - 1.6 - - - 1.8 - - - 2.0 - - - 2.2 - - - 2.4 - - - 2.6 - - - 2.8 - - - 3.0 - + + + + + + + + + + + + + + + 1.0 + 1.2 + 1.4 + 1.6 + 1.8 + 2.0 + 2.2 + 2.4 + 2.6 + 2.8 + 3.0 diff --git a/test/output/dodgeTextRadius.svg b/test/output/dodgeTextRadius.svg index 71edb18966..f23baabca7 100644 --- a/test/output/dodgeTextRadius.svg +++ b/test/output/dodgeTextRadius.svg @@ -13,40 +13,31 @@ white-space: pre; } - - - 0.0 - - - 0.1 - - - 0.2 - - - 0.3 - - - 0.4 - - - 0.5 - - - 0.6 - - - 0.7 - - - 0.8 - - - 0.9 - - - 1.0 - + + + + + + + + + + + + + + + 0.0 + 0.1 + 0.2 + 0.3 + 0.4 + 0.5 + 0.6 + 0.7 + 0.8 + 0.9 + 1.0 @@ -150,5 +141,106 @@ - 5859328342312468212623893559053234614193665654503315873784479210466064178514759444712572368191166329576513011248406982207481911867099395354508088957792813496522971849677789876623843527327679 + + 58 + 59 + 32 + 83 + 42 + 31 + 24 + 68 + 21 + 26 + 23 + 89 + 3 + 55 + 90 + 53 + 2 + 34 + 61 + 41 + 93 + 66 + 56 + 54 + 50 + 33 + 15 + 87 + 37 + 84 + 47 + 92 + 10 + 46 + 60 + 64 + 17 + 85 + 14 + 75 + 94 + 44 + 71 + 25 + 72 + 36 + 81 + 91 + 16 + 63 + 29 + 57 + 6 + 51 + 30 + 1 + 12 + 48 + 40 + 69 + 82 + 20 + 74 + 8 + 19 + 11 + 86 + 70 + 99 + 39 + 5 + 35 + 45 + 0 + 80 + 88 + 95 + 7 + 79 + 28 + 13 + 49 + 65 + 22 + 97 + 18 + 4 + 96 + 77 + 78 + 98 + 76 + 62 + 38 + 43 + 52 + 73 + 27 + 67 + 9 + \ No newline at end of file diff --git a/test/output/dodgeTick.svg b/test/output/dodgeTick.svg index 12776e661f..01b69b07f7 100644 --- a/test/output/dodgeTick.svg +++ b/test/output/dodgeTick.svg @@ -13,40 +13,31 @@ white-space: pre; } - - - 1.0 - - - 1.2 - - - 1.4 - - - 1.6 - - - 1.8 - - - 2.0 - - - 2.2 - - - 2.4 - - - 2.6 - - - 2.8 - - - 3.0 - + + + + + + + + + + + + + + + 1.0 + 1.2 + 1.4 + 1.6 + 1.8 + 2.0 + 2.2 + 2.4 + 2.6 + 2.8 + 3.0 diff --git a/test/output/downloads.svg b/test/output/downloads.svg index a69355d6d9..0a1d547c3c 100644 --- a/test/output/downloads.svg +++ b/test/output/downloads.svg @@ -13,63 +13,52 @@ white-space: pre; } - - - 0 - - - 2 - - - 4 - - - 6 - - - 8 - - - 10 - - - 12 - - - 14 - - - 16 - - - 18 - - - 20 - - - 22 - - - 24 - ↑ downloads + + + + + + + + + + + + + + - - - 2018 - - - 2019 - - - 2020 - - - 2021 - - - 2022 - + + 0 + 2 + 4 + 6 + 8 + 10 + 12 + 14 + 16 + 18 + 20 + 22 + 24 + + + ↑ downloads + + + + + + + + + + 2018 + 2019 + 2020 + 2021 + 2022 diff --git a/test/output/downloadsOrdinal.svg b/test/output/downloadsOrdinal.svg index c9be7271f4..a4a5b232b7 100644 --- a/test/output/downloadsOrdinal.svg +++ b/test/output/downloadsOrdinal.svg @@ -13,183 +13,135 @@ white-space: pre; } - - - 0 - - - 2 - - - 4 - - - 6 - - - 8 - - - 10 - - - 12 - - - 14 - - - 16 - - - 18 - - - 20 - - - 22 - ↑ downloads + + + + + + + + + + + + + - - - Jan 01 - - - Jan 02 - - - Jan 03 - - - Jan 04 - - - Jan 05 - - - Jan 06 - - - Jan 07 - - - Jan 08 - - - Jan 09 - - - Jan 10 - - - Jan 11 - - - Jan 12 - - - Jan 13 - - - Jan 14 - - - Jan 15 - - - Jan 16 - - - Jan 17 - - - Jan 18 - - - Jan 19 - - - Jan 20 - - - Jan 21 - - - Jan 22 - - - Jan 23 - - - Jan 24 - - - Jan 25 - - - Jan 26 - - - Jan 27 - - - Jan 28 - - - Jan 29 - - - Jan 30 - - - Jan 31 - - - Feb 01 - - - Feb 02 - - - Feb 03 - - - Feb 04 - - - Feb 05 - - - Feb 06 - - - Feb 07 - - - Feb 08 - - - Feb 09 - - - Feb 10 - - - Feb 11 - - - Feb 12 - - - Feb 13 - - - Feb 14 - - - Feb 15 - date + + 0 + 2 + 4 + 6 + 8 + 10 + 12 + 14 + 16 + 18 + 20 + 22 + + + ↑ downloads + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Jan 01 + Jan 02 + Jan 03 + Jan 04 + Jan 05 + Jan 06 + Jan 07 + Jan 08 + Jan 09 + Jan 10 + Jan 11 + Jan 12 + Jan 13 + Jan 14 + Jan 15 + Jan 16 + Jan 17 + Jan 18 + Jan 19 + Jan 20 + Jan 21 + Jan 22 + Jan 23 + Jan 24 + Jan 25 + Jan 26 + Jan 27 + Jan 28 + Jan 29 + Jan 30 + Jan 31 + Feb 01 + Feb 02 + Feb 03 + Feb 04 + Feb 05 + Feb 06 + Feb 07 + Feb 08 + Feb 09 + Feb 10 + Feb 11 + Feb 12 + Feb 13 + Feb 14 + Feb 15 + + + date diff --git a/test/output/driving.svg b/test/output/driving.svg index 4b5800cf68..eacb3ff226 100644 --- a/test/output/driving.svg +++ b/test/output/driving.svg @@ -13,77 +13,74 @@ white-space: pre; } - - - - 1.4 - - - - 1.6 - - - - 1.8 - - - - 2.0 - - - - 2.2 - - - - 2.4 - - - - 2.6 - - - - 2.8 - - - - 3.0 - - - - 3.2 - ↑ Cost of gasoline ($ per gallon) + + + + + + + + + + + - - - - 4,000 - - - - 5,000 - - - - 6,000 - - - - 7,000 - - - - 8,000 - - - - 9,000 - - - - 10,000 - Miles driven (per person-year) → + + + + + + + + + + + + + + 1.4 + 1.6 + 1.8 + 2.0 + 2.2 + 2.4 + 2.6 + 2.8 + 3.0 + 3.2 + + + ↑ Cost of gasoline ($ per gallon) + + + + + + + + + + + + + + + + + + + + + 4,000 + 5,000 + 6,000 + 7,000 + 8,000 + 9,000 + 10,000 + + + Miles driven (per person-year) → @@ -91,5 +88,17 @@ - 19601965197019751980198519901995200020052010 + + 1960 + 1965 + 1970 + 1975 + 1980 + 1985 + 1990 + 1995 + 2000 + 2005 + 2010 + \ No newline at end of file diff --git a/test/output/electricityDemand.svg b/test/output/electricityDemand.svg new file mode 100644 index 0000000000..7c9ace6b68 --- /dev/null +++ b/test/output/electricityDemand.svg @@ -0,0 +1,10119 @@ + + + + + + + + + + + + + + + + + 0 + 5,000 + 10,000 + 15,000 + 20,000 + 25,000 + 30,000 + 35,000 + 40,000 + 45,000 + 50,000 + + + ↑ mwh + + + + + + + + + + + 2021 + 2022 + + + + + + + + + + + + + + + + + + + December + January + February + March + April + May + June + July + August + September + October + November + December + January + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + \ No newline at end of file diff --git a/test/output/empty.svg b/test/output/empty.svg index bcc24254f7..07ddee3cd3 100644 --- a/test/output/empty.svg +++ b/test/output/empty.svg @@ -13,97 +13,83 @@ white-space: pre; } - - - - 0.0 - - - - 0.1 - - - - 0.2 - - - - 0.3 - - - - 0.4 - - - - 0.5 - - - - 0.6 - - - - 0.7 - - - - 0.8 - - - - 0.9 - - - - 1.0 - + + + + + + + + + + + + - - - - 0.0 - - - - 0.1 - - - - 0.2 - - - - 0.3 - - - - 0.4 - - - - 0.5 - - - - 0.6 - - - - 0.7 - - - - 0.8 - - - - 0.9 - - - - 1.0 - + + + + + + + + + + + + + + + 0.0 + 0.1 + 0.2 + 0.3 + 0.4 + 0.5 + 0.6 + 0.7 + 0.8 + 0.9 + 1.0 + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 0.0 + 0.1 + 0.2 + 0.3 + 0.4 + 0.5 + 0.6 + 0.7 + 0.8 + 0.9 + 1.0 diff --git a/test/output/emptyFacet.svg b/test/output/emptyFacet.svg index d9835cf3a8..04215f8a30 100644 --- a/test/output/emptyFacet.svg +++ b/test/output/emptyFacet.svg @@ -13,35 +13,45 @@ white-space: pre; } - - - 0 - VALUE - - - - a + + + a - - b - TYPE - - - - 1 + + + + + 0 - - 2 + + + + + + 1 + 2 - - - 1 + + + b + + + + - - 2 - PERIOD + + 1 + 2 + + + + TYPE + + + VALUE + + + PERIOD - - \ No newline at end of file diff --git a/test/output/energyProduction.html b/test/output/energyProduction.html index 4f30d61798..219f9e0855 100644 --- a/test/output/energyProduction.html +++ b/test/output/energyProduction.html @@ -51,66 +51,54 @@ white-space: pre; } - - - 0 - - - 10 - - - 20 - - - 30 - - - 40 - - - 50 - - - 60 - - - 70 - - - 80 - - - 90 - - - 100 - ↑ Annual production (quads) + + + + + + + + + + + + - - - 1950 - - - 1960 - - - 1970 - - - 1980 - - - 1990 - - - 2000 - - - 2010 - - - 2020 - + + 0 + 10 + 20 + 30 + 40 + 50 + 60 + 70 + 80 + 90 + 100 + + + ↑ Annual production (quads) + + + + + + + + + + + + + 1950 + 1960 + 1970 + 1980 + 1990 + 2000 + 2010 + 2020 diff --git a/test/output/faithfulDensity.svg b/test/output/faithfulDensity.svg index af790ae82a..642a6149b9 100644 --- a/test/output/faithfulDensity.svg +++ b/test/output/faithfulDensity.svg @@ -13,45 +13,43 @@ white-space: pre; } - - - 2.0 - - - 2.5 - - - 3.0 - - - 3.5 - - - 4.0 - - - 4.5 - - - 5.0 - ↑ eruptions + + + + + + + + - - - 50 - - - 60 - - - 70 - - - 80 - - - 90 - waiting → + + 2.0 + 2.5 + 3.0 + 3.5 + 4.0 + 4.5 + 5.0 + + + ↑ eruptions + + + + + + + + + + 50 + 60 + 70 + 80 + 90 + + + waiting → diff --git a/test/output/faithfulDensity1d.svg b/test/output/faithfulDensity1d.svg index 49092e3524..8b586df10c 100644 --- a/test/output/faithfulDensity1d.svg +++ b/test/output/faithfulDensity1d.svg @@ -13,22 +13,22 @@ white-space: pre; } - - - 50 - - - 60 - - - 70 - - - 80 - - - 90 - waiting → + + + + + + + + + 50 + 60 + 70 + 80 + 90 + + + waiting → diff --git a/test/output/federalFunds.svg b/test/output/federalFunds.svg new file mode 100644 index 0000000000..d3e5c06821 --- /dev/null +++ b/test/output/federalFunds.svg @@ -0,0 +1,64 @@ + + + + + + + + + + + + + + 1985 + 1990 + 1995 + 2000 + 2005 + 2010 + 2015 + 2020 + + + 0 + 2 + 4 + 6 + 8 + 10% + + + ↑ Federal funds rate (% per year) + + + + + + + + + + + + + + + + + + + \ No newline at end of file diff --git a/test/output/figcaption.html b/test/output/figcaption.html index 65a6465ff8..9e6f16c36c 100644 --- a/test/output/figcaption.html +++ b/test/output/figcaption.html @@ -13,139 +13,109 @@ white-space: pre; } - - - - 0 - - - - 1 - - - - 2 - - - - 3 - - - - 4 - - - - 5 - - - - 6 - - - - 7 - - - - 8 - - - - 9 - - - - 10 - - - - 11 - - - - 12 - ↑ Frequency (%) + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 0 + 1 + 2 + 3 + 4 + 5 + 6 + 7 + 8 + 9 + 10 + 11 + 12 + + + ↑ Frequency (%) + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - A - - - B - - - C - - - D - - - E - - - F - - - G - - - H - - - I - - - J - - - K - - - L - - - M - - - N - - - O - - - P - - - Q - - - R - - - S - - - T - - - U - - - V - - - W - - - X - - - Y - - - Z - + + A + B + C + D + E + F + G + H + I + J + K + L + M + N + O + P + Q + R + S + T + U + V + W + X + Y + Z diff --git a/test/output/figcaptionHtml.html b/test/output/figcaptionHtml.html index 3b65399b21..8ad1bd9022 100644 --- a/test/output/figcaptionHtml.html +++ b/test/output/figcaptionHtml.html @@ -13,139 +13,109 @@ white-space: pre; } - - - - 0 - - - - 1 - - - - 2 - - - - 3 - - - - 4 - - - - 5 - - - - 6 - - - - 7 - - - - 8 - - - - 9 - - - - 10 - - - - 11 - - - - 12 - ↑ Frequency (%) + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 0 + 1 + 2 + 3 + 4 + 5 + 6 + 7 + 8 + 9 + 10 + 11 + 12 + + + ↑ Frequency (%) + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - A - - - B - - - C - - - D - - - E - - - F - - - G - - - H - - - I - - - J - - - K - - - L - - - M - - - N - - - O - - - P - - - Q - - - R - - - S - - - T - - - U - - - V - - - W - - - X - - - Y - - - Z - + + A + B + C + D + E + F + G + H + I + J + K + L + M + N + O + P + Q + R + S + T + U + V + W + X + Y + Z diff --git a/test/output/firstLadies.svg b/test/output/firstLadies.svg index 8ae1146835..6b7622d144 100644 --- a/test/output/firstLadies.svg +++ b/test/output/firstLadies.svg @@ -13,52 +13,39 @@ white-space: pre; } - - - 1740 - - - 1760 - - - 1780 - - - 1800 - - - 1820 - - - 1840 - - - 1860 - - - 1880 - - - 1900 - - - 1920 - - - 1940 - - - 1960 - - - 1980 - - - 2000 - - - 2020 - + + + + + + + + + + + + + + + + + + + 1740 + 1760 + 1780 + 1800 + 1820 + 1840 + 1860 + 1880 + 1900 + 1920 + 1940 + 1960 + 1980 + 2000 + 2020 @@ -172,5 +159,60 @@ - Martha WashingtonAbigail AdamsMartha JeffersonDolly MadisonElizabeth MonroeLouisa AdamsEmily DonelsonSarah JacksonSarah Van BurenAnna HarrisonJane HarrisonLetitia TylerElizabeth Priscilla TylerJulia TylerSarah PolkMargaret "Peggy" TaylorAbigail FillmoreJane PierceHarriet LaneMary LincolnEliza JohnsonJulia GrantLucy HayesLucretia GarfieldMary McElroyRose ClevelandFrances ClevelandCaroline HarrisonMary Harrison McKeeFrances ClevelandIda McKinleyEdith RooseveltHelen "Nellie" TaftEllen WilsonMargaret WilsonEdith WilsonFlorence HardingGrace CoolidgeLou HooverAnna Eleanor RooseveltElizabeth "Bess" TrumanMamie EisenhowerJacqueline "Jackie" KennedyClaudia "Lady Bird" JohnsonThelma "Pat" NixonElizabeth "Betty" FordEleanor Rosalynn CarterNancy ReaganBarbara BushHillary ClintonLaura BushMichelle ObamaMelania TrumpJill Biden + + Martha Washington + Abigail Adams + Martha Jefferson + Dolly Madison + Elizabeth Monroe + Louisa Adams + Emily Donelson + Sarah Jackson + Sarah Van Buren + Anna Harrison + Jane Harrison + Letitia Tyler + Elizabeth Priscilla Tyler + Julia Tyler + Sarah Polk + Margaret "Peggy" Taylor + Abigail Fillmore + Jane Pierce + Harriet Lane + Mary Lincoln + Eliza Johnson + Julia Grant + Lucy Hayes + Lucretia Garfield + Mary McElroy + Rose Cleveland + Frances Cleveland + Caroline Harrison + Mary Harrison McKee + Frances Cleveland + Ida McKinley + Edith Roosevelt + Helen "Nellie" Taft + Ellen Wilson + Margaret Wilson + Edith Wilson + Florence Harding + Grace Coolidge + Lou Hoover + Anna Eleanor Roosevelt + Elizabeth "Bess" Truman + Mamie Eisenhower + Jacqueline "Jackie" Kennedy + Claudia "Lady Bird" Johnson + Thelma "Pat" Nixon + Elizabeth "Betty" Ford + Eleanor Rosalynn Carter + Nancy Reagan + Barbara Bush + Hillary Clinton + Laura Bush + Michelle Obama + Melania Trump + Jill Biden + \ No newline at end of file diff --git a/test/output/flareCluster.svg b/test/output/flareCluster.svg index 9016f8252e..6e54354e41 100644 --- a/test/output/flareCluster.svg +++ b/test/output/flareCluster.svg @@ -267,762 +267,511 @@ - - /flare - - - /flare/analytics - - - /flare/animate - - - /flare/data - - - /flare/display - - - /flare/flex - - - /flare/physics - - - /flare/query - - - /flare/scale - - - /flare/util - - - /flare/vis - - - /flare/analytics/cluster - - - /flare/analytics/graph - - - /flare/analytics/optimization - - - /flare/animate/Easing - - - /flare/animate/FunctionSequence - - - /flare/animate/interpolate - - - /flare/animate/ISchedulable - - - /flare/animate/Parallel - - - /flare/animate/Pause - - - /flare/animate/Scheduler - - - /flare/animate/Sequence - - - /flare/animate/Transition - - - /flare/animate/Transitioner - - - /flare/animate/TransitionEvent - - - /flare/animate/Tween - - - /flare/data/converters - - - /flare/data/DataField - - - /flare/data/DataSchema - - - /flare/data/DataSet - - - /flare/data/DataSource - - - /flare/data/DataTable - - - /flare/data/DataUtil - - - /flare/display/DirtySprite - - - /flare/display/LineSprite - - - /flare/display/RectSprite - - - /flare/display/TextSprite - - - /flare/flex/FlareVis - - - /flare/physics/DragForce - - - /flare/physics/GravityForce - - - /flare/physics/IForce - - - /flare/physics/NBodyForce - - - /flare/physics/Particle - - - /flare/physics/Simulation - - - /flare/physics/Spring - - - /flare/physics/SpringForce - - - /flare/query/AggregateExpression - - - /flare/query/And - - - /flare/query/Arithmetic - - - /flare/query/Average - - - /flare/query/BinaryExpression - - - /flare/query/Comparison - - - /flare/query/CompositeExpression - - - /flare/query/Count - - - /flare/query/DateUtil - - - /flare/query/Distinct - - - /flare/query/Expression - - - /flare/query/ExpressionIterator - - - /flare/query/Fn - - - /flare/query/If - - - /flare/query/IsA - - - /flare/query/Literal - - - /flare/query/Match - - - /flare/query/Maximum - - - /flare/query/methods - - - /flare/query/Minimum - - - /flare/query/Not - - - /flare/query/Or - - - /flare/query/Query - - - /flare/query/Range - - - /flare/query/StringUtil - - - /flare/query/Sum - - - /flare/query/Variable - - - /flare/query/Variance - - - /flare/query/Xor - - - /flare/scale/IScaleMap - - - /flare/scale/LinearScale - - - /flare/scale/LogScale - - - /flare/scale/OrdinalScale - - - /flare/scale/QuantileScale - - - /flare/scale/QuantitativeScale - - - /flare/scale/RootScale - - - /flare/scale/Scale - - - /flare/scale/ScaleType - - - /flare/scale/TimeScale - - - /flare/util/Arrays - - - /flare/util/Colors - - - /flare/util/Dates - - - /flare/util/Displays - - - /flare/util/Filter - - - /flare/util/Geometry - - - /flare/util/heap - - - /flare/util/IEvaluable - - - /flare/util/IPredicate - - - /flare/util/IValueProxy - - - /flare/util/math - - - /flare/util/Maths - - - /flare/util/Orientation - - - /flare/util/palette - - - /flare/util/Property - - - /flare/util/Shapes - - - /flare/util/Sort - - - /flare/util/Stats - - - /flare/util/Strings - - - /flare/vis/axis - - - /flare/vis/controls - - - /flare/vis/data - - - /flare/vis/events - - - /flare/vis/legend - - - /flare/vis/operator - - - /flare/vis/Visualization - - - /flare/analytics/cluster/AgglomerativeCluster - - - /flare/analytics/cluster/CommunityStructure - - - /flare/analytics/cluster/HierarchicalCluster - - - /flare/analytics/cluster/MergeEdge - - - /flare/analytics/graph/BetweennessCentrality - - - /flare/analytics/graph/LinkDistance - - - /flare/analytics/graph/MaxFlowMinCut - - - /flare/analytics/graph/ShortestPaths - - - /flare/analytics/graph/SpanningTree - - - /flare/analytics/optimization/AspectRatioBanker - - - /flare/animate/interpolate/ArrayInterpolator - - - /flare/animate/interpolate/ColorInterpolator - - - /flare/animate/interpolate/DateInterpolator - - - /flare/animate/interpolate/Interpolator - - - /flare/animate/interpolate/MatrixInterpolator - - - /flare/animate/interpolate/NumberInterpolator - - - /flare/animate/interpolate/ObjectInterpolator - - - /flare/animate/interpolate/PointInterpolator - - - /flare/animate/interpolate/RectangleInterpolator - - - /flare/data/converters/Converters - - - /flare/data/converters/DelimitedTextConverter - - - /flare/data/converters/GraphMLConverter - - - /flare/data/converters/IDataConverter - - - /flare/data/converters/JSONConverter - - - /flare/query/methods/add - - - /flare/query/methods/and - - - /flare/query/methods/average - - - /flare/query/methods/count - - - /flare/query/methods/distinct - - - /flare/query/methods/div - - - /flare/query/methods/eq - - - /flare/query/methods/fn - - - /flare/query/methods/gt - - - /flare/query/methods/gte - - - /flare/query/methods/iff - - - /flare/query/methods/isa - - - /flare/query/methods/lt - - - /flare/query/methods/lte - - - /flare/query/methods/max - - - /flare/query/methods/min - - - /flare/query/methods/mod - - - /flare/query/methods/mul - - - /flare/query/methods/neq - - - /flare/query/methods/not - - - /flare/query/methods/or - - - /flare/query/methods/orderby - - - /flare/query/methods/range - - - /flare/query/methods/select - - - /flare/query/methods/stddev - - - /flare/query/methods/sub - - - /flare/query/methods/sum - - - /flare/query/methods/update - - - /flare/query/methods/variance - - - /flare/query/methods/where - - - /flare/query/methods/xor - - - /flare/query/methods/_ - - - /flare/util/heap/FibonacciHeap - - - /flare/util/heap/HeapNode - - - /flare/util/math/DenseMatrix - - - /flare/util/math/IMatrix - - - /flare/util/math/SparseMatrix - - - /flare/util/palette/ColorPalette - - - /flare/util/palette/Palette - - - /flare/util/palette/ShapePalette - - - /flare/util/palette/SizePalette - - - /flare/vis/axis/Axes - - - /flare/vis/axis/Axis - - - /flare/vis/axis/AxisGridLine - - - /flare/vis/axis/AxisLabel - - - /flare/vis/axis/CartesianAxes - - - /flare/vis/controls/AnchorControl - - - /flare/vis/controls/ClickControl - - - /flare/vis/controls/Control - - - /flare/vis/controls/ControlList - - - /flare/vis/controls/DragControl - - - /flare/vis/controls/ExpandControl - - - /flare/vis/controls/HoverControl - - - /flare/vis/controls/IControl - - - /flare/vis/controls/PanZoomControl - - - /flare/vis/controls/SelectionControl - - - /flare/vis/controls/TooltipControl - - - /flare/vis/data/Data - - - /flare/vis/data/DataList - - - /flare/vis/data/DataSprite - - - /flare/vis/data/EdgeSprite - - - /flare/vis/data/NodeSprite - - - /flare/vis/data/render - - - /flare/vis/data/ScaleBinding - - - /flare/vis/data/Tree - - - /flare/vis/data/TreeBuilder - - - /flare/vis/events/DataEvent - - - /flare/vis/events/SelectionEvent - - - /flare/vis/events/TooltipEvent - - - /flare/vis/events/VisualizationEvent - - - /flare/vis/legend/Legend - - - /flare/vis/legend/LegendItem - - - /flare/vis/legend/LegendRange - - - /flare/vis/operator/distortion - - - /flare/vis/operator/encoder - - - /flare/vis/operator/filter - - - /flare/vis/operator/IOperator - - - /flare/vis/operator/label - - - /flare/vis/operator/layout - - - /flare/vis/operator/Operator - - - /flare/vis/operator/OperatorList - - - /flare/vis/operator/OperatorSequence - - - /flare/vis/operator/OperatorSwitch - - - /flare/vis/operator/SortOperator - - - /flare/vis/data/render/ArrowType - - - /flare/vis/data/render/EdgeRenderer - - - /flare/vis/data/render/IRenderer - - - /flare/vis/data/render/ShapeRenderer - - - /flare/vis/operator/distortion/BifocalDistortion - - - /flare/vis/operator/distortion/Distortion - - - /flare/vis/operator/distortion/FisheyeDistortion - - - /flare/vis/operator/encoder/ColorEncoder - - - /flare/vis/operator/encoder/Encoder - - - /flare/vis/operator/encoder/PropertyEncoder - - - /flare/vis/operator/encoder/ShapeEncoder - - - /flare/vis/operator/encoder/SizeEncoder - - - /flare/vis/operator/filter/FisheyeTreeFilter - - - /flare/vis/operator/filter/GraphDistanceFilter - - - /flare/vis/operator/filter/VisibilityFilter - - - /flare/vis/operator/label/Labeler - - - /flare/vis/operator/label/RadialLabeler - - - /flare/vis/operator/label/StackedAreaLabeler - - - /flare/vis/operator/layout/AxisLayout - - - /flare/vis/operator/layout/BundledEdgeRouter - - - /flare/vis/operator/layout/CircleLayout - - - /flare/vis/operator/layout/CirclePackingLayout - - - /flare/vis/operator/layout/DendrogramLayout - - - /flare/vis/operator/layout/ForceDirectedLayout - - - /flare/vis/operator/layout/IcicleTreeLayout - - - /flare/vis/operator/layout/IndentedTreeLayout - - - /flare/vis/operator/layout/Layout - - - /flare/vis/operator/layout/NodeLinkTreeLayout - - - /flare/vis/operator/layout/PieLayout - - - /flare/vis/operator/layout/RadialTreeLayout - - - /flare/vis/operator/layout/RandomLayout - - - /flare/vis/operator/layout/StackedAreaLayout - - - /flare/vis/operator/layout/TreeMapLayout - + /flare + /flare/analytics + /flare/animate + /flare/data + /flare/display + /flare/flex + /flare/physics + /flare/query + /flare/scale + /flare/util + /flare/vis + /flare/analytics/cluster + /flare/analytics/graph + /flare/analytics/optimization + /flare/animate/Easing + /flare/animate/FunctionSequence + /flare/animate/interpolate + /flare/animate/ISchedulable + /flare/animate/Parallel + /flare/animate/Pause + /flare/animate/Scheduler + /flare/animate/Sequence + /flare/animate/Transition + /flare/animate/Transitioner + /flare/animate/TransitionEvent + /flare/animate/Tween + /flare/data/converters + /flare/data/DataField + /flare/data/DataSchema + /flare/data/DataSet + /flare/data/DataSource + /flare/data/DataTable + /flare/data/DataUtil + /flare/display/DirtySprite + /flare/display/LineSprite + /flare/display/RectSprite + /flare/display/TextSprite + /flare/flex/FlareVis + /flare/physics/DragForce + /flare/physics/GravityForce + /flare/physics/IForce + /flare/physics/NBodyForce + /flare/physics/Particle + /flare/physics/Simulation + /flare/physics/Spring + /flare/physics/SpringForce + /flare/query/AggregateExpression + /flare/query/And + /flare/query/Arithmetic + /flare/query/Average + /flare/query/BinaryExpression + /flare/query/Comparison + /flare/query/CompositeExpression + /flare/query/Count + /flare/query/DateUtil + /flare/query/Distinct + /flare/query/Expression + /flare/query/ExpressionIterator + /flare/query/Fn + /flare/query/If + /flare/query/IsA + /flare/query/Literal + /flare/query/Match + /flare/query/Maximum + /flare/query/methods + /flare/query/Minimum + /flare/query/Not + /flare/query/Or + /flare/query/Query + /flare/query/Range + /flare/query/StringUtil + /flare/query/Sum + /flare/query/Variable + /flare/query/Variance + /flare/query/Xor + /flare/scale/IScaleMap + /flare/scale/LinearScale + /flare/scale/LogScale + /flare/scale/OrdinalScale + /flare/scale/QuantileScale + /flare/scale/QuantitativeScale + /flare/scale/RootScale + /flare/scale/Scale + /flare/scale/ScaleType + /flare/scale/TimeScale + /flare/util/Arrays + /flare/util/Colors + /flare/util/Dates + /flare/util/Displays + /flare/util/Filter + /flare/util/Geometry + /flare/util/heap + /flare/util/IEvaluable + /flare/util/IPredicate + /flare/util/IValueProxy + /flare/util/math + /flare/util/Maths + /flare/util/Orientation + /flare/util/palette + /flare/util/Property + /flare/util/Shapes + /flare/util/Sort + /flare/util/Stats + /flare/util/Strings + /flare/vis/axis + /flare/vis/controls + /flare/vis/data + /flare/vis/events + /flare/vis/legend + /flare/vis/operator + /flare/vis/Visualization + /flare/analytics/cluster/AgglomerativeCluster + /flare/analytics/cluster/CommunityStructure + /flare/analytics/cluster/HierarchicalCluster + /flare/analytics/cluster/MergeEdge + /flare/analytics/graph/BetweennessCentrality + /flare/analytics/graph/LinkDistance + /flare/analytics/graph/MaxFlowMinCut + /flare/analytics/graph/ShortestPaths + /flare/analytics/graph/SpanningTree + /flare/analytics/optimization/AspectRatioBanker + /flare/animate/interpolate/ArrayInterpolator + /flare/animate/interpolate/ColorInterpolator + /flare/animate/interpolate/DateInterpolator + /flare/animate/interpolate/Interpolator + /flare/animate/interpolate/MatrixInterpolator + /flare/animate/interpolate/NumberInterpolator + /flare/animate/interpolate/ObjectInterpolator + /flare/animate/interpolate/PointInterpolator + /flare/animate/interpolate/RectangleInterpolator + /flare/data/converters/Converters + /flare/data/converters/DelimitedTextConverter + /flare/data/converters/GraphMLConverter + /flare/data/converters/IDataConverter + /flare/data/converters/JSONConverter + /flare/query/methods/add + /flare/query/methods/and + /flare/query/methods/average + /flare/query/methods/count + /flare/query/methods/distinct + /flare/query/methods/div + /flare/query/methods/eq + /flare/query/methods/fn + /flare/query/methods/gt + /flare/query/methods/gte + /flare/query/methods/iff + /flare/query/methods/isa + /flare/query/methods/lt + /flare/query/methods/lte + /flare/query/methods/max + /flare/query/methods/min + /flare/query/methods/mod + /flare/query/methods/mul + /flare/query/methods/neq + /flare/query/methods/not + /flare/query/methods/or + /flare/query/methods/orderby + /flare/query/methods/range + /flare/query/methods/select + /flare/query/methods/stddev + /flare/query/methods/sub + /flare/query/methods/sum + /flare/query/methods/update + /flare/query/methods/variance + /flare/query/methods/where + /flare/query/methods/xor + /flare/query/methods/_ + /flare/util/heap/FibonacciHeap + /flare/util/heap/HeapNode + /flare/util/math/DenseMatrix + /flare/util/math/IMatrix + /flare/util/math/SparseMatrix + /flare/util/palette/ColorPalette + /flare/util/palette/Palette + /flare/util/palette/ShapePalette + /flare/util/palette/SizePalette + /flare/vis/axis/Axes + /flare/vis/axis/Axis + /flare/vis/axis/AxisGridLine + /flare/vis/axis/AxisLabel + /flare/vis/axis/CartesianAxes + /flare/vis/controls/AnchorControl + /flare/vis/controls/ClickControl + /flare/vis/controls/Control + /flare/vis/controls/ControlList + /flare/vis/controls/DragControl + /flare/vis/controls/ExpandControl + /flare/vis/controls/HoverControl + /flare/vis/controls/IControl + /flare/vis/controls/PanZoomControl + /flare/vis/controls/SelectionControl + /flare/vis/controls/TooltipControl + /flare/vis/data/Data + /flare/vis/data/DataList + /flare/vis/data/DataSprite + /flare/vis/data/EdgeSprite + /flare/vis/data/NodeSprite + /flare/vis/data/render + /flare/vis/data/ScaleBinding + /flare/vis/data/Tree + /flare/vis/data/TreeBuilder + /flare/vis/events/DataEvent + /flare/vis/events/SelectionEvent + /flare/vis/events/TooltipEvent + /flare/vis/events/VisualizationEvent + /flare/vis/legend/Legend + /flare/vis/legend/LegendItem + /flare/vis/legend/LegendRange + /flare/vis/operator/distortion + /flare/vis/operator/encoder + /flare/vis/operator/filter + /flare/vis/operator/IOperator + /flare/vis/operator/label + /flare/vis/operator/layout + /flare/vis/operator/Operator + /flare/vis/operator/OperatorList + /flare/vis/operator/OperatorSequence + /flare/vis/operator/OperatorSwitch + /flare/vis/operator/SortOperator + /flare/vis/data/render/ArrowType + /flare/vis/data/render/EdgeRenderer + /flare/vis/data/render/IRenderer + /flare/vis/data/render/ShapeRenderer + /flare/vis/operator/distortion/BifocalDistortion + /flare/vis/operator/distortion/Distortion + /flare/vis/operator/distortion/FisheyeDistortion + /flare/vis/operator/encoder/ColorEncoder + /flare/vis/operator/encoder/Encoder + /flare/vis/operator/encoder/PropertyEncoder + /flare/vis/operator/encoder/ShapeEncoder + /flare/vis/operator/encoder/SizeEncoder + /flare/vis/operator/filter/FisheyeTreeFilter + /flare/vis/operator/filter/GraphDistanceFilter + /flare/vis/operator/filter/VisibilityFilter + /flare/vis/operator/label/Labeler + /flare/vis/operator/label/RadialLabeler + /flare/vis/operator/label/StackedAreaLabeler + /flare/vis/operator/layout/AxisLayout + /flare/vis/operator/layout/BundledEdgeRouter + /flare/vis/operator/layout/CircleLayout + /flare/vis/operator/layout/CirclePackingLayout + /flare/vis/operator/layout/DendrogramLayout + /flare/vis/operator/layout/ForceDirectedLayout + /flare/vis/operator/layout/IcicleTreeLayout + /flare/vis/operator/layout/IndentedTreeLayout + /flare/vis/operator/layout/Layout + /flare/vis/operator/layout/NodeLinkTreeLayout + /flare/vis/operator/layout/PieLayout + /flare/vis/operator/layout/RadialTreeLayout + /flare/vis/operator/layout/RandomLayout + /flare/vis/operator/layout/StackedAreaLayout + /flare/vis/operator/layout/TreeMapLayout + + + flare/flare + analytics/flare/analytics + animate/flare/animate + data/flare/data + display/flare/display + flex/flare/flex + physics/flare/physics + query/flare/query + scale/flare/scale + util/flare/util + vis/flare/vis + cluster/flare/analytics/cluster + graph/flare/analytics/graph + optimization/flare/analytics/optimization + Easing/flare/animate/Easing + FunctionSequence/flare/animate/FunctionSequence + interpolate/flare/animate/interpolate + ISchedulable/flare/animate/ISchedulable + Parallel/flare/animate/Parallel + Pause/flare/animate/Pause + Scheduler/flare/animate/Scheduler + Sequence/flare/animate/Sequence + Transition/flare/animate/Transition + Transitioner/flare/animate/Transitioner + TransitionEvent/flare/animate/TransitionEvent + Tween/flare/animate/Tween + converters/flare/data/converters + DataField/flare/data/DataField + DataSchema/flare/data/DataSchema + DataSet/flare/data/DataSet + DataSource/flare/data/DataSource + DataTable/flare/data/DataTable + DataUtil/flare/data/DataUtil + DirtySprite/flare/display/DirtySprite + LineSprite/flare/display/LineSprite + RectSprite/flare/display/RectSprite + TextSprite/flare/display/TextSprite + FlareVis/flare/flex/FlareVis + DragForce/flare/physics/DragForce + GravityForce/flare/physics/GravityForce + IForce/flare/physics/IForce + NBodyForce/flare/physics/NBodyForce + Particle/flare/physics/Particle + Simulation/flare/physics/Simulation + Spring/flare/physics/Spring + SpringForce/flare/physics/SpringForce + AggregateExpression/flare/query/AggregateExpression + And/flare/query/And + Arithmetic/flare/query/Arithmetic + Average/flare/query/Average + BinaryExpression/flare/query/BinaryExpression + Comparison/flare/query/Comparison + CompositeExpression/flare/query/CompositeExpression + Count/flare/query/Count + DateUtil/flare/query/DateUtil + Distinct/flare/query/Distinct + Expression/flare/query/Expression + ExpressionIterator/flare/query/ExpressionIterator + Fn/flare/query/Fn + If/flare/query/If + IsA/flare/query/IsA + Literal/flare/query/Literal + Match/flare/query/Match + Maximum/flare/query/Maximum + methods/flare/query/methods + Minimum/flare/query/Minimum + Not/flare/query/Not + Or/flare/query/Or + Query/flare/query/Query + Range/flare/query/Range + StringUtil/flare/query/StringUtil + Sum/flare/query/Sum + Variable/flare/query/Variable + Variance/flare/query/Variance + Xor/flare/query/Xor + IScaleMap/flare/scale/IScaleMap + LinearScale/flare/scale/LinearScale + LogScale/flare/scale/LogScale + OrdinalScale/flare/scale/OrdinalScale + QuantileScale/flare/scale/QuantileScale + QuantitativeScale/flare/scale/QuantitativeScale + RootScale/flare/scale/RootScale + Scale/flare/scale/Scale + ScaleType/flare/scale/ScaleType + TimeScale/flare/scale/TimeScale + Arrays/flare/util/Arrays + Colors/flare/util/Colors + Dates/flare/util/Dates + Displays/flare/util/Displays + Filter/flare/util/Filter + Geometry/flare/util/Geometry + heap/flare/util/heap + IEvaluable/flare/util/IEvaluable + IPredicate/flare/util/IPredicate + IValueProxy/flare/util/IValueProxy + math/flare/util/math + Maths/flare/util/Maths + Orientation/flare/util/Orientation + palette/flare/util/palette + Property/flare/util/Property + Shapes/flare/util/Shapes + Sort/flare/util/Sort + Stats/flare/util/Stats + Strings/flare/util/Strings + axis/flare/vis/axis + controls/flare/vis/controls + data/flare/vis/data + events/flare/vis/events + legend/flare/vis/legend + operator/flare/vis/operator + Visualization/flare/vis/Visualization + AgglomerativeCluster/flare/analytics/cluster/AgglomerativeCluster + CommunityStructure/flare/analytics/cluster/CommunityStructure + HierarchicalCluster/flare/analytics/cluster/HierarchicalCluster + MergeEdge/flare/analytics/cluster/MergeEdge + BetweennessCentrality/flare/analytics/graph/BetweennessCentrality + LinkDistance/flare/analytics/graph/LinkDistance + MaxFlowMinCut/flare/analytics/graph/MaxFlowMinCut + ShortestPaths/flare/analytics/graph/ShortestPaths + SpanningTree/flare/analytics/graph/SpanningTree + AspectRatioBanker/flare/analytics/optimization/AspectRatioBanker + ArrayInterpolator/flare/animate/interpolate/ArrayInterpolator + ColorInterpolator/flare/animate/interpolate/ColorInterpolator + DateInterpolator/flare/animate/interpolate/DateInterpolator + Interpolator/flare/animate/interpolate/Interpolator + MatrixInterpolator/flare/animate/interpolate/MatrixInterpolator + NumberInterpolator/flare/animate/interpolate/NumberInterpolator + ObjectInterpolator/flare/animate/interpolate/ObjectInterpolator + PointInterpolator/flare/animate/interpolate/PointInterpolator + RectangleInterpolator/flare/animate/interpolate/RectangleInterpolator + Converters/flare/data/converters/Converters + DelimitedTextConverter/flare/data/converters/DelimitedTextConverter + GraphMLConverter/flare/data/converters/GraphMLConverter + IDataConverter/flare/data/converters/IDataConverter + JSONConverter/flare/data/converters/JSONConverter + add/flare/query/methods/add + and/flare/query/methods/and + average/flare/query/methods/average + count/flare/query/methods/count + distinct/flare/query/methods/distinct + div/flare/query/methods/div + eq/flare/query/methods/eq + fn/flare/query/methods/fn + gt/flare/query/methods/gt + gte/flare/query/methods/gte + iff/flare/query/methods/iff + isa/flare/query/methods/isa + lt/flare/query/methods/lt + lte/flare/query/methods/lte + max/flare/query/methods/max + min/flare/query/methods/min + mod/flare/query/methods/mod + mul/flare/query/methods/mul + neq/flare/query/methods/neq + not/flare/query/methods/not + or/flare/query/methods/or + orderby/flare/query/methods/orderby + range/flare/query/methods/range + select/flare/query/methods/select + stddev/flare/query/methods/stddev + sub/flare/query/methods/sub + sum/flare/query/methods/sum + update/flare/query/methods/update + variance/flare/query/methods/variance + where/flare/query/methods/where + xor/flare/query/methods/xor + _/flare/query/methods/_ + FibonacciHeap/flare/util/heap/FibonacciHeap + HeapNode/flare/util/heap/HeapNode + DenseMatrix/flare/util/math/DenseMatrix + IMatrix/flare/util/math/IMatrix + SparseMatrix/flare/util/math/SparseMatrix + ColorPalette/flare/util/palette/ColorPalette + Palette/flare/util/palette/Palette + ShapePalette/flare/util/palette/ShapePalette + SizePalette/flare/util/palette/SizePalette + Axes/flare/vis/axis/Axes + Axis/flare/vis/axis/Axis + AxisGridLine/flare/vis/axis/AxisGridLine + AxisLabel/flare/vis/axis/AxisLabel + CartesianAxes/flare/vis/axis/CartesianAxes + AnchorControl/flare/vis/controls/AnchorControl + ClickControl/flare/vis/controls/ClickControl + Control/flare/vis/controls/Control + ControlList/flare/vis/controls/ControlList + DragControl/flare/vis/controls/DragControl + ExpandControl/flare/vis/controls/ExpandControl + HoverControl/flare/vis/controls/HoverControl + IControl/flare/vis/controls/IControl + PanZoomControl/flare/vis/controls/PanZoomControl + SelectionControl/flare/vis/controls/SelectionControl + TooltipControl/flare/vis/controls/TooltipControl + Data/flare/vis/data/Data + DataList/flare/vis/data/DataList + DataSprite/flare/vis/data/DataSprite + EdgeSprite/flare/vis/data/EdgeSprite + NodeSprite/flare/vis/data/NodeSprite + render/flare/vis/data/render + ScaleBinding/flare/vis/data/ScaleBinding + Tree/flare/vis/data/Tree + TreeBuilder/flare/vis/data/TreeBuilder + DataEvent/flare/vis/events/DataEvent + SelectionEvent/flare/vis/events/SelectionEvent + TooltipEvent/flare/vis/events/TooltipEvent + VisualizationEvent/flare/vis/events/VisualizationEvent + Legend/flare/vis/legend/Legend + LegendItem/flare/vis/legend/LegendItem + LegendRange/flare/vis/legend/LegendRange + distortion/flare/vis/operator/distortion + encoder/flare/vis/operator/encoder + filter/flare/vis/operator/filter + IOperator/flare/vis/operator/IOperator + label/flare/vis/operator/label + layout/flare/vis/operator/layout + Operator/flare/vis/operator/Operator + OperatorList/flare/vis/operator/OperatorList + OperatorSequence/flare/vis/operator/OperatorSequence + OperatorSwitch/flare/vis/operator/OperatorSwitch + SortOperator/flare/vis/operator/SortOperator + ArrowType/flare/vis/data/render/ArrowType + EdgeRenderer/flare/vis/data/render/EdgeRenderer + IRenderer/flare/vis/data/render/IRenderer + ShapeRenderer/flare/vis/data/render/ShapeRenderer + BifocalDistortion/flare/vis/operator/distortion/BifocalDistortion + Distortion/flare/vis/operator/distortion/Distortion + FisheyeDistortion/flare/vis/operator/distortion/FisheyeDistortion + ColorEncoder/flare/vis/operator/encoder/ColorEncoder + Encoder/flare/vis/operator/encoder/Encoder + PropertyEncoder/flare/vis/operator/encoder/PropertyEncoder + ShapeEncoder/flare/vis/operator/encoder/ShapeEncoder + SizeEncoder/flare/vis/operator/encoder/SizeEncoder + FisheyeTreeFilter/flare/vis/operator/filter/FisheyeTreeFilter + GraphDistanceFilter/flare/vis/operator/filter/GraphDistanceFilter + VisibilityFilter/flare/vis/operator/filter/VisibilityFilter + Labeler/flare/vis/operator/label/Labeler + RadialLabeler/flare/vis/operator/label/RadialLabeler + StackedAreaLabeler/flare/vis/operator/label/StackedAreaLabeler + AxisLayout/flare/vis/operator/layout/AxisLayout + BundledEdgeRouter/flare/vis/operator/layout/BundledEdgeRouter + CircleLayout/flare/vis/operator/layout/CircleLayout + CirclePackingLayout/flare/vis/operator/layout/CirclePackingLayout + DendrogramLayout/flare/vis/operator/layout/DendrogramLayout + ForceDirectedLayout/flare/vis/operator/layout/ForceDirectedLayout + IcicleTreeLayout/flare/vis/operator/layout/IcicleTreeLayout + IndentedTreeLayout/flare/vis/operator/layout/IndentedTreeLayout + Layout/flare/vis/operator/layout/Layout + NodeLinkTreeLayout/flare/vis/operator/layout/NodeLinkTreeLayout + PieLayout/flare/vis/operator/layout/PieLayout + RadialTreeLayout/flare/vis/operator/layout/RadialTreeLayout + RandomLayout/flare/vis/operator/layout/RandomLayout + StackedAreaLayout/flare/vis/operator/layout/StackedAreaLayout + TreeMapLayout/flare/vis/operator/layout/TreeMapLayout - flare/flareanalytics/flare/analyticsanimate/flare/animatedata/flare/datadisplay/flare/displayflex/flare/flexphysics/flare/physicsquery/flare/queryscale/flare/scaleutil/flare/utilvis/flare/viscluster/flare/analytics/clustergraph/flare/analytics/graphoptimization/flare/analytics/optimizationEasing/flare/animate/EasingFunctionSequence/flare/animate/FunctionSequenceinterpolate/flare/animate/interpolateISchedulable/flare/animate/ISchedulableParallel/flare/animate/ParallelPause/flare/animate/PauseScheduler/flare/animate/SchedulerSequence/flare/animate/SequenceTransition/flare/animate/TransitionTransitioner/flare/animate/TransitionerTransitionEvent/flare/animate/TransitionEventTween/flare/animate/Tweenconverters/flare/data/convertersDataField/flare/data/DataFieldDataSchema/flare/data/DataSchemaDataSet/flare/data/DataSetDataSource/flare/data/DataSourceDataTable/flare/data/DataTableDataUtil/flare/data/DataUtilDirtySprite/flare/display/DirtySpriteLineSprite/flare/display/LineSpriteRectSprite/flare/display/RectSpriteTextSprite/flare/display/TextSpriteFlareVis/flare/flex/FlareVisDragForce/flare/physics/DragForceGravityForce/flare/physics/GravityForceIForce/flare/physics/IForceNBodyForce/flare/physics/NBodyForceParticle/flare/physics/ParticleSimulation/flare/physics/SimulationSpring/flare/physics/SpringSpringForce/flare/physics/SpringForceAggregateExpression/flare/query/AggregateExpressionAnd/flare/query/AndArithmetic/flare/query/ArithmeticAverage/flare/query/AverageBinaryExpression/flare/query/BinaryExpressionComparison/flare/query/ComparisonCompositeExpression/flare/query/CompositeExpressionCount/flare/query/CountDateUtil/flare/query/DateUtilDistinct/flare/query/DistinctExpression/flare/query/ExpressionExpressionIterator/flare/query/ExpressionIteratorFn/flare/query/FnIf/flare/query/IfIsA/flare/query/IsALiteral/flare/query/LiteralMatch/flare/query/MatchMaximum/flare/query/Maximummethods/flare/query/methodsMinimum/flare/query/MinimumNot/flare/query/NotOr/flare/query/OrQuery/flare/query/QueryRange/flare/query/RangeStringUtil/flare/query/StringUtilSum/flare/query/SumVariable/flare/query/VariableVariance/flare/query/VarianceXor/flare/query/XorIScaleMap/flare/scale/IScaleMapLinearScale/flare/scale/LinearScaleLogScale/flare/scale/LogScaleOrdinalScale/flare/scale/OrdinalScaleQuantileScale/flare/scale/QuantileScaleQuantitativeScale/flare/scale/QuantitativeScaleRootScale/flare/scale/RootScaleScale/flare/scale/ScaleScaleType/flare/scale/ScaleTypeTimeScale/flare/scale/TimeScaleArrays/flare/util/ArraysColors/flare/util/ColorsDates/flare/util/DatesDisplays/flare/util/DisplaysFilter/flare/util/FilterGeometry/flare/util/Geometryheap/flare/util/heapIEvaluable/flare/util/IEvaluableIPredicate/flare/util/IPredicateIValueProxy/flare/util/IValueProxymath/flare/util/mathMaths/flare/util/MathsOrientation/flare/util/Orientationpalette/flare/util/paletteProperty/flare/util/PropertyShapes/flare/util/ShapesSort/flare/util/SortStats/flare/util/StatsStrings/flare/util/Stringsaxis/flare/vis/axiscontrols/flare/vis/controlsdata/flare/vis/dataevents/flare/vis/eventslegend/flare/vis/legendoperator/flare/vis/operatorVisualization/flare/vis/VisualizationAgglomerativeCluster/flare/analytics/cluster/AgglomerativeClusterCommunityStructure/flare/analytics/cluster/CommunityStructureHierarchicalCluster/flare/analytics/cluster/HierarchicalClusterMergeEdge/flare/analytics/cluster/MergeEdgeBetweennessCentrality/flare/analytics/graph/BetweennessCentralityLinkDistance/flare/analytics/graph/LinkDistanceMaxFlowMinCut/flare/analytics/graph/MaxFlowMinCutShortestPaths/flare/analytics/graph/ShortestPathsSpanningTree/flare/analytics/graph/SpanningTreeAspectRatioBanker/flare/analytics/optimization/AspectRatioBankerArrayInterpolator/flare/animate/interpolate/ArrayInterpolatorColorInterpolator/flare/animate/interpolate/ColorInterpolatorDateInterpolator/flare/animate/interpolate/DateInterpolatorInterpolator/flare/animate/interpolate/InterpolatorMatrixInterpolator/flare/animate/interpolate/MatrixInterpolatorNumberInterpolator/flare/animate/interpolate/NumberInterpolatorObjectInterpolator/flare/animate/interpolate/ObjectInterpolatorPointInterpolator/flare/animate/interpolate/PointInterpolatorRectangleInterpolator/flare/animate/interpolate/RectangleInterpolatorConverters/flare/data/converters/ConvertersDelimitedTextConverter/flare/data/converters/DelimitedTextConverterGraphMLConverter/flare/data/converters/GraphMLConverterIDataConverter/flare/data/converters/IDataConverterJSONConverter/flare/data/converters/JSONConverteradd/flare/query/methods/addand/flare/query/methods/andaverage/flare/query/methods/averagecount/flare/query/methods/countdistinct/flare/query/methods/distinctdiv/flare/query/methods/diveq/flare/query/methods/eqfn/flare/query/methods/fngt/flare/query/methods/gtgte/flare/query/methods/gteiff/flare/query/methods/iffisa/flare/query/methods/isalt/flare/query/methods/ltlte/flare/query/methods/ltemax/flare/query/methods/maxmin/flare/query/methods/minmod/flare/query/methods/modmul/flare/query/methods/mulneq/flare/query/methods/neqnot/flare/query/methods/notor/flare/query/methods/ororderby/flare/query/methods/orderbyrange/flare/query/methods/rangeselect/flare/query/methods/selectstddev/flare/query/methods/stddevsub/flare/query/methods/subsum/flare/query/methods/sumupdate/flare/query/methods/updatevariance/flare/query/methods/variancewhere/flare/query/methods/wherexor/flare/query/methods/xor_/flare/query/methods/_FibonacciHeap/flare/util/heap/FibonacciHeapHeapNode/flare/util/heap/HeapNodeDenseMatrix/flare/util/math/DenseMatrixIMatrix/flare/util/math/IMatrixSparseMatrix/flare/util/math/SparseMatrixColorPalette/flare/util/palette/ColorPalettePalette/flare/util/palette/PaletteShapePalette/flare/util/palette/ShapePaletteSizePalette/flare/util/palette/SizePaletteAxes/flare/vis/axis/AxesAxis/flare/vis/axis/AxisAxisGridLine/flare/vis/axis/AxisGridLineAxisLabel/flare/vis/axis/AxisLabelCartesianAxes/flare/vis/axis/CartesianAxesAnchorControl/flare/vis/controls/AnchorControlClickControl/flare/vis/controls/ClickControlControl/flare/vis/controls/ControlControlList/flare/vis/controls/ControlListDragControl/flare/vis/controls/DragControlExpandControl/flare/vis/controls/ExpandControlHoverControl/flare/vis/controls/HoverControlIControl/flare/vis/controls/IControlPanZoomControl/flare/vis/controls/PanZoomControlSelectionControl/flare/vis/controls/SelectionControlTooltipControl/flare/vis/controls/TooltipControlData/flare/vis/data/DataDataList/flare/vis/data/DataListDataSprite/flare/vis/data/DataSpriteEdgeSprite/flare/vis/data/EdgeSpriteNodeSprite/flare/vis/data/NodeSpriterender/flare/vis/data/renderScaleBinding/flare/vis/data/ScaleBindingTree/flare/vis/data/TreeTreeBuilder/flare/vis/data/TreeBuilderDataEvent/flare/vis/events/DataEventSelectionEvent/flare/vis/events/SelectionEventTooltipEvent/flare/vis/events/TooltipEventVisualizationEvent/flare/vis/events/VisualizationEventLegend/flare/vis/legend/LegendLegendItem/flare/vis/legend/LegendItemLegendRange/flare/vis/legend/LegendRangedistortion/flare/vis/operator/distortionencoder/flare/vis/operator/encoderfilter/flare/vis/operator/filterIOperator/flare/vis/operator/IOperatorlabel/flare/vis/operator/labellayout/flare/vis/operator/layoutOperator/flare/vis/operator/OperatorOperatorList/flare/vis/operator/OperatorListOperatorSequence/flare/vis/operator/OperatorSequenceOperatorSwitch/flare/vis/operator/OperatorSwitchSortOperator/flare/vis/operator/SortOperatorArrowType/flare/vis/data/render/ArrowTypeEdgeRenderer/flare/vis/data/render/EdgeRendererIRenderer/flare/vis/data/render/IRendererShapeRenderer/flare/vis/data/render/ShapeRendererBifocalDistortion/flare/vis/operator/distortion/BifocalDistortionDistortion/flare/vis/operator/distortion/DistortionFisheyeDistortion/flare/vis/operator/distortion/FisheyeDistortionColorEncoder/flare/vis/operator/encoder/ColorEncoderEncoder/flare/vis/operator/encoder/EncoderPropertyEncoder/flare/vis/operator/encoder/PropertyEncoderShapeEncoder/flare/vis/operator/encoder/ShapeEncoderSizeEncoder/flare/vis/operator/encoder/SizeEncoderFisheyeTreeFilter/flare/vis/operator/filter/FisheyeTreeFilterGraphDistanceFilter/flare/vis/operator/filter/GraphDistanceFilterVisibilityFilter/flare/vis/operator/filter/VisibilityFilterLabeler/flare/vis/operator/label/LabelerRadialLabeler/flare/vis/operator/label/RadialLabelerStackedAreaLabeler/flare/vis/operator/label/StackedAreaLabelerAxisLayout/flare/vis/operator/layout/AxisLayoutBundledEdgeRouter/flare/vis/operator/layout/BundledEdgeRouterCircleLayout/flare/vis/operator/layout/CircleLayoutCirclePackingLayout/flare/vis/operator/layout/CirclePackingLayoutDendrogramLayout/flare/vis/operator/layout/DendrogramLayoutForceDirectedLayout/flare/vis/operator/layout/ForceDirectedLayoutIcicleTreeLayout/flare/vis/operator/layout/IcicleTreeLayoutIndentedTreeLayout/flare/vis/operator/layout/IndentedTreeLayoutLayout/flare/vis/operator/layout/LayoutNodeLinkTreeLayout/flare/vis/operator/layout/NodeLinkTreeLayoutPieLayout/flare/vis/operator/layout/PieLayoutRadialTreeLayout/flare/vis/operator/layout/RadialTreeLayoutRandomLayout/flare/vis/operator/layout/RandomLayoutStackedAreaLayout/flare/vis/operator/layout/StackedAreaLayoutTreeMapLayout/flare/vis/operator/layout/TreeMapLayout \ No newline at end of file diff --git a/test/output/flareIndent.svg b/test/output/flareIndent.svg index f26afd9d35..c21599c161 100644 --- a/test/output/flareIndent.svg +++ b/test/output/flareIndent.svg @@ -267,762 +267,511 @@ - - /flare - - - /flare/analytics - - - /flare/animate - - - /flare/data - - - /flare/display - - - /flare/flex - - - /flare/physics - - - /flare/query - - - /flare/scale - - - /flare/util - - - /flare/vis - - - /flare/analytics/cluster - - - /flare/analytics/graph - - - /flare/analytics/optimization - - - /flare/animate/Easing - - - /flare/animate/FunctionSequence - - - /flare/animate/interpolate - - - /flare/animate/ISchedulable - - - /flare/animate/Parallel - - - /flare/animate/Pause - - - /flare/animate/Scheduler - - - /flare/animate/Sequence - - - /flare/animate/Transition - - - /flare/animate/Transitioner - - - /flare/animate/TransitionEvent - - - /flare/animate/Tween - - - /flare/data/converters - - - /flare/data/DataField - - - /flare/data/DataSchema - - - /flare/data/DataSet - - - /flare/data/DataSource - - - /flare/data/DataTable - - - /flare/data/DataUtil - - - /flare/display/DirtySprite - - - /flare/display/LineSprite - - - /flare/display/RectSprite - - - /flare/display/TextSprite - - - /flare/flex/FlareVis - - - /flare/physics/DragForce - - - /flare/physics/GravityForce - - - /flare/physics/IForce - - - /flare/physics/NBodyForce - - - /flare/physics/Particle - - - /flare/physics/Simulation - - - /flare/physics/Spring - - - /flare/physics/SpringForce - - - /flare/query/AggregateExpression - - - /flare/query/And - - - /flare/query/Arithmetic - - - /flare/query/Average - - - /flare/query/BinaryExpression - - - /flare/query/Comparison - - - /flare/query/CompositeExpression - - - /flare/query/Count - - - /flare/query/DateUtil - - - /flare/query/Distinct - - - /flare/query/Expression - - - /flare/query/ExpressionIterator - - - /flare/query/Fn - - - /flare/query/If - - - /flare/query/IsA - - - /flare/query/Literal - - - /flare/query/Match - - - /flare/query/Maximum - - - /flare/query/methods - - - /flare/query/Minimum - - - /flare/query/Not - - - /flare/query/Or - - - /flare/query/Query - - - /flare/query/Range - - - /flare/query/StringUtil - - - /flare/query/Sum - - - /flare/query/Variable - - - /flare/query/Variance - - - /flare/query/Xor - - - /flare/scale/IScaleMap - - - /flare/scale/LinearScale - - - /flare/scale/LogScale - - - /flare/scale/OrdinalScale - - - /flare/scale/QuantileScale - - - /flare/scale/QuantitativeScale - - - /flare/scale/RootScale - - - /flare/scale/Scale - - - /flare/scale/ScaleType - - - /flare/scale/TimeScale - - - /flare/util/Arrays - - - /flare/util/Colors - - - /flare/util/Dates - - - /flare/util/Displays - - - /flare/util/Filter - - - /flare/util/Geometry - - - /flare/util/heap - - - /flare/util/IEvaluable - - - /flare/util/IPredicate - - - /flare/util/IValueProxy - - - /flare/util/math - - - /flare/util/Maths - - - /flare/util/Orientation - - - /flare/util/palette - - - /flare/util/Property - - - /flare/util/Shapes - - - /flare/util/Sort - - - /flare/util/Stats - - - /flare/util/Strings - - - /flare/vis/axis - - - /flare/vis/controls - - - /flare/vis/data - - - /flare/vis/events - - - /flare/vis/legend - - - /flare/vis/operator - - - /flare/vis/Visualization - - - /flare/analytics/cluster/AgglomerativeCluster - - - /flare/analytics/cluster/CommunityStructure - - - /flare/analytics/cluster/HierarchicalCluster - - - /flare/analytics/cluster/MergeEdge - - - /flare/analytics/graph/BetweennessCentrality - - - /flare/analytics/graph/LinkDistance - - - /flare/analytics/graph/MaxFlowMinCut - - - /flare/analytics/graph/ShortestPaths - - - /flare/analytics/graph/SpanningTree - - - /flare/analytics/optimization/AspectRatioBanker - - - /flare/animate/interpolate/ArrayInterpolator - - - /flare/animate/interpolate/ColorInterpolator - - - /flare/animate/interpolate/DateInterpolator - - - /flare/animate/interpolate/Interpolator - - - /flare/animate/interpolate/MatrixInterpolator - - - /flare/animate/interpolate/NumberInterpolator - - - /flare/animate/interpolate/ObjectInterpolator - - - /flare/animate/interpolate/PointInterpolator - - - /flare/animate/interpolate/RectangleInterpolator - - - /flare/data/converters/Converters - - - /flare/data/converters/DelimitedTextConverter - - - /flare/data/converters/GraphMLConverter - - - /flare/data/converters/IDataConverter - - - /flare/data/converters/JSONConverter - - - /flare/query/methods/add - - - /flare/query/methods/and - - - /flare/query/methods/average - - - /flare/query/methods/count - - - /flare/query/methods/distinct - - - /flare/query/methods/div - - - /flare/query/methods/eq - - - /flare/query/methods/fn - - - /flare/query/methods/gt - - - /flare/query/methods/gte - - - /flare/query/methods/iff - - - /flare/query/methods/isa - - - /flare/query/methods/lt - - - /flare/query/methods/lte - - - /flare/query/methods/max - - - /flare/query/methods/min - - - /flare/query/methods/mod - - - /flare/query/methods/mul - - - /flare/query/methods/neq - - - /flare/query/methods/not - - - /flare/query/methods/or - - - /flare/query/methods/orderby - - - /flare/query/methods/range - - - /flare/query/methods/select - - - /flare/query/methods/stddev - - - /flare/query/methods/sub - - - /flare/query/methods/sum - - - /flare/query/methods/update - - - /flare/query/methods/variance - - - /flare/query/methods/where - - - /flare/query/methods/xor - - - /flare/query/methods/_ - - - /flare/util/heap/FibonacciHeap - - - /flare/util/heap/HeapNode - - - /flare/util/math/DenseMatrix - - - /flare/util/math/IMatrix - - - /flare/util/math/SparseMatrix - - - /flare/util/palette/ColorPalette - - - /flare/util/palette/Palette - - - /flare/util/palette/ShapePalette - - - /flare/util/palette/SizePalette - - - /flare/vis/axis/Axes - - - /flare/vis/axis/Axis - - - /flare/vis/axis/AxisGridLine - - - /flare/vis/axis/AxisLabel - - - /flare/vis/axis/CartesianAxes - - - /flare/vis/controls/AnchorControl - - - /flare/vis/controls/ClickControl - - - /flare/vis/controls/Control - - - /flare/vis/controls/ControlList - - - /flare/vis/controls/DragControl - - - /flare/vis/controls/ExpandControl - - - /flare/vis/controls/HoverControl - - - /flare/vis/controls/IControl - - - /flare/vis/controls/PanZoomControl - - - /flare/vis/controls/SelectionControl - - - /flare/vis/controls/TooltipControl - - - /flare/vis/data/Data - - - /flare/vis/data/DataList - - - /flare/vis/data/DataSprite - - - /flare/vis/data/EdgeSprite - - - /flare/vis/data/NodeSprite - - - /flare/vis/data/render - - - /flare/vis/data/ScaleBinding - - - /flare/vis/data/Tree - - - /flare/vis/data/TreeBuilder - - - /flare/vis/events/DataEvent - - - /flare/vis/events/SelectionEvent - - - /flare/vis/events/TooltipEvent - - - /flare/vis/events/VisualizationEvent - - - /flare/vis/legend/Legend - - - /flare/vis/legend/LegendItem - - - /flare/vis/legend/LegendRange - - - /flare/vis/operator/distortion - - - /flare/vis/operator/encoder - - - /flare/vis/operator/filter - - - /flare/vis/operator/IOperator - - - /flare/vis/operator/label - - - /flare/vis/operator/layout - - - /flare/vis/operator/Operator - - - /flare/vis/operator/OperatorList - - - /flare/vis/operator/OperatorSequence - - - /flare/vis/operator/OperatorSwitch - - - /flare/vis/operator/SortOperator - - - /flare/vis/data/render/ArrowType - - - /flare/vis/data/render/EdgeRenderer - - - /flare/vis/data/render/IRenderer - - - /flare/vis/data/render/ShapeRenderer - - - /flare/vis/operator/distortion/BifocalDistortion - - - /flare/vis/operator/distortion/Distortion - - - /flare/vis/operator/distortion/FisheyeDistortion - - - /flare/vis/operator/encoder/ColorEncoder - - - /flare/vis/operator/encoder/Encoder - - - /flare/vis/operator/encoder/PropertyEncoder - - - /flare/vis/operator/encoder/ShapeEncoder - - - /flare/vis/operator/encoder/SizeEncoder - - - /flare/vis/operator/filter/FisheyeTreeFilter - - - /flare/vis/operator/filter/GraphDistanceFilter - - - /flare/vis/operator/filter/VisibilityFilter - - - /flare/vis/operator/label/Labeler - - - /flare/vis/operator/label/RadialLabeler - - - /flare/vis/operator/label/StackedAreaLabeler - - - /flare/vis/operator/layout/AxisLayout - - - /flare/vis/operator/layout/BundledEdgeRouter - - - /flare/vis/operator/layout/CircleLayout - - - /flare/vis/operator/layout/CirclePackingLayout - - - /flare/vis/operator/layout/DendrogramLayout - - - /flare/vis/operator/layout/ForceDirectedLayout - - - /flare/vis/operator/layout/IcicleTreeLayout - - - /flare/vis/operator/layout/IndentedTreeLayout - - - /flare/vis/operator/layout/Layout - - - /flare/vis/operator/layout/NodeLinkTreeLayout - - - /flare/vis/operator/layout/PieLayout - - - /flare/vis/operator/layout/RadialTreeLayout - - - /flare/vis/operator/layout/RandomLayout - - - /flare/vis/operator/layout/StackedAreaLayout - - - /flare/vis/operator/layout/TreeMapLayout - + /flare + /flare/analytics + /flare/animate + /flare/data + /flare/display + /flare/flex + /flare/physics + /flare/query + /flare/scale + /flare/util + /flare/vis + /flare/analytics/cluster + /flare/analytics/graph + /flare/analytics/optimization + /flare/animate/Easing + /flare/animate/FunctionSequence + /flare/animate/interpolate + /flare/animate/ISchedulable + /flare/animate/Parallel + /flare/animate/Pause + /flare/animate/Scheduler + /flare/animate/Sequence + /flare/animate/Transition + /flare/animate/Transitioner + /flare/animate/TransitionEvent + /flare/animate/Tween + /flare/data/converters + /flare/data/DataField + /flare/data/DataSchema + /flare/data/DataSet + /flare/data/DataSource + /flare/data/DataTable + /flare/data/DataUtil + /flare/display/DirtySprite + /flare/display/LineSprite + /flare/display/RectSprite + /flare/display/TextSprite + /flare/flex/FlareVis + /flare/physics/DragForce + /flare/physics/GravityForce + /flare/physics/IForce + /flare/physics/NBodyForce + /flare/physics/Particle + /flare/physics/Simulation + /flare/physics/Spring + /flare/physics/SpringForce + /flare/query/AggregateExpression + /flare/query/And + /flare/query/Arithmetic + /flare/query/Average + /flare/query/BinaryExpression + /flare/query/Comparison + /flare/query/CompositeExpression + /flare/query/Count + /flare/query/DateUtil + /flare/query/Distinct + /flare/query/Expression + /flare/query/ExpressionIterator + /flare/query/Fn + /flare/query/If + /flare/query/IsA + /flare/query/Literal + /flare/query/Match + /flare/query/Maximum + /flare/query/methods + /flare/query/Minimum + /flare/query/Not + /flare/query/Or + /flare/query/Query + /flare/query/Range + /flare/query/StringUtil + /flare/query/Sum + /flare/query/Variable + /flare/query/Variance + /flare/query/Xor + /flare/scale/IScaleMap + /flare/scale/LinearScale + /flare/scale/LogScale + /flare/scale/OrdinalScale + /flare/scale/QuantileScale + /flare/scale/QuantitativeScale + /flare/scale/RootScale + /flare/scale/Scale + /flare/scale/ScaleType + /flare/scale/TimeScale + /flare/util/Arrays + /flare/util/Colors + /flare/util/Dates + /flare/util/Displays + /flare/util/Filter + /flare/util/Geometry + /flare/util/heap + /flare/util/IEvaluable + /flare/util/IPredicate + /flare/util/IValueProxy + /flare/util/math + /flare/util/Maths + /flare/util/Orientation + /flare/util/palette + /flare/util/Property + /flare/util/Shapes + /flare/util/Sort + /flare/util/Stats + /flare/util/Strings + /flare/vis/axis + /flare/vis/controls + /flare/vis/data + /flare/vis/events + /flare/vis/legend + /flare/vis/operator + /flare/vis/Visualization + /flare/analytics/cluster/AgglomerativeCluster + /flare/analytics/cluster/CommunityStructure + /flare/analytics/cluster/HierarchicalCluster + /flare/analytics/cluster/MergeEdge + /flare/analytics/graph/BetweennessCentrality + /flare/analytics/graph/LinkDistance + /flare/analytics/graph/MaxFlowMinCut + /flare/analytics/graph/ShortestPaths + /flare/analytics/graph/SpanningTree + /flare/analytics/optimization/AspectRatioBanker + /flare/animate/interpolate/ArrayInterpolator + /flare/animate/interpolate/ColorInterpolator + /flare/animate/interpolate/DateInterpolator + /flare/animate/interpolate/Interpolator + /flare/animate/interpolate/MatrixInterpolator + /flare/animate/interpolate/NumberInterpolator + /flare/animate/interpolate/ObjectInterpolator + /flare/animate/interpolate/PointInterpolator + /flare/animate/interpolate/RectangleInterpolator + /flare/data/converters/Converters + /flare/data/converters/DelimitedTextConverter + /flare/data/converters/GraphMLConverter + /flare/data/converters/IDataConverter + /flare/data/converters/JSONConverter + /flare/query/methods/add + /flare/query/methods/and + /flare/query/methods/average + /flare/query/methods/count + /flare/query/methods/distinct + /flare/query/methods/div + /flare/query/methods/eq + /flare/query/methods/fn + /flare/query/methods/gt + /flare/query/methods/gte + /flare/query/methods/iff + /flare/query/methods/isa + /flare/query/methods/lt + /flare/query/methods/lte + /flare/query/methods/max + /flare/query/methods/min + /flare/query/methods/mod + /flare/query/methods/mul + /flare/query/methods/neq + /flare/query/methods/not + /flare/query/methods/or + /flare/query/methods/orderby + /flare/query/methods/range + /flare/query/methods/select + /flare/query/methods/stddev + /flare/query/methods/sub + /flare/query/methods/sum + /flare/query/methods/update + /flare/query/methods/variance + /flare/query/methods/where + /flare/query/methods/xor + /flare/query/methods/_ + /flare/util/heap/FibonacciHeap + /flare/util/heap/HeapNode + /flare/util/math/DenseMatrix + /flare/util/math/IMatrix + /flare/util/math/SparseMatrix + /flare/util/palette/ColorPalette + /flare/util/palette/Palette + /flare/util/palette/ShapePalette + /flare/util/palette/SizePalette + /flare/vis/axis/Axes + /flare/vis/axis/Axis + /flare/vis/axis/AxisGridLine + /flare/vis/axis/AxisLabel + /flare/vis/axis/CartesianAxes + /flare/vis/controls/AnchorControl + /flare/vis/controls/ClickControl + /flare/vis/controls/Control + /flare/vis/controls/ControlList + /flare/vis/controls/DragControl + /flare/vis/controls/ExpandControl + /flare/vis/controls/HoverControl + /flare/vis/controls/IControl + /flare/vis/controls/PanZoomControl + /flare/vis/controls/SelectionControl + /flare/vis/controls/TooltipControl + /flare/vis/data/Data + /flare/vis/data/DataList + /flare/vis/data/DataSprite + /flare/vis/data/EdgeSprite + /flare/vis/data/NodeSprite + /flare/vis/data/render + /flare/vis/data/ScaleBinding + /flare/vis/data/Tree + /flare/vis/data/TreeBuilder + /flare/vis/events/DataEvent + /flare/vis/events/SelectionEvent + /flare/vis/events/TooltipEvent + /flare/vis/events/VisualizationEvent + /flare/vis/legend/Legend + /flare/vis/legend/LegendItem + /flare/vis/legend/LegendRange + /flare/vis/operator/distortion + /flare/vis/operator/encoder + /flare/vis/operator/filter + /flare/vis/operator/IOperator + /flare/vis/operator/label + /flare/vis/operator/layout + /flare/vis/operator/Operator + /flare/vis/operator/OperatorList + /flare/vis/operator/OperatorSequence + /flare/vis/operator/OperatorSwitch + /flare/vis/operator/SortOperator + /flare/vis/data/render/ArrowType + /flare/vis/data/render/EdgeRenderer + /flare/vis/data/render/IRenderer + /flare/vis/data/render/ShapeRenderer + /flare/vis/operator/distortion/BifocalDistortion + /flare/vis/operator/distortion/Distortion + /flare/vis/operator/distortion/FisheyeDistortion + /flare/vis/operator/encoder/ColorEncoder + /flare/vis/operator/encoder/Encoder + /flare/vis/operator/encoder/PropertyEncoder + /flare/vis/operator/encoder/ShapeEncoder + /flare/vis/operator/encoder/SizeEncoder + /flare/vis/operator/filter/FisheyeTreeFilter + /flare/vis/operator/filter/GraphDistanceFilter + /flare/vis/operator/filter/VisibilityFilter + /flare/vis/operator/label/Labeler + /flare/vis/operator/label/RadialLabeler + /flare/vis/operator/label/StackedAreaLabeler + /flare/vis/operator/layout/AxisLayout + /flare/vis/operator/layout/BundledEdgeRouter + /flare/vis/operator/layout/CircleLayout + /flare/vis/operator/layout/CirclePackingLayout + /flare/vis/operator/layout/DendrogramLayout + /flare/vis/operator/layout/ForceDirectedLayout + /flare/vis/operator/layout/IcicleTreeLayout + /flare/vis/operator/layout/IndentedTreeLayout + /flare/vis/operator/layout/Layout + /flare/vis/operator/layout/NodeLinkTreeLayout + /flare/vis/operator/layout/PieLayout + /flare/vis/operator/layout/RadialTreeLayout + /flare/vis/operator/layout/RandomLayout + /flare/vis/operator/layout/StackedAreaLayout + /flare/vis/operator/layout/TreeMapLayout + + + flare/flare + analytics/flare/analytics + animate/flare/animate + data/flare/data + display/flare/display + flex/flare/flex + physics/flare/physics + query/flare/query + scale/flare/scale + util/flare/util + vis/flare/vis + cluster/flare/analytics/cluster + graph/flare/analytics/graph + optimization/flare/analytics/optimization + Easing/flare/animate/Easing + FunctionSequence/flare/animate/FunctionSequence + interpolate/flare/animate/interpolate + ISchedulable/flare/animate/ISchedulable + Parallel/flare/animate/Parallel + Pause/flare/animate/Pause + Scheduler/flare/animate/Scheduler + Sequence/flare/animate/Sequence + Transition/flare/animate/Transition + Transitioner/flare/animate/Transitioner + TransitionEvent/flare/animate/TransitionEvent + Tween/flare/animate/Tween + converters/flare/data/converters + DataField/flare/data/DataField + DataSchema/flare/data/DataSchema + DataSet/flare/data/DataSet + DataSource/flare/data/DataSource + DataTable/flare/data/DataTable + DataUtil/flare/data/DataUtil + DirtySprite/flare/display/DirtySprite + LineSprite/flare/display/LineSprite + RectSprite/flare/display/RectSprite + TextSprite/flare/display/TextSprite + FlareVis/flare/flex/FlareVis + DragForce/flare/physics/DragForce + GravityForce/flare/physics/GravityForce + IForce/flare/physics/IForce + NBodyForce/flare/physics/NBodyForce + Particle/flare/physics/Particle + Simulation/flare/physics/Simulation + Spring/flare/physics/Spring + SpringForce/flare/physics/SpringForce + AggregateExpression/flare/query/AggregateExpression + And/flare/query/And + Arithmetic/flare/query/Arithmetic + Average/flare/query/Average + BinaryExpression/flare/query/BinaryExpression + Comparison/flare/query/Comparison + CompositeExpression/flare/query/CompositeExpression + Count/flare/query/Count + DateUtil/flare/query/DateUtil + Distinct/flare/query/Distinct + Expression/flare/query/Expression + ExpressionIterator/flare/query/ExpressionIterator + Fn/flare/query/Fn + If/flare/query/If + IsA/flare/query/IsA + Literal/flare/query/Literal + Match/flare/query/Match + Maximum/flare/query/Maximum + methods/flare/query/methods + Minimum/flare/query/Minimum + Not/flare/query/Not + Or/flare/query/Or + Query/flare/query/Query + Range/flare/query/Range + StringUtil/flare/query/StringUtil + Sum/flare/query/Sum + Variable/flare/query/Variable + Variance/flare/query/Variance + Xor/flare/query/Xor + IScaleMap/flare/scale/IScaleMap + LinearScale/flare/scale/LinearScale + LogScale/flare/scale/LogScale + OrdinalScale/flare/scale/OrdinalScale + QuantileScale/flare/scale/QuantileScale + QuantitativeScale/flare/scale/QuantitativeScale + RootScale/flare/scale/RootScale + Scale/flare/scale/Scale + ScaleType/flare/scale/ScaleType + TimeScale/flare/scale/TimeScale + Arrays/flare/util/Arrays + Colors/flare/util/Colors + Dates/flare/util/Dates + Displays/flare/util/Displays + Filter/flare/util/Filter + Geometry/flare/util/Geometry + heap/flare/util/heap + IEvaluable/flare/util/IEvaluable + IPredicate/flare/util/IPredicate + IValueProxy/flare/util/IValueProxy + math/flare/util/math + Maths/flare/util/Maths + Orientation/flare/util/Orientation + palette/flare/util/palette + Property/flare/util/Property + Shapes/flare/util/Shapes + Sort/flare/util/Sort + Stats/flare/util/Stats + Strings/flare/util/Strings + axis/flare/vis/axis + controls/flare/vis/controls + data/flare/vis/data + events/flare/vis/events + legend/flare/vis/legend + operator/flare/vis/operator + Visualization/flare/vis/Visualization + AgglomerativeCluster/flare/analytics/cluster/AgglomerativeCluster + CommunityStructure/flare/analytics/cluster/CommunityStructure + HierarchicalCluster/flare/analytics/cluster/HierarchicalCluster + MergeEdge/flare/analytics/cluster/MergeEdge + BetweennessCentrality/flare/analytics/graph/BetweennessCentrality + LinkDistance/flare/analytics/graph/LinkDistance + MaxFlowMinCut/flare/analytics/graph/MaxFlowMinCut + ShortestPaths/flare/analytics/graph/ShortestPaths + SpanningTree/flare/analytics/graph/SpanningTree + AspectRatioBanker/flare/analytics/optimization/AspectRatioBanker + ArrayInterpolator/flare/animate/interpolate/ArrayInterpolator + ColorInterpolator/flare/animate/interpolate/ColorInterpolator + DateInterpolator/flare/animate/interpolate/DateInterpolator + Interpolator/flare/animate/interpolate/Interpolator + MatrixInterpolator/flare/animate/interpolate/MatrixInterpolator + NumberInterpolator/flare/animate/interpolate/NumberInterpolator + ObjectInterpolator/flare/animate/interpolate/ObjectInterpolator + PointInterpolator/flare/animate/interpolate/PointInterpolator + RectangleInterpolator/flare/animate/interpolate/RectangleInterpolator + Converters/flare/data/converters/Converters + DelimitedTextConverter/flare/data/converters/DelimitedTextConverter + GraphMLConverter/flare/data/converters/GraphMLConverter + IDataConverter/flare/data/converters/IDataConverter + JSONConverter/flare/data/converters/JSONConverter + add/flare/query/methods/add + and/flare/query/methods/and + average/flare/query/methods/average + count/flare/query/methods/count + distinct/flare/query/methods/distinct + div/flare/query/methods/div + eq/flare/query/methods/eq + fn/flare/query/methods/fn + gt/flare/query/methods/gt + gte/flare/query/methods/gte + iff/flare/query/methods/iff + isa/flare/query/methods/isa + lt/flare/query/methods/lt + lte/flare/query/methods/lte + max/flare/query/methods/max + min/flare/query/methods/min + mod/flare/query/methods/mod + mul/flare/query/methods/mul + neq/flare/query/methods/neq + not/flare/query/methods/not + or/flare/query/methods/or + orderby/flare/query/methods/orderby + range/flare/query/methods/range + select/flare/query/methods/select + stddev/flare/query/methods/stddev + sub/flare/query/methods/sub + sum/flare/query/methods/sum + update/flare/query/methods/update + variance/flare/query/methods/variance + where/flare/query/methods/where + xor/flare/query/methods/xor + _/flare/query/methods/_ + FibonacciHeap/flare/util/heap/FibonacciHeap + HeapNode/flare/util/heap/HeapNode + DenseMatrix/flare/util/math/DenseMatrix + IMatrix/flare/util/math/IMatrix + SparseMatrix/flare/util/math/SparseMatrix + ColorPalette/flare/util/palette/ColorPalette + Palette/flare/util/palette/Palette + ShapePalette/flare/util/palette/ShapePalette + SizePalette/flare/util/palette/SizePalette + Axes/flare/vis/axis/Axes + Axis/flare/vis/axis/Axis + AxisGridLine/flare/vis/axis/AxisGridLine + AxisLabel/flare/vis/axis/AxisLabel + CartesianAxes/flare/vis/axis/CartesianAxes + AnchorControl/flare/vis/controls/AnchorControl + ClickControl/flare/vis/controls/ClickControl + Control/flare/vis/controls/Control + ControlList/flare/vis/controls/ControlList + DragControl/flare/vis/controls/DragControl + ExpandControl/flare/vis/controls/ExpandControl + HoverControl/flare/vis/controls/HoverControl + IControl/flare/vis/controls/IControl + PanZoomControl/flare/vis/controls/PanZoomControl + SelectionControl/flare/vis/controls/SelectionControl + TooltipControl/flare/vis/controls/TooltipControl + Data/flare/vis/data/Data + DataList/flare/vis/data/DataList + DataSprite/flare/vis/data/DataSprite + EdgeSprite/flare/vis/data/EdgeSprite + NodeSprite/flare/vis/data/NodeSprite + render/flare/vis/data/render + ScaleBinding/flare/vis/data/ScaleBinding + Tree/flare/vis/data/Tree + TreeBuilder/flare/vis/data/TreeBuilder + DataEvent/flare/vis/events/DataEvent + SelectionEvent/flare/vis/events/SelectionEvent + TooltipEvent/flare/vis/events/TooltipEvent + VisualizationEvent/flare/vis/events/VisualizationEvent + Legend/flare/vis/legend/Legend + LegendItem/flare/vis/legend/LegendItem + LegendRange/flare/vis/legend/LegendRange + distortion/flare/vis/operator/distortion + encoder/flare/vis/operator/encoder + filter/flare/vis/operator/filter + IOperator/flare/vis/operator/IOperator + label/flare/vis/operator/label + layout/flare/vis/operator/layout + Operator/flare/vis/operator/Operator + OperatorList/flare/vis/operator/OperatorList + OperatorSequence/flare/vis/operator/OperatorSequence + OperatorSwitch/flare/vis/operator/OperatorSwitch + SortOperator/flare/vis/operator/SortOperator + ArrowType/flare/vis/data/render/ArrowType + EdgeRenderer/flare/vis/data/render/EdgeRenderer + IRenderer/flare/vis/data/render/IRenderer + ShapeRenderer/flare/vis/data/render/ShapeRenderer + BifocalDistortion/flare/vis/operator/distortion/BifocalDistortion + Distortion/flare/vis/operator/distortion/Distortion + FisheyeDistortion/flare/vis/operator/distortion/FisheyeDistortion + ColorEncoder/flare/vis/operator/encoder/ColorEncoder + Encoder/flare/vis/operator/encoder/Encoder + PropertyEncoder/flare/vis/operator/encoder/PropertyEncoder + ShapeEncoder/flare/vis/operator/encoder/ShapeEncoder + SizeEncoder/flare/vis/operator/encoder/SizeEncoder + FisheyeTreeFilter/flare/vis/operator/filter/FisheyeTreeFilter + GraphDistanceFilter/flare/vis/operator/filter/GraphDistanceFilter + VisibilityFilter/flare/vis/operator/filter/VisibilityFilter + Labeler/flare/vis/operator/label/Labeler + RadialLabeler/flare/vis/operator/label/RadialLabeler + StackedAreaLabeler/flare/vis/operator/label/StackedAreaLabeler + AxisLayout/flare/vis/operator/layout/AxisLayout + BundledEdgeRouter/flare/vis/operator/layout/BundledEdgeRouter + CircleLayout/flare/vis/operator/layout/CircleLayout + CirclePackingLayout/flare/vis/operator/layout/CirclePackingLayout + DendrogramLayout/flare/vis/operator/layout/DendrogramLayout + ForceDirectedLayout/flare/vis/operator/layout/ForceDirectedLayout + IcicleTreeLayout/flare/vis/operator/layout/IcicleTreeLayout + IndentedTreeLayout/flare/vis/operator/layout/IndentedTreeLayout + Layout/flare/vis/operator/layout/Layout + NodeLinkTreeLayout/flare/vis/operator/layout/NodeLinkTreeLayout + PieLayout/flare/vis/operator/layout/PieLayout + RadialTreeLayout/flare/vis/operator/layout/RadialTreeLayout + RandomLayout/flare/vis/operator/layout/RandomLayout + StackedAreaLayout/flare/vis/operator/layout/StackedAreaLayout + TreeMapLayout/flare/vis/operator/layout/TreeMapLayout - flare/flareanalytics/flare/analyticsanimate/flare/animatedata/flare/datadisplay/flare/displayflex/flare/flexphysics/flare/physicsquery/flare/queryscale/flare/scaleutil/flare/utilvis/flare/viscluster/flare/analytics/clustergraph/flare/analytics/graphoptimization/flare/analytics/optimizationEasing/flare/animate/EasingFunctionSequence/flare/animate/FunctionSequenceinterpolate/flare/animate/interpolateISchedulable/flare/animate/ISchedulableParallel/flare/animate/ParallelPause/flare/animate/PauseScheduler/flare/animate/SchedulerSequence/flare/animate/SequenceTransition/flare/animate/TransitionTransitioner/flare/animate/TransitionerTransitionEvent/flare/animate/TransitionEventTween/flare/animate/Tweenconverters/flare/data/convertersDataField/flare/data/DataFieldDataSchema/flare/data/DataSchemaDataSet/flare/data/DataSetDataSource/flare/data/DataSourceDataTable/flare/data/DataTableDataUtil/flare/data/DataUtilDirtySprite/flare/display/DirtySpriteLineSprite/flare/display/LineSpriteRectSprite/flare/display/RectSpriteTextSprite/flare/display/TextSpriteFlareVis/flare/flex/FlareVisDragForce/flare/physics/DragForceGravityForce/flare/physics/GravityForceIForce/flare/physics/IForceNBodyForce/flare/physics/NBodyForceParticle/flare/physics/ParticleSimulation/flare/physics/SimulationSpring/flare/physics/SpringSpringForce/flare/physics/SpringForceAggregateExpression/flare/query/AggregateExpressionAnd/flare/query/AndArithmetic/flare/query/ArithmeticAverage/flare/query/AverageBinaryExpression/flare/query/BinaryExpressionComparison/flare/query/ComparisonCompositeExpression/flare/query/CompositeExpressionCount/flare/query/CountDateUtil/flare/query/DateUtilDistinct/flare/query/DistinctExpression/flare/query/ExpressionExpressionIterator/flare/query/ExpressionIteratorFn/flare/query/FnIf/flare/query/IfIsA/flare/query/IsALiteral/flare/query/LiteralMatch/flare/query/MatchMaximum/flare/query/Maximummethods/flare/query/methodsMinimum/flare/query/MinimumNot/flare/query/NotOr/flare/query/OrQuery/flare/query/QueryRange/flare/query/RangeStringUtil/flare/query/StringUtilSum/flare/query/SumVariable/flare/query/VariableVariance/flare/query/VarianceXor/flare/query/XorIScaleMap/flare/scale/IScaleMapLinearScale/flare/scale/LinearScaleLogScale/flare/scale/LogScaleOrdinalScale/flare/scale/OrdinalScaleQuantileScale/flare/scale/QuantileScaleQuantitativeScale/flare/scale/QuantitativeScaleRootScale/flare/scale/RootScaleScale/flare/scale/ScaleScaleType/flare/scale/ScaleTypeTimeScale/flare/scale/TimeScaleArrays/flare/util/ArraysColors/flare/util/ColorsDates/flare/util/DatesDisplays/flare/util/DisplaysFilter/flare/util/FilterGeometry/flare/util/Geometryheap/flare/util/heapIEvaluable/flare/util/IEvaluableIPredicate/flare/util/IPredicateIValueProxy/flare/util/IValueProxymath/flare/util/mathMaths/flare/util/MathsOrientation/flare/util/Orientationpalette/flare/util/paletteProperty/flare/util/PropertyShapes/flare/util/ShapesSort/flare/util/SortStats/flare/util/StatsStrings/flare/util/Stringsaxis/flare/vis/axiscontrols/flare/vis/controlsdata/flare/vis/dataevents/flare/vis/eventslegend/flare/vis/legendoperator/flare/vis/operatorVisualization/flare/vis/VisualizationAgglomerativeCluster/flare/analytics/cluster/AgglomerativeClusterCommunityStructure/flare/analytics/cluster/CommunityStructureHierarchicalCluster/flare/analytics/cluster/HierarchicalClusterMergeEdge/flare/analytics/cluster/MergeEdgeBetweennessCentrality/flare/analytics/graph/BetweennessCentralityLinkDistance/flare/analytics/graph/LinkDistanceMaxFlowMinCut/flare/analytics/graph/MaxFlowMinCutShortestPaths/flare/analytics/graph/ShortestPathsSpanningTree/flare/analytics/graph/SpanningTreeAspectRatioBanker/flare/analytics/optimization/AspectRatioBankerArrayInterpolator/flare/animate/interpolate/ArrayInterpolatorColorInterpolator/flare/animate/interpolate/ColorInterpolatorDateInterpolator/flare/animate/interpolate/DateInterpolatorInterpolator/flare/animate/interpolate/InterpolatorMatrixInterpolator/flare/animate/interpolate/MatrixInterpolatorNumberInterpolator/flare/animate/interpolate/NumberInterpolatorObjectInterpolator/flare/animate/interpolate/ObjectInterpolatorPointInterpolator/flare/animate/interpolate/PointInterpolatorRectangleInterpolator/flare/animate/interpolate/RectangleInterpolatorConverters/flare/data/converters/ConvertersDelimitedTextConverter/flare/data/converters/DelimitedTextConverterGraphMLConverter/flare/data/converters/GraphMLConverterIDataConverter/flare/data/converters/IDataConverterJSONConverter/flare/data/converters/JSONConverteradd/flare/query/methods/addand/flare/query/methods/andaverage/flare/query/methods/averagecount/flare/query/methods/countdistinct/flare/query/methods/distinctdiv/flare/query/methods/diveq/flare/query/methods/eqfn/flare/query/methods/fngt/flare/query/methods/gtgte/flare/query/methods/gteiff/flare/query/methods/iffisa/flare/query/methods/isalt/flare/query/methods/ltlte/flare/query/methods/ltemax/flare/query/methods/maxmin/flare/query/methods/minmod/flare/query/methods/modmul/flare/query/methods/mulneq/flare/query/methods/neqnot/flare/query/methods/notor/flare/query/methods/ororderby/flare/query/methods/orderbyrange/flare/query/methods/rangeselect/flare/query/methods/selectstddev/flare/query/methods/stddevsub/flare/query/methods/subsum/flare/query/methods/sumupdate/flare/query/methods/updatevariance/flare/query/methods/variancewhere/flare/query/methods/wherexor/flare/query/methods/xor_/flare/query/methods/_FibonacciHeap/flare/util/heap/FibonacciHeapHeapNode/flare/util/heap/HeapNodeDenseMatrix/flare/util/math/DenseMatrixIMatrix/flare/util/math/IMatrixSparseMatrix/flare/util/math/SparseMatrixColorPalette/flare/util/palette/ColorPalettePalette/flare/util/palette/PaletteShapePalette/flare/util/palette/ShapePaletteSizePalette/flare/util/palette/SizePaletteAxes/flare/vis/axis/AxesAxis/flare/vis/axis/AxisAxisGridLine/flare/vis/axis/AxisGridLineAxisLabel/flare/vis/axis/AxisLabelCartesianAxes/flare/vis/axis/CartesianAxesAnchorControl/flare/vis/controls/AnchorControlClickControl/flare/vis/controls/ClickControlControl/flare/vis/controls/ControlControlList/flare/vis/controls/ControlListDragControl/flare/vis/controls/DragControlExpandControl/flare/vis/controls/ExpandControlHoverControl/flare/vis/controls/HoverControlIControl/flare/vis/controls/IControlPanZoomControl/flare/vis/controls/PanZoomControlSelectionControl/flare/vis/controls/SelectionControlTooltipControl/flare/vis/controls/TooltipControlData/flare/vis/data/DataDataList/flare/vis/data/DataListDataSprite/flare/vis/data/DataSpriteEdgeSprite/flare/vis/data/EdgeSpriteNodeSprite/flare/vis/data/NodeSpriterender/flare/vis/data/renderScaleBinding/flare/vis/data/ScaleBindingTree/flare/vis/data/TreeTreeBuilder/flare/vis/data/TreeBuilderDataEvent/flare/vis/events/DataEventSelectionEvent/flare/vis/events/SelectionEventTooltipEvent/flare/vis/events/TooltipEventVisualizationEvent/flare/vis/events/VisualizationEventLegend/flare/vis/legend/LegendLegendItem/flare/vis/legend/LegendItemLegendRange/flare/vis/legend/LegendRangedistortion/flare/vis/operator/distortionencoder/flare/vis/operator/encoderfilter/flare/vis/operator/filterIOperator/flare/vis/operator/IOperatorlabel/flare/vis/operator/labellayout/flare/vis/operator/layoutOperator/flare/vis/operator/OperatorOperatorList/flare/vis/operator/OperatorListOperatorSequence/flare/vis/operator/OperatorSequenceOperatorSwitch/flare/vis/operator/OperatorSwitchSortOperator/flare/vis/operator/SortOperatorArrowType/flare/vis/data/render/ArrowTypeEdgeRenderer/flare/vis/data/render/EdgeRendererIRenderer/flare/vis/data/render/IRendererShapeRenderer/flare/vis/data/render/ShapeRendererBifocalDistortion/flare/vis/operator/distortion/BifocalDistortionDistortion/flare/vis/operator/distortion/DistortionFisheyeDistortion/flare/vis/operator/distortion/FisheyeDistortionColorEncoder/flare/vis/operator/encoder/ColorEncoderEncoder/flare/vis/operator/encoder/EncoderPropertyEncoder/flare/vis/operator/encoder/PropertyEncoderShapeEncoder/flare/vis/operator/encoder/ShapeEncoderSizeEncoder/flare/vis/operator/encoder/SizeEncoderFisheyeTreeFilter/flare/vis/operator/filter/FisheyeTreeFilterGraphDistanceFilter/flare/vis/operator/filter/GraphDistanceFilterVisibilityFilter/flare/vis/operator/filter/VisibilityFilterLabeler/flare/vis/operator/label/LabelerRadialLabeler/flare/vis/operator/label/RadialLabelerStackedAreaLabeler/flare/vis/operator/label/StackedAreaLabelerAxisLayout/flare/vis/operator/layout/AxisLayoutBundledEdgeRouter/flare/vis/operator/layout/BundledEdgeRouterCircleLayout/flare/vis/operator/layout/CircleLayoutCirclePackingLayout/flare/vis/operator/layout/CirclePackingLayoutDendrogramLayout/flare/vis/operator/layout/DendrogramLayoutForceDirectedLayout/flare/vis/operator/layout/ForceDirectedLayoutIcicleTreeLayout/flare/vis/operator/layout/IcicleTreeLayoutIndentedTreeLayout/flare/vis/operator/layout/IndentedTreeLayoutLayout/flare/vis/operator/layout/LayoutNodeLinkTreeLayout/flare/vis/operator/layout/NodeLinkTreeLayoutPieLayout/flare/vis/operator/layout/PieLayoutRadialTreeLayout/flare/vis/operator/layout/RadialTreeLayoutRandomLayout/flare/vis/operator/layout/RandomLayoutStackedAreaLayout/flare/vis/operator/layout/StackedAreaLayoutTreeMapLayout/flare/vis/operator/layout/TreeMapLayout \ No newline at end of file diff --git a/test/output/flareTree.svg b/test/output/flareTree.svg index 2335808674..2d9271f72a 100644 --- a/test/output/flareTree.svg +++ b/test/output/flareTree.svg @@ -272,5 +272,258 @@ - flare/flareanalytics/flare/analyticsanimate/flare/animatedata/flare/datadisplay/flare/displayflex/flare/flexphysics/flare/physicsquery/flare/queryscale/flare/scaleutil/flare/utilvis/flare/viscluster/flare/analytics/clustergraph/flare/analytics/graphoptimization/flare/analytics/optimizationEasing/flare/animate/EasingFunctionSequence/flare/animate/FunctionSequenceinterpolate/flare/animate/interpolateISchedulable/flare/animate/ISchedulableParallel/flare/animate/ParallelPause/flare/animate/PauseScheduler/flare/animate/SchedulerSequence/flare/animate/SequenceTransition/flare/animate/TransitionTransitioner/flare/animate/TransitionerTransitionEvent/flare/animate/TransitionEventTween/flare/animate/Tweenconverters/flare/data/convertersDataField/flare/data/DataFieldDataSchema/flare/data/DataSchemaDataSet/flare/data/DataSetDataSource/flare/data/DataSourceDataTable/flare/data/DataTableDataUtil/flare/data/DataUtilDirtySprite/flare/display/DirtySpriteLineSprite/flare/display/LineSpriteRectSprite/flare/display/RectSpriteTextSprite/flare/display/TextSpriteFlareVis/flare/flex/FlareVisDragForce/flare/physics/DragForceGravityForce/flare/physics/GravityForceIForce/flare/physics/IForceNBodyForce/flare/physics/NBodyForceParticle/flare/physics/ParticleSimulation/flare/physics/SimulationSpring/flare/physics/SpringSpringForce/flare/physics/SpringForceAggregateExpression/flare/query/AggregateExpressionAnd/flare/query/AndArithmetic/flare/query/ArithmeticAverage/flare/query/AverageBinaryExpression/flare/query/BinaryExpressionComparison/flare/query/ComparisonCompositeExpression/flare/query/CompositeExpressionCount/flare/query/CountDateUtil/flare/query/DateUtilDistinct/flare/query/DistinctExpression/flare/query/ExpressionExpressionIterator/flare/query/ExpressionIteratorFn/flare/query/FnIf/flare/query/IfIsA/flare/query/IsALiteral/flare/query/LiteralMatch/flare/query/MatchMaximum/flare/query/Maximummethods/flare/query/methodsMinimum/flare/query/MinimumNot/flare/query/NotOr/flare/query/OrQuery/flare/query/QueryRange/flare/query/RangeStringUtil/flare/query/StringUtilSum/flare/query/SumVariable/flare/query/VariableVariance/flare/query/VarianceXor/flare/query/XorIScaleMap/flare/scale/IScaleMapLinearScale/flare/scale/LinearScaleLogScale/flare/scale/LogScaleOrdinalScale/flare/scale/OrdinalScaleQuantileScale/flare/scale/QuantileScaleQuantitativeScale/flare/scale/QuantitativeScaleRootScale/flare/scale/RootScaleScale/flare/scale/ScaleScaleType/flare/scale/ScaleTypeTimeScale/flare/scale/TimeScaleArrays/flare/util/ArraysColors/flare/util/ColorsDates/flare/util/DatesDisplays/flare/util/DisplaysFilter/flare/util/FilterGeometry/flare/util/Geometryheap/flare/util/heapIEvaluable/flare/util/IEvaluableIPredicate/flare/util/IPredicateIValueProxy/flare/util/IValueProxymath/flare/util/mathMaths/flare/util/MathsOrientation/flare/util/Orientationpalette/flare/util/paletteProperty/flare/util/PropertyShapes/flare/util/ShapesSort/flare/util/SortStats/flare/util/StatsStrings/flare/util/Stringsaxis/flare/vis/axiscontrols/flare/vis/controlsdata/flare/vis/dataevents/flare/vis/eventslegend/flare/vis/legendoperator/flare/vis/operatorVisualization/flare/vis/VisualizationAgglomerativeCluster/flare/analytics/cluster/AgglomerativeClusterCommunityStructure/flare/analytics/cluster/CommunityStructureHierarchicalCluster/flare/analytics/cluster/HierarchicalClusterMergeEdge/flare/analytics/cluster/MergeEdgeBetweennessCentrality/flare/analytics/graph/BetweennessCentralityLinkDistance/flare/analytics/graph/LinkDistanceMaxFlowMinCut/flare/analytics/graph/MaxFlowMinCutShortestPaths/flare/analytics/graph/ShortestPathsSpanningTree/flare/analytics/graph/SpanningTreeAspectRatioBanker/flare/analytics/optimization/AspectRatioBankerArrayInterpolator/flare/animate/interpolate/ArrayInterpolatorColorInterpolator/flare/animate/interpolate/ColorInterpolatorDateInterpolator/flare/animate/interpolate/DateInterpolatorInterpolator/flare/animate/interpolate/InterpolatorMatrixInterpolator/flare/animate/interpolate/MatrixInterpolatorNumberInterpolator/flare/animate/interpolate/NumberInterpolatorObjectInterpolator/flare/animate/interpolate/ObjectInterpolatorPointInterpolator/flare/animate/interpolate/PointInterpolatorRectangleInterpolator/flare/animate/interpolate/RectangleInterpolatorConverters/flare/data/converters/ConvertersDelimitedTextConverter/flare/data/converters/DelimitedTextConverterGraphMLConverter/flare/data/converters/GraphMLConverterIDataConverter/flare/data/converters/IDataConverterJSONConverter/flare/data/converters/JSONConverteradd/flare/query/methods/addand/flare/query/methods/andaverage/flare/query/methods/averagecount/flare/query/methods/countdistinct/flare/query/methods/distinctdiv/flare/query/methods/diveq/flare/query/methods/eqfn/flare/query/methods/fngt/flare/query/methods/gtgte/flare/query/methods/gteiff/flare/query/methods/iffisa/flare/query/methods/isalt/flare/query/methods/ltlte/flare/query/methods/ltemax/flare/query/methods/maxmin/flare/query/methods/minmod/flare/query/methods/modmul/flare/query/methods/mulneq/flare/query/methods/neqnot/flare/query/methods/notor/flare/query/methods/ororderby/flare/query/methods/orderbyrange/flare/query/methods/rangeselect/flare/query/methods/selectstddev/flare/query/methods/stddevsub/flare/query/methods/subsum/flare/query/methods/sumupdate/flare/query/methods/updatevariance/flare/query/methods/variancewhere/flare/query/methods/wherexor/flare/query/methods/xor_/flare/query/methods/_FibonacciHeap/flare/util/heap/FibonacciHeapHeapNode/flare/util/heap/HeapNodeDenseMatrix/flare/util/math/DenseMatrixIMatrix/flare/util/math/IMatrixSparseMatrix/flare/util/math/SparseMatrixColorPalette/flare/util/palette/ColorPalettePalette/flare/util/palette/PaletteShapePalette/flare/util/palette/ShapePaletteSizePalette/flare/util/palette/SizePaletteAxes/flare/vis/axis/AxesAxis/flare/vis/axis/AxisAxisGridLine/flare/vis/axis/AxisGridLineAxisLabel/flare/vis/axis/AxisLabelCartesianAxes/flare/vis/axis/CartesianAxesAnchorControl/flare/vis/controls/AnchorControlClickControl/flare/vis/controls/ClickControlControl/flare/vis/controls/ControlControlList/flare/vis/controls/ControlListDragControl/flare/vis/controls/DragControlExpandControl/flare/vis/controls/ExpandControlHoverControl/flare/vis/controls/HoverControlIControl/flare/vis/controls/IControlPanZoomControl/flare/vis/controls/PanZoomControlSelectionControl/flare/vis/controls/SelectionControlTooltipControl/flare/vis/controls/TooltipControlData/flare/vis/data/DataDataList/flare/vis/data/DataListDataSprite/flare/vis/data/DataSpriteEdgeSprite/flare/vis/data/EdgeSpriteNodeSprite/flare/vis/data/NodeSpriterender/flare/vis/data/renderScaleBinding/flare/vis/data/ScaleBindingTree/flare/vis/data/TreeTreeBuilder/flare/vis/data/TreeBuilderDataEvent/flare/vis/events/DataEventSelectionEvent/flare/vis/events/SelectionEventTooltipEvent/flare/vis/events/TooltipEventVisualizationEvent/flare/vis/events/VisualizationEventLegend/flare/vis/legend/LegendLegendItem/flare/vis/legend/LegendItemLegendRange/flare/vis/legend/LegendRangedistortion/flare/vis/operator/distortionencoder/flare/vis/operator/encoderfilter/flare/vis/operator/filterIOperator/flare/vis/operator/IOperatorlabel/flare/vis/operator/labellayout/flare/vis/operator/layoutOperator/flare/vis/operator/OperatorOperatorList/flare/vis/operator/OperatorListOperatorSequence/flare/vis/operator/OperatorSequenceOperatorSwitch/flare/vis/operator/OperatorSwitchSortOperator/flare/vis/operator/SortOperatorArrowType/flare/vis/data/render/ArrowTypeEdgeRenderer/flare/vis/data/render/EdgeRendererIRenderer/flare/vis/data/render/IRendererShapeRenderer/flare/vis/data/render/ShapeRendererBifocalDistortion/flare/vis/operator/distortion/BifocalDistortionDistortion/flare/vis/operator/distortion/DistortionFisheyeDistortion/flare/vis/operator/distortion/FisheyeDistortionColorEncoder/flare/vis/operator/encoder/ColorEncoderEncoder/flare/vis/operator/encoder/EncoderPropertyEncoder/flare/vis/operator/encoder/PropertyEncoderShapeEncoder/flare/vis/operator/encoder/ShapeEncoderSizeEncoder/flare/vis/operator/encoder/SizeEncoderFisheyeTreeFilter/flare/vis/operator/filter/FisheyeTreeFilterGraphDistanceFilter/flare/vis/operator/filter/GraphDistanceFilterVisibilityFilter/flare/vis/operator/filter/VisibilityFilterLabeler/flare/vis/operator/label/LabelerRadialLabeler/flare/vis/operator/label/RadialLabelerStackedAreaLabeler/flare/vis/operator/label/StackedAreaLabelerAxisLayout/flare/vis/operator/layout/AxisLayoutBundledEdgeRouter/flare/vis/operator/layout/BundledEdgeRouterCircleLayout/flare/vis/operator/layout/CircleLayoutCirclePackingLayout/flare/vis/operator/layout/CirclePackingLayoutDendrogramLayout/flare/vis/operator/layout/DendrogramLayoutForceDirectedLayout/flare/vis/operator/layout/ForceDirectedLayoutIcicleTreeLayout/flare/vis/operator/layout/IcicleTreeLayoutIndentedTreeLayout/flare/vis/operator/layout/IndentedTreeLayoutLayout/flare/vis/operator/layout/LayoutNodeLinkTreeLayout/flare/vis/operator/layout/NodeLinkTreeLayoutPieLayout/flare/vis/operator/layout/PieLayoutRadialTreeLayout/flare/vis/operator/layout/RadialTreeLayoutRandomLayout/flare/vis/operator/layout/RandomLayoutStackedAreaLayout/flare/vis/operator/layout/StackedAreaLayoutTreeMapLayout/flare/vis/operator/layout/TreeMapLayout + + flare/flare + analytics/flare/analytics + animate/flare/animate + data/flare/data + display/flare/display + flex/flare/flex + physics/flare/physics + query/flare/query + scale/flare/scale + util/flare/util + vis/flare/vis + cluster/flare/analytics/cluster + graph/flare/analytics/graph + optimization/flare/analytics/optimization + Easing/flare/animate/Easing + FunctionSequence/flare/animate/FunctionSequence + interpolate/flare/animate/interpolate + ISchedulable/flare/animate/ISchedulable + Parallel/flare/animate/Parallel + Pause/flare/animate/Pause + Scheduler/flare/animate/Scheduler + Sequence/flare/animate/Sequence + Transition/flare/animate/Transition + Transitioner/flare/animate/Transitioner + TransitionEvent/flare/animate/TransitionEvent + Tween/flare/animate/Tween + converters/flare/data/converters + DataField/flare/data/DataField + DataSchema/flare/data/DataSchema + DataSet/flare/data/DataSet + DataSource/flare/data/DataSource + DataTable/flare/data/DataTable + DataUtil/flare/data/DataUtil + DirtySprite/flare/display/DirtySprite + LineSprite/flare/display/LineSprite + RectSprite/flare/display/RectSprite + TextSprite/flare/display/TextSprite + FlareVis/flare/flex/FlareVis + DragForce/flare/physics/DragForce + GravityForce/flare/physics/GravityForce + IForce/flare/physics/IForce + NBodyForce/flare/physics/NBodyForce + Particle/flare/physics/Particle + Simulation/flare/physics/Simulation + Spring/flare/physics/Spring + SpringForce/flare/physics/SpringForce + AggregateExpression/flare/query/AggregateExpression + And/flare/query/And + Arithmetic/flare/query/Arithmetic + Average/flare/query/Average + BinaryExpression/flare/query/BinaryExpression + Comparison/flare/query/Comparison + CompositeExpression/flare/query/CompositeExpression + Count/flare/query/Count + DateUtil/flare/query/DateUtil + Distinct/flare/query/Distinct + Expression/flare/query/Expression + ExpressionIterator/flare/query/ExpressionIterator + Fn/flare/query/Fn + If/flare/query/If + IsA/flare/query/IsA + Literal/flare/query/Literal + Match/flare/query/Match + Maximum/flare/query/Maximum + methods/flare/query/methods + Minimum/flare/query/Minimum + Not/flare/query/Not + Or/flare/query/Or + Query/flare/query/Query + Range/flare/query/Range + StringUtil/flare/query/StringUtil + Sum/flare/query/Sum + Variable/flare/query/Variable + Variance/flare/query/Variance + Xor/flare/query/Xor + IScaleMap/flare/scale/IScaleMap + LinearScale/flare/scale/LinearScale + LogScale/flare/scale/LogScale + OrdinalScale/flare/scale/OrdinalScale + QuantileScale/flare/scale/QuantileScale + QuantitativeScale/flare/scale/QuantitativeScale + RootScale/flare/scale/RootScale + Scale/flare/scale/Scale + ScaleType/flare/scale/ScaleType + TimeScale/flare/scale/TimeScale + Arrays/flare/util/Arrays + Colors/flare/util/Colors + Dates/flare/util/Dates + Displays/flare/util/Displays + Filter/flare/util/Filter + Geometry/flare/util/Geometry + heap/flare/util/heap + IEvaluable/flare/util/IEvaluable + IPredicate/flare/util/IPredicate + IValueProxy/flare/util/IValueProxy + math/flare/util/math + Maths/flare/util/Maths + Orientation/flare/util/Orientation + palette/flare/util/palette + Property/flare/util/Property + Shapes/flare/util/Shapes + Sort/flare/util/Sort + Stats/flare/util/Stats + Strings/flare/util/Strings + axis/flare/vis/axis + controls/flare/vis/controls + data/flare/vis/data + events/flare/vis/events + legend/flare/vis/legend + operator/flare/vis/operator + Visualization/flare/vis/Visualization + AgglomerativeCluster/flare/analytics/cluster/AgglomerativeCluster + CommunityStructure/flare/analytics/cluster/CommunityStructure + HierarchicalCluster/flare/analytics/cluster/HierarchicalCluster + MergeEdge/flare/analytics/cluster/MergeEdge + BetweennessCentrality/flare/analytics/graph/BetweennessCentrality + LinkDistance/flare/analytics/graph/LinkDistance + MaxFlowMinCut/flare/analytics/graph/MaxFlowMinCut + ShortestPaths/flare/analytics/graph/ShortestPaths + SpanningTree/flare/analytics/graph/SpanningTree + AspectRatioBanker/flare/analytics/optimization/AspectRatioBanker + ArrayInterpolator/flare/animate/interpolate/ArrayInterpolator + ColorInterpolator/flare/animate/interpolate/ColorInterpolator + DateInterpolator/flare/animate/interpolate/DateInterpolator + Interpolator/flare/animate/interpolate/Interpolator + MatrixInterpolator/flare/animate/interpolate/MatrixInterpolator + NumberInterpolator/flare/animate/interpolate/NumberInterpolator + ObjectInterpolator/flare/animate/interpolate/ObjectInterpolator + PointInterpolator/flare/animate/interpolate/PointInterpolator + RectangleInterpolator/flare/animate/interpolate/RectangleInterpolator + Converters/flare/data/converters/Converters + DelimitedTextConverter/flare/data/converters/DelimitedTextConverter + GraphMLConverter/flare/data/converters/GraphMLConverter + IDataConverter/flare/data/converters/IDataConverter + JSONConverter/flare/data/converters/JSONConverter + add/flare/query/methods/add + and/flare/query/methods/and + average/flare/query/methods/average + count/flare/query/methods/count + distinct/flare/query/methods/distinct + div/flare/query/methods/div + eq/flare/query/methods/eq + fn/flare/query/methods/fn + gt/flare/query/methods/gt + gte/flare/query/methods/gte + iff/flare/query/methods/iff + isa/flare/query/methods/isa + lt/flare/query/methods/lt + lte/flare/query/methods/lte + max/flare/query/methods/max + min/flare/query/methods/min + mod/flare/query/methods/mod + mul/flare/query/methods/mul + neq/flare/query/methods/neq + not/flare/query/methods/not + or/flare/query/methods/or + orderby/flare/query/methods/orderby + range/flare/query/methods/range + select/flare/query/methods/select + stddev/flare/query/methods/stddev + sub/flare/query/methods/sub + sum/flare/query/methods/sum + update/flare/query/methods/update + variance/flare/query/methods/variance + where/flare/query/methods/where + xor/flare/query/methods/xor + _/flare/query/methods/_ + FibonacciHeap/flare/util/heap/FibonacciHeap + HeapNode/flare/util/heap/HeapNode + DenseMatrix/flare/util/math/DenseMatrix + IMatrix/flare/util/math/IMatrix + SparseMatrix/flare/util/math/SparseMatrix + ColorPalette/flare/util/palette/ColorPalette + Palette/flare/util/palette/Palette + ShapePalette/flare/util/palette/ShapePalette + SizePalette/flare/util/palette/SizePalette + Axes/flare/vis/axis/Axes + Axis/flare/vis/axis/Axis + AxisGridLine/flare/vis/axis/AxisGridLine + AxisLabel/flare/vis/axis/AxisLabel + CartesianAxes/flare/vis/axis/CartesianAxes + AnchorControl/flare/vis/controls/AnchorControl + ClickControl/flare/vis/controls/ClickControl + Control/flare/vis/controls/Control + ControlList/flare/vis/controls/ControlList + DragControl/flare/vis/controls/DragControl + ExpandControl/flare/vis/controls/ExpandControl + HoverControl/flare/vis/controls/HoverControl + IControl/flare/vis/controls/IControl + PanZoomControl/flare/vis/controls/PanZoomControl + SelectionControl/flare/vis/controls/SelectionControl + TooltipControl/flare/vis/controls/TooltipControl + Data/flare/vis/data/Data + DataList/flare/vis/data/DataList + DataSprite/flare/vis/data/DataSprite + EdgeSprite/flare/vis/data/EdgeSprite + NodeSprite/flare/vis/data/NodeSprite + render/flare/vis/data/render + ScaleBinding/flare/vis/data/ScaleBinding + Tree/flare/vis/data/Tree + TreeBuilder/flare/vis/data/TreeBuilder + DataEvent/flare/vis/events/DataEvent + SelectionEvent/flare/vis/events/SelectionEvent + TooltipEvent/flare/vis/events/TooltipEvent + VisualizationEvent/flare/vis/events/VisualizationEvent + Legend/flare/vis/legend/Legend + LegendItem/flare/vis/legend/LegendItem + LegendRange/flare/vis/legend/LegendRange + distortion/flare/vis/operator/distortion + encoder/flare/vis/operator/encoder + filter/flare/vis/operator/filter + IOperator/flare/vis/operator/IOperator + label/flare/vis/operator/label + layout/flare/vis/operator/layout + Operator/flare/vis/operator/Operator + OperatorList/flare/vis/operator/OperatorList + OperatorSequence/flare/vis/operator/OperatorSequence + OperatorSwitch/flare/vis/operator/OperatorSwitch + SortOperator/flare/vis/operator/SortOperator + ArrowType/flare/vis/data/render/ArrowType + EdgeRenderer/flare/vis/data/render/EdgeRenderer + IRenderer/flare/vis/data/render/IRenderer + ShapeRenderer/flare/vis/data/render/ShapeRenderer + BifocalDistortion/flare/vis/operator/distortion/BifocalDistortion + Distortion/flare/vis/operator/distortion/Distortion + FisheyeDistortion/flare/vis/operator/distortion/FisheyeDistortion + ColorEncoder/flare/vis/operator/encoder/ColorEncoder + Encoder/flare/vis/operator/encoder/Encoder + PropertyEncoder/flare/vis/operator/encoder/PropertyEncoder + ShapeEncoder/flare/vis/operator/encoder/ShapeEncoder + SizeEncoder/flare/vis/operator/encoder/SizeEncoder + FisheyeTreeFilter/flare/vis/operator/filter/FisheyeTreeFilter + GraphDistanceFilter/flare/vis/operator/filter/GraphDistanceFilter + VisibilityFilter/flare/vis/operator/filter/VisibilityFilter + Labeler/flare/vis/operator/label/Labeler + RadialLabeler/flare/vis/operator/label/RadialLabeler + StackedAreaLabeler/flare/vis/operator/label/StackedAreaLabeler + AxisLayout/flare/vis/operator/layout/AxisLayout + BundledEdgeRouter/flare/vis/operator/layout/BundledEdgeRouter + CircleLayout/flare/vis/operator/layout/CircleLayout + CirclePackingLayout/flare/vis/operator/layout/CirclePackingLayout + DendrogramLayout/flare/vis/operator/layout/DendrogramLayout + ForceDirectedLayout/flare/vis/operator/layout/ForceDirectedLayout + IcicleTreeLayout/flare/vis/operator/layout/IcicleTreeLayout + IndentedTreeLayout/flare/vis/operator/layout/IndentedTreeLayout + Layout/flare/vis/operator/layout/Layout + NodeLinkTreeLayout/flare/vis/operator/layout/NodeLinkTreeLayout + PieLayout/flare/vis/operator/layout/PieLayout + RadialTreeLayout/flare/vis/operator/layout/RadialTreeLayout + RandomLayout/flare/vis/operator/layout/RandomLayout + StackedAreaLayout/flare/vis/operator/layout/StackedAreaLayout + TreeMapLayout/flare/vis/operator/layout/TreeMapLayout + \ No newline at end of file diff --git a/test/output/footballCoverage.svg b/test/output/footballCoverage.svg index 05f2a4ee5f..f3e4902dec 100644 --- a/test/output/footballCoverage.svg +++ b/test/output/footballCoverage.svg @@ -13,332 +13,404 @@ white-space: pre; } - - - 0% - + + + C2 - - 5% - + + + + + + + + + + + + - - 10% - + + + + + + + + + + + + - - 15% - + + 0% + 5% + 10% + 15% + 20% + 25% + 30% + 35% + 40% + 45% + 50% - - 20% - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - 25% - + + + + C3 - - 30% - + + + + + + + + + + + + - - 35% - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - 40% - + + + + C4 - - 45% - + + + + + + + + + + + + - - 50% - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - C2 + + + M0 - - C3 + + + + + + + + + + + + - - C4 - - - M0 + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - M1 + + + + M1 - - M2 + + + + + + + + + + + + - - T2 - coverage - - - + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + M2 - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + - - - + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + T2 - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + - - - + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + coverage + \ No newline at end of file diff --git a/test/output/fruitSales.svg b/test/output/fruitSales.svg index 8120163833..ba70fb80a8 100644 --- a/test/output/fruitSales.svg +++ b/test/output/fruitSales.svg @@ -13,54 +13,46 @@ white-space: pre; } - - - bananas - - - oranges - - - grapes - - - apples - + + + + + - - - 0 - - - 2 - - - 4 - - - 6 - - - 8 - - - 10 - - - 12 - - - 14 - - - 16 - - - 18 - - - 20 - units → + + bananas + oranges + grapes + apples + + + + + + + + + + + + + + + + 0 + 2 + 4 + 6 + 8 + 10 + 12 + 14 + 16 + 18 + 20 + + + units → diff --git a/test/output/fruitSalesDate.svg b/test/output/fruitSalesDate.svg index 15a1aa5900..4425c34153 100644 --- a/test/output/fruitSalesDate.svg +++ b/test/output/fruitSalesDate.svg @@ -13,36 +13,37 @@ white-space: pre; } - - - 0 - - - 5 - - - 10 - - - 15 - - - 20 - - - 25 - - - 30 - ↑ units - - - - 2021-03-15 - - - 2021-03-16 - date + + + + + + + + + + + 0 + 5 + 10 + 15 + 20 + 25 + 30 + + + ↑ units + + + + + + + 2021-03-15 + 2021-03-16 + + + date @@ -53,5 +54,13 @@ - applesorangesgrapesapplesorangesgrapesbananas + + apples + oranges + grapes + apples + oranges + grapes + bananas + \ No newline at end of file diff --git a/test/output/functionContour.svg b/test/output/functionContour.svg index d1d8ae818b..eeaac7e3c8 100644 --- a/test/output/functionContour.svg +++ b/test/output/functionContour.svg @@ -13,54 +13,43 @@ white-space: pre; } - - - 0 - - - 1 - - - 2 - - - 3 - - - 4 - - - 5 - - - 6 - - - 7 - + + + + + + + + + - - - 0 - - - 2 - - - 4 - - - 6 - - - 8 - - - 10 - - - 12 - + + 0 + 1 + 2 + 3 + 4 + 5 + 6 + 7 + + + + + + + + + + + + 0 + 2 + 4 + 6 + 8 + 10 + 12 diff --git a/test/output/functionContourFaceted.svg b/test/output/functionContourFaceted.svg index 2cf41d5a2c..b6cf96d73e 100644 --- a/test/output/functionContourFaceted.svg +++ b/test/output/functionContourFaceted.svg @@ -13,148 +13,132 @@ white-space: pre; } - - - cos - - - lin - - - - - lin - - - sin - - - - - 0 - - - 2 - - - 4 - - - 6 - - - 8 - - - 10 - - - 12 + + + lin + + + + + + + + + + + + 0 + 2 + 4 + 6 + 8 + 10 + 12 + + + + + + + + + + + + + - - - 0 - - - 2 - - - 4 - - - 6 - - - 8 - - - 10 - - - 12 + + + + + + + + + + + + 0 + 2 + 4 + 6 + 8 + 10 + 12 + + + + + + + + 0 + 5 + 10 + + + + + + + + + + + + + - - - 0 - - - 5 + + + cos - - 10 + + sin + + + + + + + + + + + + + - - - 0 + + + lin - - 5 + + + + - - 10 + + 0 + 5 + 10 - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + \ No newline at end of file diff --git a/test/output/functionContourFaceted2.svg b/test/output/functionContourFaceted2.svg index 722b661a44..e2b7f44fd5 100644 --- a/test/output/functionContourFaceted2.svg +++ b/test/output/functionContourFaceted2.svg @@ -13,148 +13,132 @@ white-space: pre; } - - - cos - - - lin - - - - - lin - - - sin - - - - - 0 - - - 2 - - - 4 - - - 6 - - - 8 - - - 10 - - - 12 + + + lin + + + + + + + + + + + + 0 + 2 + 4 + 6 + 8 + 10 + 12 + + + + + + + + + + + + + - - - 0 - - - 2 - - - 4 - - - 6 - - - 8 - - - 10 - - - 12 + + + + + + + + + + + + 0 + 2 + 4 + 6 + 8 + 10 + 12 + + + + + + + + 0 + 5 + 10 + + + + + + + + + + + + + - - - 0 - - - 5 + + + cos - - 10 + + sin + + + + + + + + + + + + + - - - 0 + + + lin - - 5 + + + + - - 10 + + 0 + 5 + 10 - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + \ No newline at end of file diff --git a/test/output/gistempAnomaly.svg b/test/output/gistempAnomaly.svg index 8817400f42..093eb9884c 100644 --- a/test/output/gistempAnomaly.svg +++ b/test/output/gistempAnomaly.svg @@ -13,70 +13,62 @@ white-space: pre; } - - - - −0.6 - - - - −0.4 - - - - −0.2 - - - - +0.0 - - - - +0.2 - - - - +0.4 - - - - +0.6 - - - - +0.8 - - - - +1.0 - - - - +1.2 - ↑ Temperature anomaly (°C) + + + + + + + + + + + + + + + + + + + + + + + + + + −0.6 + −0.4 + −0.2 + +0.0 + +0.2 + +0.4 + +0.6 + +0.8 + +1.0 + +1.2 + + + ↑ Temperature anomaly (°C) + + + + + + + + + - - - 1880 - - - 1900 - - - 1920 - - - 1940 - - - 1960 - - - 1980 - - - 2000 - + + 1880 + 1900 + 1920 + 1940 + 1960 + 1980 + 2000 diff --git a/test/output/gistempAnomalyMoving.svg b/test/output/gistempAnomalyMoving.svg index e127d2167a..57c2a4d765 100644 --- a/test/output/gistempAnomalyMoving.svg +++ b/test/output/gistempAnomalyMoving.svg @@ -13,70 +13,62 @@ white-space: pre; } - - - - −0.6 - - - - −0.4 - - - - −0.2 - - - - +0.0 - - - - +0.2 - - - - +0.4 - - - - +0.6 - - - - +0.8 - - - - +1.0 - - - - +1.2 - ↑ Temperature anomaly (°C) + + + + + + + + + + + + + + + + + + + + + + + + + + −0.6 + −0.4 + −0.2 + +0.0 + +0.2 + +0.4 + +0.6 + +0.8 + +1.0 + +1.2 + + + ↑ Temperature anomaly (°C) + + + + + + + + + - - - 1880 - - - 1900 - - - 1920 - - - 1940 - - - 1960 - - - 1980 - - - 2000 - + + 1880 + 1900 + 1920 + 1940 + 1960 + 1980 + 2000 diff --git a/test/output/gistempAnomalyTransform.svg b/test/output/gistempAnomalyTransform.svg index 18de62526f..504b9de015 100644 --- a/test/output/gistempAnomalyTransform.svg +++ b/test/output/gistempAnomalyTransform.svg @@ -13,58 +13,53 @@ white-space: pre; } - - - - −1.0 - - - - −0.5 - - - - +0.0 - - - - +0.5 - - - - +1.0 - - - - +1.5 - - - - +2.0 - ↑ Temperature anomaly (°F) + + + + + + + + + + + + + + + + + + + + −1.0 + −0.5 + +0.0 + +0.5 + +1.0 + +1.5 + +2.0 + + + ↑ Temperature anomaly (°F) + + + + + + + + + - - - 1880 - - - 1900 - - - 1920 - - - 1940 - - - 1960 - - - 1980 - - - 2000 - + + 1880 + 1900 + 1920 + 1940 + 1960 + 1980 + 2000 diff --git a/test/output/googleTrendsRidgeline.svg b/test/output/googleTrendsRidgeline.svg index 960267d91c..deb225ade6 100644 --- a/test/output/googleTrendsRidgeline.svg +++ b/test/output/googleTrendsRidgeline.svg @@ -13,940 +13,928 @@ white-space: pre; } - - - Australian bushfires + + + Australian bushfires - - Qasem Soleimani + + + + + + + + + + + + + - - Prince Harry, Meghan + + 2020 + February + March + April + May + June + July + August + September + October + November + December - - Brexit - - - Impeachment - - - Kobe Bryant - - - Wuhan - - - Nancy Pelosi - - - Parasite - - - Roger Stone - - - Democratic primaries - - - Love Is Blind - - - Stock market - - - Tom Hanks - - - Trump coronavirus - - - Locust - - - Martial law - - - Toilet paper - - - Animal Crossing - - - Anthony Fauci - - - COVID-19 - - - Tiger King - - - Zoom Video Communications - - - Masks - - - Stimulus check - - - Sourdough - - - The Last Dance - - - Kim Jong-un - - - Murder hornet - - - SpaceX - - - Black Lives Matter - - - George Floyd - - - Ghislaine Maxwell - - - TikTok - - - Taylor Swift - - - Hydroxychloroquine - - - John Lewis - - - Regis Philbin - - - William Barr - - - Beirut explosion - - - Kamala Harris - - - QAnon - - - Chadwick Boseman - - - Hurricane Laura - - - Jacob Blake - - - Naomi Osaka - - - Wildfires - - - Hurricane Teddy - - - Ruth Bader Ginsburg - - - Breonna Taylor - - - Presidential debates - - - Proud Boys - - - Eddie Van Halen - - - Amy Coney Barrett - - - Hunter Biden - - - Absentee ballot - - - Joe Biden - - - Voter turnout - - - Alex Trebek - - - Electoral fraud - - - Four seasons total landscaping - - - Hurricane Iota - - - Rudy Giuliani - - - COVID-19 vaccine - - - - - 2020 - - - February - - - March - - - April - - - May - - - June - - - July - - - August - - - September - - - October - - - November - - - December - - - - + - + - + - + + + Qasem Soleimani + - + - + - + - + + + Prince Harry, Meghan + - + - + - + - + + + Brexit + - + - + - + - + + + Impeachment + - + - + - + - + + + Kobe Bryant + - + - + - + - + + + Wuhan + - + - + - + - + + + Nancy Pelosi + - + - + - + - + + + Parasite + - + - + - + - + + + Roger Stone + - + - + - + - + + + Democratic primaries + - + - + - + - + + + Love Is Blind + - + - + - + - + + + Stock market + - + - + - + - + + + Tom Hanks + - + - + - + - + + + Trump coronavirus + - + - + - + - + + + Locust + - + - + - + - + + + Martial law + - + - + - + - + + + Toilet paper + - + - + - + - + + + Animal Crossing + - + - + - + - + + + Anthony Fauci + - + - + - + - + + + COVID-19 + - + - + - + - + + + Tiger King + - + - + - + - + + + Zoom Video Communications + - + - + - + - + + + Masks + - + - + - + - + + + Stimulus check + - + - + - + - + + + Sourdough + - + - + - + - + + + The Last Dance + - + - + - + - + + + Kim Jong-un + - + - + - + - + + + Murder hornet + - + - + - + - + + + SpaceX + - + - + - + - + + + Black Lives Matter + - + - + - + - + + + George Floyd + - + - + - + - + + + Ghislaine Maxwell + - + - + - + - + + + TikTok + - + - + - + - + + + Taylor Swift + - + - + - + - + + + Hydroxychloroquine + - + - + - + - + + + John Lewis + - + - + - + - + + + Regis Philbin + - + - + - + - + + + William Barr + - + - + - + - + + + Beirut explosion + - + - + - + - + + + Kamala Harris + - + - + - + - + + + QAnon + - + - + - + - + + + Chadwick Boseman + - + - + - + - + + + Hurricane Laura + - + - + - + - + + + Jacob Blake + - + - + - + - + + + Naomi Osaka + - + - + - + - + + + Wildfires + - + - + - + - + + + Hurricane Teddy + - + - + - + - + + + Ruth Bader Ginsburg + - + - + - + - + + + Breonna Taylor + - + - + - + - + + + Presidential debates + - + - + - + - + + + Proud Boys + - + - + - + - + + + Eddie Van Halen + - + - + - + - + + + Amy Coney Barrett + - + - + - + - + + + Hunter Biden + - + - + - + - + + + Absentee ballot + - + - + - + - + + + Joe Biden + - + - + - + - + + + Voter turnout + - + - + - + - + + + Alex Trebek + - + - + - + - + + + Electoral fraud + - + - + - + - + + + Four seasons total landscaping + - + - + - + - + + + Hurricane Iota + - + - + - + - + + + Rudy Giuliani + - + - + - + - + + + COVID-19 vaccine + - + - + - + \ No newline at end of file diff --git a/test/output/greekGods.svg b/test/output/greekGods.svg index 30882386d9..8e88e87ec0 100644 --- a/test/output/greekGods.svg +++ b/test/output/greekGods.svg @@ -23,30 +23,23 @@ - - /Chaos - - - /Chaos/Eros - - - /Chaos/Erebus - - - /Chaos/Tartarus - - - /Chaos/Gaia - - - /Chaos/Gaia/Mountains - - - /Chaos/Gaia/Pontus - - - /Chaos/Gaia/Uranus - + /Chaos + /Chaos/Eros + /Chaos/Erebus + /Chaos/Tartarus + /Chaos/Gaia + /Chaos/Gaia/Mountains + /Chaos/Gaia/Pontus + /Chaos/Gaia/Uranus + + + Chaos/Chaos + Eros/Chaos/Eros + Erebus/Chaos/Erebus + Tartarus/Chaos/Tartarus + Gaia/Chaos/Gaia + Mountains/Chaos/Gaia/Mountains + Pontus/Chaos/Gaia/Pontus + Uranus/Chaos/Gaia/Uranus - Chaos/ChaosEros/Chaos/ErosErebus/Chaos/ErebusTartarus/Chaos/TartarusGaia/Chaos/GaiaMountains/Chaos/Gaia/MountainsPontus/Chaos/Gaia/PontusUranus/Chaos/Gaia/Uranus \ No newline at end of file diff --git a/test/output/gridChoropleth.svg b/test/output/gridChoropleth.svg index 62ea63e7ef..1e8a864b02 100644 --- a/test/output/gridChoropleth.svg +++ b/test/output/gridChoropleth.svg @@ -66,6 +66,110 @@ - CATXFLNYPAILOHGANCMINJVAWAAZMATNINMOMDWICOMNSCALLAKYOROKCTUTIANVARMSKSNMNEWVIDHINHMEMTRIDESDNDAKDCVTWY - +6%+15%+14%+0%+1%−1%+1%+10%+10%+1%+1%+7%+13%+14%+6%+8%+4%+2%+5%+2%+15%+6%+11%+3%+3%+3%+10%+5%−0%+16%+4%+14%+3%+0%+2%+2%+6%−3%+14%+4%+3%+1%+8%+1%+8%+9%+13%+3%+17%−0%+3% + + CA + TX + FL + NY + PA + IL + OH + GA + NC + MI + NJ + VA + WA + AZ + MA + TN + IN + MO + MD + WI + CO + MN + SC + AL + LA + KY + OR + OK + CT + UT + IA + NV + AR + MS + KS + NM + NE + WV + ID + HI + NH + ME + MT + RI + DE + SD + ND + AK + DC + VT + WY + + + +6% + +15% + +14% + +0% + +1% + −1% + +1% + +10% + +10% + +1% + +1% + +7% + +13% + +14% + +6% + +8% + +4% + +2% + +5% + +2% + +15% + +6% + +11% + +3% + +3% + +3% + +10% + +5% + −0% + +16% + +4% + +14% + +3% + +0% + +2% + +2% + +6% + −3% + +14% + +4% + +3% + +1% + +8% + +1% + +8% + +9% + +13% + +3% + +17% + −0% + +3% + \ No newline at end of file diff --git a/test/output/gridChoroplethDx.svg b/test/output/gridChoroplethDx.svg index af18a39732..0a84911db1 100644 --- a/test/output/gridChoroplethDx.svg +++ b/test/output/gridChoroplethDx.svg @@ -119,6 +119,110 @@ - CATXFLNYPAILOHGANCMINJVAWAAZMATNINMOMDWICOMNSCALLAKYOROKCTUTIANVARMSKSNMNEWVIDHINHMEMTRIDESDNDAKDCVTWY - +6%+15%+14%+0%+1%−1%+1%+10%+10%+1%+1%+7%+13%+14%+6%+8%+4%+2%+5%+2%+15%+6%+11%+3%+3%+3%+10%+5%−0%+16%+4%+14%+3%+0%+2%+2%+6%−3%+14%+4%+3%+1%+8%+1%+8%+9%+13%+3%+17%−0%+3% + + CA + TX + FL + NY + PA + IL + OH + GA + NC + MI + NJ + VA + WA + AZ + MA + TN + IN + MO + MD + WI + CO + MN + SC + AL + LA + KY + OR + OK + CT + UT + IA + NV + AR + MS + KS + NM + NE + WV + ID + HI + NH + ME + MT + RI + DE + SD + ND + AK + DC + VT + WY + + + +6% + +15% + +14% + +0% + +1% + −1% + +1% + +10% + +10% + +1% + +1% + +7% + +13% + +14% + +6% + +8% + +4% + +2% + +5% + +2% + +15% + +6% + +11% + +3% + +3% + +3% + +10% + +5% + −0% + +16% + +4% + +14% + +3% + +0% + +2% + +2% + +6% + −3% + +14% + +4% + +3% + +1% + +8% + +1% + +8% + +9% + +13% + +3% + +17% + −0% + +3% + \ No newline at end of file diff --git a/test/output/groupedRects.svg b/test/output/groupedRects.svg index 442fe3bf57..1ab2d809de 100644 --- a/test/output/groupedRects.svg +++ b/test/output/groupedRects.svg @@ -13,72 +13,58 @@ white-space: pre; } - - - 0.0 - - - 0.1 - - - 0.2 - - - 0.3 - - - 0.4 - - - 0.5 - - - 0.6 - - - 0.7 - - - 0.8 - - - 0.9 - - - 1.0 - ↑ Frequency + + + + + + + + + + + + - - - A - - - B - - - C - - - D - - - E - - - F - - - G - - - H - - - I - - - J - + + 0.0 + 0.1 + 0.2 + 0.3 + 0.4 + 0.5 + 0.6 + 0.7 + 0.8 + 0.9 + 1.0 + + + ↑ Frequency + + + + + + + + + + + + + + + A + B + C + D + E + F + G + H + I + J diff --git a/test/output/hadcrutWarmingStripes.svg b/test/output/hadcrutWarmingStripes.svg index 1ea5910546..f6c043c161 100644 --- a/test/output/hadcrutWarmingStripes.svg +++ b/test/output/hadcrutWarmingStripes.svg @@ -13,34 +13,27 @@ white-space: pre; } - - - 1860 - - - 1880 - - - 1900 - - - 1920 - - - 1940 - - - 1960 - - - 1980 - - - 2000 - - - 2020 - + + + + + + + + + + + + + 1860 + 1880 + 1900 + 1920 + 1940 + 1960 + 1980 + 2000 + 2020 diff --git a/test/output/heatmap.svg b/test/output/heatmap.svg index 4a4ceef85b..56ff0eebec 100644 --- a/test/output/heatmap.svg +++ b/test/output/heatmap.svg @@ -13,54 +13,43 @@ white-space: pre; } - - - 0 - - - 1 - - - 2 - - - 3 - - - 4 - - - 5 - - - 6 - - - 7 - + + + + + + + + + - - - 0 - - - 2 - - - 4 - - - 6 - - - 8 - - - 10 - - - 12 - + + 0 + 1 + 2 + 3 + 4 + 5 + 6 + 7 + + + + + + + + + + + + 0 + 2 + 4 + 6 + 8 + 10 + 12 diff --git a/test/output/heatmapArray.svg b/test/output/heatmapArray.svg index 4a4ceef85b..56ff0eebec 100644 --- a/test/output/heatmapArray.svg +++ b/test/output/heatmapArray.svg @@ -13,54 +13,43 @@ white-space: pre; } - - - 0 - - - 1 - - - 2 - - - 3 - - - 4 - - - 5 - - - 6 - - - 7 - + + + + + + + + + - - - 0 - - - 2 - - - 4 - - - 6 - - - 8 - - - 10 - - - 12 - + + 0 + 1 + 2 + 3 + 4 + 5 + 6 + 7 + + + + + + + + + + + + 0 + 2 + 4 + 6 + 8 + 10 + 12 diff --git a/test/output/heatmapFaceted.svg b/test/output/heatmapFaceted.svg index 635d603d18..cb80d84132 100644 --- a/test/output/heatmapFaceted.svg +++ b/test/output/heatmapFaceted.svg @@ -13,112 +13,96 @@ white-space: pre; } - - - cos + + + lin + + + + + + + + + + + + 0 + 2 + 4 + 6 + 8 + 10 + 12 - - lin - - - - - lin - - - sin - - - - - 0 - - - 2 - - - 4 - - - 6 - - - 8 - - - 10 - - - 12 - - - - - 0 - - - 2 - - - 4 - - - 6 - - - 8 - - - 10 - - - 12 + + + - - - 0 - - - 5 + + + + + + + + + + + + 0 + 2 + 4 + 6 + 8 + 10 + 12 + + + + + + + + 0 + 5 + 10 - - 10 + + + - - - 0 + + + cos - - 5 + + sin - - 10 - - - - + - + - - - + + + lin - - - - - + + + + + + + 0 + 5 + 10 - - - - + - + \ No newline at end of file diff --git a/test/output/heatmapLog.svg b/test/output/heatmapLog.svg index 906b1678ab..340f4de176 100644 --- a/test/output/heatmapLog.svg +++ b/test/output/heatmapLog.svg @@ -13,63 +13,49 @@ white-space: pre; } - - - −2.5 - - - −2.0 - - - −1.5 - - - −1.0 - - - −0.5 - - - +0.0 - - - +0.5 - - - +1.0 - - - +1.5 - + + + + + + + + + + - - - −2.0 - - - −1.5 - - - −1.0 - - - −0.5 - - - +0.0 - - - +0.5 - - - +1.0 - - - +1.5 - - - +2.0 - + + −2.5 + −2.0 + −1.5 + −1.0 + −0.5 + +0.0 + +0.5 + +1.0 + +1.5 + + + + + + + + + + + + + + −2.0 + −1.5 + −1.0 + −0.5 + +0.0 + +0.5 + +1.0 + +1.5 + +2.0 diff --git a/test/output/hexbin.svg b/test/output/hexbin.svg index 537ef95f49..9a68c8e133 100644 --- a/test/output/hexbin.svg +++ b/test/output/hexbin.svg @@ -13,72 +13,61 @@ white-space: pre; } - - - 34 - - - 36 - - - 38 - - - 40 - - - 42 - - - 44 - - - 46 - - - 48 - - - 50 - - - 52 - - - 54 - - - 56 - - - 58 - ↑ culmen_length_mm + + + + + + + + + + + + + + - - - 14 - - - 15 - - - 16 - - - 17 - - - 18 - - - 19 - - - 20 - - - 21 - culmen_depth_mm → + + 34 + 36 + 38 + 40 + 42 + 44 + 46 + 48 + 50 + 52 + 54 + 56 + 58 + + + ↑ culmen_length_mm + + + + + + + + + + + + + 14 + 15 + 16 + 17 + 18 + 19 + 20 + 21 + + + culmen_depth_mm → diff --git a/test/output/hexbinOranges.svg b/test/output/hexbinOranges.svg index 78bbdec1df..9bb323604f 100644 --- a/test/output/hexbinOranges.svg +++ b/test/output/hexbinOranges.svg @@ -13,72 +13,61 @@ white-space: pre; } - - - 34 - - - 36 - - - 38 - - - 40 - - - 42 - - - 44 - - - 46 - - - 48 - - - 50 - - - 52 - - - 54 - - - 56 - - - 58 - ↑ culmen_length_mm + + + + + + + + + + + + + + - - - 14 - - - 15 - - - 16 - - - 17 - - - 18 - - - 19 - - - 20 - - - 21 - culmen_depth_mm → + + 34 + 36 + 38 + 40 + 42 + 44 + 46 + 48 + 50 + 52 + 54 + 56 + 58 + + + ↑ culmen_length_mm + + + + + + + + + + + + + 14 + 15 + 16 + 17 + 18 + 19 + 20 + 21 + + + culmen_depth_mm → diff --git a/test/output/hexbinR.html b/test/output/hexbinR.html index 9bfaac07c6..eaa30bc00e 100644 --- a/test/output/hexbinR.html +++ b/test/output/hexbinR.html @@ -16,18 +16,23 @@ - 0 + + 0 - 5 + + 5 - 10 + + 10 - 15 + + 15 - Proportion of each sex (%) + + Proportion of each sex (%) - - - 35 - - - 40 - - - 45 - - - 50 + + + FEMALE - - 55 - ↑ culmen_length_mm - - - - FEMALE + + + + + + - - MALE + + 35 + 40 + 45 + 50 + 55 - - - sex - - - - 14 + + + + + - - 16 + + 14 + 16 + 18 + 20 - - 18 + + + + + + + + - - 20 + + 9 + 8 + 8 + 8 + 6 + 6 + 6 + 5 + 5 + 5 + 5 + 4 + 4 + 4 + 3 + 3 + 3 + 3 + 3 + 3 + 3 + 2 + 2 + 2 + 2 + 2 + 2 + 2 + 2 + 2 + 2 + 2 + 2 + 2 + 2 + 2 + 2 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 - - - 14 + + + MALE - - 16 + + + + + - - 18 + + 14 + 16 + 18 + 20 - - 20 + + + + + + + + + + + 11 + 9 + 8 + 7 + 5 + 5 + 5 + 4 + 4 + 4 + 4 + 4 + 4 + 4 + 4 + 3 + 3 + 3 + 3 + 2 + 2 + 2 + 2 + 2 + 2 + 2 + 2 + 2 + 2 + 2 + 2 + 2 + 2 + 2 + 2 + 2 + 2 + 2 + 2 + 2 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 + 1 - - - 14 + + + + + + - - 16 + + 14 + 16 + 18 + 20 - - 18 + + + + + + + + - - 20 - culmen_depth_mm → - - - - - 8 - - - 8 - - - 7 - - - 7 - - - 7 - - - 6 - - - 6 - - - 6 - - - 5 - - - 5 - - - 5 - - - 5 - - - 5 - - - 4 - - - 4 - - - 3 - - - 3 - - - 3 - - - 3 - - - 3 - - - 3 - - - 2 - - - 2 - - - 2 - - - 2 - - - 2 - - - 2 - - - 2 - - - 2 - - - 2 - - - 2 - - - 2 - - - 2 - - - 2 - - - 2 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - + 2 + 1 + 1 + 1 + 1 + 1 + 1 + 1 - - - - - 11 - - - 10 - - - 9 - - - 8 - - - 6 - - - 6 - - - 5 - - - 5 - - - 4 - - - 4 - - - 3 - - - 3 - - - 3 - - - 3 - - - 3 - - - 3 - - - 3 - - - 3 - - - 3 - - - 3 - - - 3 - - - 3 - - - 3 - - - 2 - - - 2 - - - 2 - - - 2 - - - 2 - - - 2 - - - 2 - - - 2 - - - 2 - - - 2 - - - 2 - - - 2 - - - 2 - - - 2 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - + + sex - - - - - 2 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - - 1 - - + + ↑ culmen_length_mm + + + culmen_depth_mm → \ No newline at end of file diff --git a/test/output/hexbinSymbol.html b/test/output/hexbinSymbol.html index f49a13b9bb..d597be2509 100644 --- a/test/output/hexbinSymbol.html +++ b/test/output/hexbinSymbol.html @@ -57,93 +57,86 @@ white-space: pre; } - - - - 34 - - - - 36 - - - - 38 - - - - 40 - - - - 42 - - - - 44 - - - - 46 - - - - 48 - - - - 50 - - - - 52 - - - - 54 - - - - 56 - - - - 58 - ↑ culmen_length_mm + + + + + + + + + + + + + + - - - - 14 - - - - 15 - - - - 16 - - - - 17 - - - - 18 - - - - 19 - - - - 20 - - - - 21 - culmen_depth_mm → + + + + + + + + + + + + + + + + + 34 + 36 + 38 + 40 + 42 + 44 + 46 + 48 + 50 + 52 + 54 + 56 + 58 + + + ↑ culmen_length_mm + + + + + + + + + + + + + + + + + + + + + + + 14 + 15 + 16 + 17 + 18 + 19 + 20 + 21 + + + culmen_depth_mm → diff --git a/test/output/hexbinText.svg b/test/output/hexbinText.svg index df336f26ce..d5ecb24894 100644 --- a/test/output/hexbinText.svg +++ b/test/output/hexbinText.svg @@ -13,215 +13,368 @@ white-space: pre; } - - - 35 + + + FEMALE - - 40 + + + + + + - - 45 + + 35 + 40 + 45 + 50 + 55 - - 50 + + + + + - - 55 - ↑ culmen_length_mm - - - - FEMALE + + 14 + 16 + 18 + 20 - - MALE + + + + + + + + - - - sex - - - - 14 + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - 16 + + 4 + 5 + 2 + 6 + 1 + 7 + 3 + 2 + 4 + 6 + 3 + 8 + 1 + 7 + 4 + 3 + 1 + 2 + 1 + 2 + 1 + 1 + 5 + 1 + 2 + 2 + 1 + 5 + 1 + 3 + 2 + 1 + 2 + 1 + 2 + 2 + 1 + 1 + 1 + 1 + 4 + 7 + 7 + 3 + 1 + 10 + 3 + 1 + 2 + 4 + 6 + 2 + 3 + 1 + 1 + 1 + 1 - - 18 + + + + MALE - - 20 + + + + + - - - - 14 + + 14 + 16 + 18 + 20 - - 16 + + + + + + + + - - 18 + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - 20 + + 16 + 1 + 5 + 2 + 1 + 3 + 1 + 3 + 3 + 1 + 1 + 1 + 1 + 5 + 3 + 7 + 4 + 2 + 1 + 3 + 1 + 2 + 1 + 1 + 1 + 3 + 6 + 7 + 4 + 4 + 1 + 1 + 1 + 3 + 1 + 1 + 2 + 1 + 1 + 1 + 6 + 6 + 2 + 4 + 3 + 7 + 8 + 7 + 2 + 1 + 1 + 1 + 1 + 1 + 1 + 2 + 2 + 1 + 2 + 1 + 1 + 1 - - - 14 + + + + + + + + + 14 + 16 + 18 + 20 + + + + + + + + + - - 16 + + + + + + + + + - - 18 + + 1 + 1 + 2 + 1 + 1 + 1 + 1 + 1 - - 20 - culmen_depth_mm → - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - 7447546101148212213115315122311311111115712313414662111 + + sex - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - 5141131318111414541111112111225522111138131466654241110113111211 + + ↑ culmen_length_mm - - - - - - - - - - - - - 11211111 + + culmen_depth_mm → \ No newline at end of file diff --git a/test/output/hexbinZ.html b/test/output/hexbinZ.html index f7fdb249a8..b3bd33ea2d 100644 --- a/test/output/hexbinZ.html +++ b/test/output/hexbinZ.html @@ -51,45 +51,43 @@ white-space: pre; } - - - 3,000 - - - 3,500 - - - 4,000 - - - 4,500 - - - 5,000 - - - 5,500 - - - 6,000 - ↑ body_mass_g + + + + + + + + - - - 35 - - - 40 - - - 45 - - - 50 - - - 55 - culmen_length_mm → + + 3,000 + 3,500 + 4,000 + 4,500 + 5,000 + 5,500 + 6,000 + + + ↑ body_mass_g + + + + + + + + + + 35 + 40 + 45 + 50 + 55 + + + culmen_length_mm → diff --git a/test/output/hexbinZNull.svg b/test/output/hexbinZNull.svg index 11bfbf3020..5baa97d18c 100644 --- a/test/output/hexbinZNull.svg +++ b/test/output/hexbinZNull.svg @@ -13,72 +13,61 @@ white-space: pre; } - - - 34 - - - 36 - - - 38 - - - 40 - - - 42 - - - 44 - - - 46 - - - 48 - - - 50 - - - 52 - - - 54 - - - 56 - - - 58 - ↑ culmen_length_mm + + + + + + + + + + + + + + - - - 14 - - - 15 - - - 16 - - - 17 - - - 18 - - - 19 - - - 20 - - - 21 - culmen_depth_mm → + + 34 + 36 + 38 + 40 + 42 + 44 + 46 + 48 + 50 + 52 + 54 + 56 + 58 + + + ↑ culmen_length_mm + + + + + + + + + + + + + 14 + 15 + 16 + 17 + 18 + 19 + 20 + 21 + + + culmen_depth_mm → diff --git a/test/output/highCardinalityOrdinal.svg b/test/output/highCardinalityOrdinal.svg index 5c0056adae..6bfc0b4689 100644 --- a/test/output/highCardinalityOrdinal.svg +++ b/test/output/highCardinalityOrdinal.svg @@ -13,85 +13,61 @@ white-space: pre; } - - - 0 - - - 1 - - - 2 - - - 3 - - - 4 - - - 5 - - - 6 - - - 7 - - - 8 - - - 9 - - - 10 - - - 11 - - - 12 - - - 13 - - - 14 - - - 15 - - - 16 - - - 17 - - - 18 - - - 19 - - - 20 - - - 21 - - - 22 - - - 23 - - - 24 - - - 25 - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 0 + 1 + 2 + 3 + 4 + 5 + 6 + 7 + 8 + 9 + 10 + 11 + 12 + 13 + 14 + 15 + 16 + 17 + 18 + 19 + 20 + 21 + 22 + 23 + 24 + 25 diff --git a/test/output/hrefFill.svg b/test/output/hrefFill.svg index 970b7d26c1..09f1fd7d27 100644 --- a/test/output/hrefFill.svg +++ b/test/output/hrefFill.svg @@ -13,15 +13,19 @@ white-space: pre; } - - - 0 - + + - - - 0 - + + 0 - click me + + + + + 0 + + + click me + \ No newline at end of file diff --git a/test/output/ibmTrading.svg b/test/output/ibmTrading.svg index 2f6b391498..acea2508f6 100644 --- a/test/output/ibmTrading.svg +++ b/test/output/ibmTrading.svg @@ -13,131 +13,103 @@ white-space: pre; } - - - - 0 - - - - 2 - - - - 4 - - - - 6 - - - - 8 - - - - 10 - - - - 12 - - - - 14 - - - - 16 - - - - 18 - - - - 20 - ↑ Volume (USD, millions) + + + + + + + + + + + + - - - 2018-04-16 - - - 2018-04-17 - - - 2018-04-18 - - - 2018-04-19 - - - 2018-04-20 - - - 2018-04-21 - - - 2018-04-22 - - - 2018-04-23 - - - 2018-04-24 - - - 2018-04-25 - - - 2018-04-26 - - - 2018-04-27 - - - 2018-04-28 - - - 2018-04-29 - - - 2018-04-30 - - - 2018-05-01 - - - 2018-05-02 - - - 2018-05-03 - - - 2018-05-04 - - - 2018-05-05 - - - 2018-05-06 - - - 2018-05-07 - - - 2018-05-08 - - - 2018-05-09 - - - 2018-05-10 - - - 2018-05-11 - + + + + + + + + + + + + + + + 0 + 2 + 4 + 6 + 8 + 10 + 12 + 14 + 16 + 18 + 20 + + + ↑ Volume (USD, millions) + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 2018-04-16 + 2018-04-17 + 2018-04-18 + 2018-04-19 + 2018-04-20 + 2018-04-21 + 2018-04-22 + 2018-04-23 + 2018-04-24 + 2018-04-25 + 2018-04-26 + 2018-04-27 + 2018-04-28 + 2018-04-29 + 2018-04-30 + 2018-05-01 + 2018-05-02 + 2018-05-03 + 2018-05-04 + 2018-05-05 + 2018-05-06 + 2018-05-07 + 2018-05-08 + 2018-05-09 + 2018-05-10 + 2018-05-11 diff --git a/test/output/identityScale.svg b/test/output/identityScale.svg index f25eff0f8f..59e4cd53cd 100644 --- a/test/output/identityScale.svg +++ b/test/output/identityScale.svg @@ -13,48 +13,39 @@ white-space: pre; } - - - 350 - - - 300 - - - 250 - - - 200 - - - 150 - - - 100 - - - 50 - + + + + + + + + - - - 100 - - - 200 - - - 300 - - - 400 - - - 500 - - - 600 - + + 350 + 300 + 250 + 200 + 150 + 100 + 50 + + + + + + + + + + + 100 + 200 + 300 + 400 + 500 + 600 diff --git a/test/output/industryUnemployment.svg b/test/output/industryUnemployment.svg index cca46b7d6a..ad26238b60 100644 --- a/test/output/industryUnemployment.svg +++ b/test/output/industryUnemployment.svg @@ -13,118 +13,80 @@ white-space: pre; } - - - - 0 - - - - 2,000 - - - - 4,000 - - - - 6,000 - - - - 8,000 - - - - 10,000 - - - - 12,000 - - - - 14,000 - ↑ unemployed + + + + + + + + + + + + + + + + + + + + + + 0 + 2,000 + 4,000 + 6,000 + 8,000 + 10,000 + 12,000 + 14,000 + + + ↑ unemployed + + + + + + + + + + + + + - - - 2000 - - - 2001 - - - 2002 - - - 2003 - - - 2004 - - - 2005 - - - 2006 - - - 2007 - - - 2008 - - - 2009 - - - 2010 - + + 2000 + 2001 + 2002 + 2003 + 2004 + 2005 + 2006 + 2007 + 2008 + 2009 + 2010 - - Wholesale and Retail Trade - - - Manufacturing - - - Leisure and hospitality - - - Business services - - - Construction - - - Education and Health - - - Government - - - Finance - - - Self-employed - - - Other - - - Transportation and Utilities - - - Information - - - Agriculture - - - Mining and Extraction - + Wholesale and Retail Trade + Manufacturing + Leisure and hospitality + Business services + Construction + Education and Health + Government + Finance + Self-employed + Other + Transportation and Utilities + Information + Agriculture + Mining and Extraction diff --git a/test/output/industryUnemploymentShare.svg b/test/output/industryUnemploymentShare.svg index 9c6d48c642..f4ee7f80c8 100644 --- a/test/output/industryUnemploymentShare.svg +++ b/test/output/industryUnemploymentShare.svg @@ -13,130 +13,89 @@ white-space: pre; } - - - - 0% - - - - 10% - - - - 20% - - - - 30% - - - - 40% - - - - 50% - - - - 60% - - - - 70% - - - - 80% - - - - 90% - - - - 100% - ↑ unemployed + + + + + + + + + + + + + + + + + + + + + + + + + + + + 0% + 10% + 20% + 30% + 40% + 50% + 60% + 70% + 80% + 90% + 100% + + + ↑ unemployed + + + + + + + + + + + + + - - - 2000 - - - 2001 - - - 2002 - - - 2003 - - - 2004 - - - 2005 - - - 2006 - - - 2007 - - - 2008 - - - 2009 - - - 2010 - + + 2000 + 2001 + 2002 + 2003 + 2004 + 2005 + 2006 + 2007 + 2008 + 2009 + 2010 - - Wholesale and Retail Trade - - - Manufacturing - - - Leisure and hospitality - - - Business services - - - Construction - - - Education and Health - - - Government - - - Finance - - - Self-employed - - - Other - - - Transportation and Utilities - - - Information - - - Agriculture - - - Mining and Extraction - + Wholesale and Retail Trade + Manufacturing + Leisure and hospitality + Business services + Construction + Education and Health + Government + Finance + Self-employed + Other + Transportation and Utilities + Information + Agriculture + Mining and Extraction diff --git a/test/output/industryUnemploymentStream.svg b/test/output/industryUnemploymentStream.svg index b13195d638..0dfc333e77 100644 --- a/test/output/industryUnemploymentStream.svg +++ b/test/output/industryUnemploymentStream.svg @@ -13,109 +13,69 @@ white-space: pre; } - - - 0 - - - 2,000 - - - 4,000 - - - 6,000 - - - 8,000 - - - 10,000 - - - 12,000 - - - 14,000 - ↑ unemployed + + + + + + + + + - - - 2000 - - - 2001 - - - 2002 - - - 2003 - - - 2004 - - - 2005 - - - 2006 - - - 2007 - - - 2008 - - - 2009 - - - 2010 - + + 0 + 2,000 + 4,000 + 6,000 + 8,000 + 10,000 + 12,000 + 14,000 + + + ↑ unemployed + + + + + + + + + + + + + + + + 2000 + 2001 + 2002 + 2003 + 2004 + 2005 + 2006 + 2007 + 2008 + 2009 + 2010 - - Wholesale and Retail Trade - - - Manufacturing - - - Leisure and hospitality - - - Business services - - - Construction - - - Education and Health - - - Government - - - Finance - - - Self-employed - - - Other - - - Transportation and Utilities - - - Information - - - Agriculture - - - Mining and Extraction - + Wholesale and Retail Trade + Manufacturing + Leisure and hospitality + Business services + Construction + Education and Health + Government + Finance + Self-employed + Other + Transportation and Utilities + Information + Agriculture + Mining and Extraction \ No newline at end of file diff --git a/test/output/industryUnemploymentTrack.svg b/test/output/industryUnemploymentTrack.svg index 476a55fec0..d8f26e8554 100644 --- a/test/output/industryUnemploymentTrack.svg +++ b/test/output/industryUnemploymentTrack.svg @@ -13,5388 +13,1913 @@ white-space: pre; } - - - Construction + + + Construction - - Wholesale and Retail Trade - - - Manufacturing - - - Leisure and hospitality - - - Business services - - - Education and Health - - - Government - - - Self-employed - - - Finance - - - Transportation and Utilities - - - Other - - - Information - - - Agriculture - - - Mining and Extraction - industry - - - - 2000 - - - 2002 - - - 2004 - - - 2006 + + 745 + 812 + 669 + 447 + 397 + 389 + 384 + 446 + 386 + 417 + 482 + 580 + 836 + 826 + 683 + 596 + 478 + 443 + 447 + 522 + 489 + 535 + 670 + 785 + 1,211 + 1,060 + 1,009 + 855 + 626 + 593 + 594 + 654 + 615 + 680 + 758 + 941 + 1,196 + 1,173 + 987 + 772 + 715 + 710 + 677 + 650 + 681 + 651 + 690 + 813 + 994 + 1,039 + 1,011 + 849 + 665 + 668 + 610 + 563 + 629 + 635 + 695 + 870 + 1,079 + 1,150 + 961 + 693 + 567 + 559 + 509 + 561 + 572 + 519 + 564 + 813 + 868 + 836 + 820 + 674 + 647 + 569 + 633 + 618 + 586 + 456 + 618 + 725 + 922 + 1,086 + 924 + 853 + 676 + 600 + 617 + 558 + 596 + 641 + 645 + 968 + 1,099 + 1,118 + 1,170 + 1,057 + 809 + 785 + 783 + 814 + 970 + 1,078 + 1,237 + 1,438 + 1,744 + 2,025 + 1,979 + 1,737 + 1,768 + 1,601 + 1,687 + 1,542 + 1,594 + 1,744 + 1,780 + 2,044 + 2,194 + 2,440 - - 2008 + + 2,440 - - 2010 + + 384 + + Wholesale and Retail Trade + - - 745 - - - 812 - - - 669 - - - 447 - - - 397 - - - 389 - - - 384 - - - 446 - - - 386 - - - 417 - - - 482 - - - 580 - - - 836 - - - 826 - - - 683 - - - 596 - - - 478 - - - 443 - - - 447 - - - 522 - - - 489 - - - 535 - - - 670 - - - 785 - - - 1,211 - - - 1,060 - - - 1,009 - - - 855 - - - 626 - - - 593 - - - 594 - - - 654 - - - 615 - - - 680 - - - 758 - - - 941 - - - 1,196 - - - 1,173 - - - 987 - - - 772 - - - 715 - - - 710 - - - 677 - - - 650 - - - 681 - - - 651 - - - 690 - - - 813 - - - 994 - - - 1,039 - - - 1,011 - - - 849 - - - 665 - - - 668 - - - 610 - - - 563 - - - 629 - - - 635 - - - 695 - - - 870 - - - 1,079 - - - 1,150 - - - 961 - - - 693 - - - 567 - - - 559 - - - 509 - - - 561 - - - 572 - - - 519 - - - 564 - - - 813 - - - 868 - - - 836 - - - 820 - - - 674 - - - 647 - - - 569 - - - 633 - - - 618 - - - 586 - - - 456 - - - 618 - - - 725 - - - 922 - - - 1,086 - - - 924 - - - 853 - - - 676 - - - 600 - - - 617 - - - 558 - - - 596 - - - 641 - - - 645 - - - 968 - - - 1,099 - - - 1,118 - - - 1,170 - - - 1,057 - - - 809 - - - 785 - - - 783 - - - 814 - - - 970 - - - 1,078 - - - 1,237 - - - 1,438 - - - 1,744 - - - 2,025 - - - 1,979 - - - 1,737 - - - 1,768 - - - 1,601 - - - 1,687 - - - 1,542 - - - 1,594 - - - 1,744 - - - 1,780 - - - 2,044 - - - 2,194 - - - 2,440 - + 1,000 + 1,023 + 983 + 793 + 821 + 837 + 792 + 853 + 791 + 739 + 701 + 715 + 908 + 990 + 1,037 + 820 + 875 + 955 + 833 + 928 + 936 + 941 + 1,046 + 1,074 + 1,212 + 1,264 + 1,269 + 1,222 + 1,138 + 1,240 + 1,132 + 1,170 + 1,171 + 1,212 + 1,242 + 1,150 + 1,342 + 1,238 + 1,179 + 1,201 + 1,247 + 1,434 + 1,387 + 1,161 + 1,229 + 1,189 + 1,156 + 1,081 + 1,389 + 1,369 + 1,386 + 1,248 + 1,183 + 1,182 + 1,163 + 1,079 + 1,127 + 1,138 + 1,045 + 1,058 + 1,302 + 1,301 + 1,173 + 1,131 + 1,145 + 1,197 + 1,194 + 1,130 + 1,038 + 1,050 + 1,013 + 968 + 1,203 + 1,141 + 1,022 + 972 + 1,025 + 1,085 + 1,083 + 977 + 1,008 + 972 + 1,018 + 965 + 1,166 + 1,045 + 896 + 872 + 795 + 979 + 1,089 + 1,028 + 1,027 + 907 + 893 + 1,009 + 1,120 + 1,007 + 992 + 919 + 1,049 + 1,160 + 1,329 + 1,366 + 1,277 + 1,313 + 1,397 + 1,535 + 1,794 + 1,847 + 1,852 + 1,833 + 1,835 + 1,863 + 1,854 + 1,794 + 1,809 + 1,919 + 1,879 + 1,851 + 2,154 + 2,071 - - 2,440 - + 2,154 - - 384 - + 701 + + Manufacturing + - - 1,000 - - - 1,023 - - - 983 - - - 793 - - - 821 - - - 837 - - - 792 - - - 853 - - - 791 - - - 739 - - - 701 - - - 715 - - - 908 - - - 990 - - - 1,037 - - - 820 - - - 875 - - - 955 - - - 833 - - - 928 - - - 936 - - - 941 - - - 1,046 - - - 1,074 - - - 1,212 - - - 1,264 - - - 1,269 - - - 1,222 - - - 1,138 - - - 1,240 - - - 1,132 - - - 1,170 - - - 1,171 - - - 1,212 - - - 1,242 - - - 1,150 - - - 1,342 - - - 1,238 - - - 1,179 - - - 1,201 - - - 1,247 - - - 1,434 - - - 1,387 - - - 1,161 - - - 1,229 - - - 1,189 - - - 1,156 - - - 1,081 - - - 1,389 - - - 1,369 - - - 1,386 - - - 1,248 - - - 1,183 - - - 1,182 - - - 1,163 - - - 1,079 - - - 1,127 - - - 1,138 - - - 1,045 - - - 1,058 - - - 1,302 - - - 1,301 - - - 1,173 - - - 1,131 - - - 1,145 - - - 1,197 - - - 1,194 - - - 1,130 - - - 1,038 - - - 1,050 - - - 1,013 - - - 968 - - - 1,203 - - - 1,141 - - - 1,022 - - - 972 - - - 1,025 - - - 1,085 - - - 1,083 - - - 977 - - - 1,008 - - - 972 - - - 1,018 - - - 965 - - - 1,166 - - - 1,045 - - - 896 - - - 872 - - - 795 - - - 979 - - - 1,089 - - - 1,028 - - - 1,027 - - - 907 - - - 893 - - - 1,009 - - - 1,120 - - - 1,007 - - - 992 - - - 919 - - - 1,049 - - - 1,160 - - - 1,329 - - - 1,366 - - - 1,277 - - - 1,313 - - - 1,397 - - - 1,535 - - - 1,794 - - - 1,847 - - - 1,852 - - - 1,833 - - - 1,835 - - - 1,863 - - - 1,854 - - - 1,794 - - - 1,809 - - - 1,919 - - - 1,879 - - - 1,851 - - - 2,154 - - - 2,071 - + 734 + 694 + 739 + 736 + 685 + 621 + 708 + 685 + 667 + 693 + 672 + 653 + 911 + 902 + 954 + 855 + 903 + 956 + 1,054 + 1,023 + 996 + 1,065 + 1,108 + 1,172 + 1,377 + 1,296 + 1,367 + 1,322 + 1,194 + 1,187 + 1,185 + 1,108 + 1,076 + 1,046 + 1,115 + 1,188 + 1,302 + 1,229 + 1,222 + 1,199 + 1,150 + 1,232 + 1,193 + 1,186 + 1,175 + 1,041 + 1,034 + 1,025 + 1,110 + 1,094 + 1,083 + 1,004 + 966 + 957 + 1,019 + 840 + 852 + 884 + 905 + 872 + 889 + 889 + 879 + 793 + 743 + 743 + 883 + 767 + 775 + 800 + 823 + 757 + 778 + 821 + 701 + 745 + 680 + 635 + 736 + 680 + 632 + 618 + 702 + 660 + 752 + 774 + 742 + 749 + 651 + 653 + 621 + 596 + 673 + 729 + 762 + 772 + 837 + 820 + 831 + 796 + 879 + 862 + 908 + 960 + 984 + 1,007 + 1,144 + 1,315 + 1,711 + 1,822 + 1,912 + 1,968 + 2,010 + 2,010 + 1,988 + 1,866 + 1,876 + 1,884 + 1,882 + 1,747 + 1,918 + 1,814 - - 2,154 - + 2,010 - - 701 - + 596 + + Leisure and hospitality + - - 734 - - - 694 - - - 739 - - - 736 - - - 685 - - - 621 - - - 708 - - - 685 - - - 667 - - - 693 - - - 672 - - - 653 - - - 911 - - - 902 - - - 954 - - - 855 - - - 903 - - - 956 - - - 1,054 - - - 1,023 - - - 996 - - - 1,065 - - - 1,108 - - - 1,172 - - - 1,377 - - - 1,296 - - - 1,367 - - - 1,322 - - - 1,194 - - - 1,187 - - - 1,185 - - - 1,108 - - - 1,076 - - - 1,046 - - - 1,115 - - - 1,188 - - - 1,302 - - - 1,229 - - - 1,222 - - - 1,199 - - - 1,150 - - - 1,232 - - - 1,193 - - - 1,186 - - - 1,175 - - - 1,041 - - - 1,034 - - - 1,025 - - - 1,110 - - - 1,094 - - - 1,083 - - - 1,004 - - - 966 - - - 957 - - - 1,019 - - - 840 - - - 852 - - - 884 - - - 905 - - - 872 - - - 889 - - - 889 - - - 879 - - - 793 - - - 743 - - - 743 - - - 883 - - - 767 - - - 775 - - - 800 - - - 823 - - - 757 - - - 778 - - - 821 - - - 701 - - - 745 - - - 680 - - - 635 - - - 736 - - - 680 - - - 632 - - - 618 - - - 702 - - - 660 - - - 752 - - - 774 - - - 742 - - - 749 - - - 651 - - - 653 - - - 621 - - - 596 - - - 673 - - - 729 - - - 762 - - - 772 - - - 837 - - - 820 - - - 831 - - - 796 - - - 879 - - - 862 - - - 908 - - - 960 - - - 984 - - - 1,007 - - - 1,144 - - - 1,315 - - - 1,711 - - - 1,822 - - - 1,912 - - - 1,968 - - - 2,010 - - - 2,010 - - - 1,988 - - - 1,866 - - - 1,876 - - - 1,884 - - - 1,882 - - - 1,747 - - - 1,918 - - - 1,814 - + 782 + 779 + 789 + 658 + 675 + 833 + 786 + 675 + 636 + 691 + 694 + 639 + 806 + 821 + 817 + 744 + 731 + 821 + 813 + 767 + 900 + 903 + 935 + 938 + 947 + 973 + 976 + 953 + 1,022 + 1,034 + 999 + 884 + 885 + 956 + 978 + 922 + 1,049 + 1,145 + 1,035 + 986 + 955 + 1,048 + 1,020 + 1,050 + 978 + 933 + 990 + 885 + 1,097 + 987 + 1,039 + 925 + 977 + 1,189 + 965 + 1,010 + 854 + 853 + 916 + 850 + 993 + 1,008 + 967 + 882 + 944 + 950 + 929 + 844 + 842 + 796 + 966 + 930 + 910 + 1,040 + 917 + 882 + 830 + 942 + 867 + 855 + 810 + 795 + 836 + 701 + 911 + 879 + 845 + 822 + 831 + 917 + 920 + 877 + 892 + 911 + 986 + 961 + 1,176 + 1,056 + 944 + 874 + 1,074 + 1,154 + 1,172 + 1,122 + 1,029 + 1,126 + 1,283 + 1,210 + 1,487 + 1,477 + 1,484 + 1,322 + 1,599 + 1,688 + 1,600 + 1,636 + 1,469 + 1,604 + 1,524 + 1,624 + 1,804 + 1,597 - - 2,010 - + 1,804 - - 596 - + 636 + + Business services + - - 782 - - - 779 - - - 789 - - - 658 - - - 675 - - - 833 - - - 786 - - - 675 - - - 636 - - - 691 - - - 694 - - - 639 - - - 806 - - - 821 - - - 817 - - - 744 - - - 731 - - - 821 - - - 813 - - - 767 - - - 900 - - - 903 - - - 935 - - - 938 - - - 947 - - - 973 - - - 976 - - - 953 - - - 1,022 - - - 1,034 - - - 999 - - - 884 - - - 885 - - - 956 - - - 978 - - - 922 - - - 1,049 - - - 1,145 - - - 1,035 - - - 986 - - - 955 - - - 1,048 - - - 1,020 - - - 1,050 - - - 978 - - - 933 - - - 990 - - - 885 - - - 1,097 - - - 987 - - - 1,039 - - - 925 - - - 977 - - - 1,189 - - - 965 - - - 1,010 - - - 854 - - - 853 - - - 916 - - - 850 - - - 993 - - - 1,008 - - - 967 - - - 882 - - - 944 - - - 950 - - - 929 - - - 844 - - - 842 - - - 796 - - - 966 - - - 930 - - - 910 - - - 1,040 - - - 917 - - - 882 - - - 830 - - - 942 - - - 867 - - - 855 - - - 810 - - - 795 - - - 836 - - - 701 - - - 911 - - - 879 - - - 845 - - - 822 - - - 831 - - - 917 - - - 920 - - - 877 - - - 892 - - - 911 - - - 986 - - - 961 - - - 1,176 - - - 1,056 - - - 944 - - - 874 - - - 1,074 - - - 1,154 - - - 1,172 - - - 1,122 - - - 1,029 - - - 1,126 - - - 1,283 - - - 1,210 - - - 1,487 - - - 1,477 - - - 1,484 - - - 1,322 - - - 1,599 - - - 1,688 - - - 1,600 - - - 1,636 - - - 1,469 - - - 1,604 - - - 1,524 - - - 1,624 - - - 1,804 - - - 1,597 - + 655 + 587 + 623 + 517 + 561 + 545 + 636 + 584 + 559 + 504 + 547 + 564 + 734 + 724 + 652 + 655 + 652 + 694 + 731 + 790 + 810 + 910 + 946 + 921 + 1,120 + 973 + 964 + 951 + 983 + 1,079 + 1,075 + 926 + 1,007 + 962 + 1,029 + 1,038 + 1,112 + 1,140 + 1,190 + 1,076 + 1,105 + 1,092 + 1,021 + 881 + 975 + 1,014 + 948 + 948 + 1,070 + 964 + 999 + 752 + 819 + 814 + 790 + 845 + 750 + 781 + 872 + 875 + 958 + 916 + 807 + 714 + 730 + 743 + 804 + 728 + 862 + 748 + 711 + 788 + 825 + 841 + 824 + 644 + 695 + 753 + 735 + 681 + 736 + 768 + 658 + 791 + 885 + 825 + 775 + 689 + 743 + 722 + 743 + 683 + 655 + 675 + 679 + 803 + 893 + 866 + 876 + 736 + 829 + 890 + 866 + 961 + 951 + 1,052 + 992 + 1,147 + 1,445 + 1,512 + 1,597 + 1,448 + 1,514 + 1,580 + 1,531 + 1,560 + 1,596 + 1,488 + 1,514 + 1,486 + 1,614 + 1,740 - - 1,804 - + 1,740 - - 636 - + 504 + + Education and Health + - - 655 - - - 587 - - - 623 - - - 517 - - - 561 - - - 545 - - - 636 - - - 584 - - - 559 - - - 504 - - - 547 - - - 564 - - - 734 - - - 724 - - - 652 - - - 655 - - - 652 - - - 694 - - - 731 - - - 790 - - - 810 - - - 910 - - - 946 - - - 921 - - - 1,120 - - - 973 - - - 964 - - - 951 - - - 983 - - - 1,079 - - - 1,075 - - - 926 - - - 1,007 - - - 962 - - - 1,029 - - - 1,038 - - - 1,112 - - - 1,140 - - - 1,190 - - - 1,076 - - - 1,105 - - - 1,092 - - - 1,021 - - - 881 - - - 975 - - - 1,014 - - - 948 - - - 948 - - - 1,070 - - - 964 - - - 999 - - - 752 - - - 819 - - - 814 - - - 790 - - - 845 - - - 750 - - - 781 - - - 872 - - - 875 - - - 958 - - - 916 - - - 807 - - - 714 - - - 730 - - - 743 - - - 804 - - - 728 - - - 862 - - - 748 - - - 711 - - - 788 - - - 825 - - - 841 - - - 824 - - - 644 - - - 695 - - - 753 - - - 735 - - - 681 - - - 736 - - - 768 - - - 658 - - - 791 - - - 885 - - - 825 - - - 775 - - - 689 - - - 743 - - - 722 - - - 743 - - - 683 - - - 655 - - - 675 - - - 679 - - - 803 - - - 893 - - - 866 - - - 876 - - - 736 - - - 829 - - - 890 - - - 866 - - - 961 - - - 951 - - - 1,052 - - - 992 - - - 1,147 - - - 1,445 - - - 1,512 - - - 1,597 - - - 1,448 - - - 1,514 - - - 1,580 - - - 1,531 - - - 1,560 - - - 1,596 - - - 1,488 - - - 1,514 - - - 1,486 - - - 1,614 - - - 1,740 - + 353 + 349 + 381 + 329 + 423 + 452 + 478 + 450 + 398 + 339 + 351 + 293 + 428 + 423 + 456 + 341 + 390 + 476 + 513 + 595 + 455 + 486 + 516 + 483 + 586 + 590 + 540 + 493 + 533 + 638 + 671 + 660 + 562 + 517 + 493 + 558 + 559 + 576 + 518 + 611 + 618 + 769 + 697 + 760 + 649 + 639 + 662 + 620 + 662 + 608 + 584 + 589 + 570 + 769 + 725 + 647 + 593 + 526 + 570 + 562 + 613 + 619 + 614 + 591 + 648 + 667 + 635 + 644 + 658 + 628 + 677 + 529 + 593 + 528 + 563 + 558 + 543 + 617 + 659 + 611 + 576 + 531 + 536 + 502 + 563 + 489 + 495 + 555 + 622 + 653 + 665 + 648 + 630 + 534 + 526 + 521 + 576 + 562 + 609 + 551 + 619 + 669 + 776 + 844 + 835 + 797 + 748 + 791 + 792 + 847 + 931 + 964 + 1,005 + 1,267 + 1,269 + 1,239 + 1,257 + 1,280 + 1,168 + 1,183 + 1,175 + 1,200 - - 1,740 - + 1,280 - - 504 - + 293 + + Government + - - 353 - - - 349 - - - 381 - - - 329 - - - 423 - - - 452 - - - 478 - - - 450 - - - 398 - - - 339 - - - 351 - - - 293 - - - 428 - - - 423 - - - 456 - - - 341 - - - 390 - - - 476 - - - 513 - - - 595 - - - 455 - - - 486 - - - 516 - - - 483 - - - 586 - - - 590 - - - 540 - - - 493 - - - 533 - - - 638 - - - 671 - - - 660 - - - 562 - - - 517 - - - 493 - - - 558 - - - 559 - - - 576 - - - 518 - - - 611 - - - 618 - - - 769 - - - 697 - - - 760 - - - 649 - - - 639 - - - 662 - - - 620 - - - 662 - - - 608 - - - 584 - - - 589 - - - 570 - - - 769 - - - 725 - - - 647 - - - 593 - - - 526 - - - 570 - - - 562 - - - 613 - - - 619 - - - 614 - - - 591 - - - 648 - - - 667 - - - 635 - - - 644 - - - 658 - - - 628 - - - 677 - - - 529 - - - 593 - - - 528 - - - 563 - - - 558 - - - 543 - - - 617 - - - 659 - - - 611 - - - 576 - - - 531 - - - 536 - - - 502 - - - 563 - - - 489 - - - 495 - - - 555 - - - 622 - - - 653 - - - 665 - - - 648 - - - 630 - - - 534 - - - 526 - - - 521 - - - 576 - - - 562 - - - 609 - - - 551 - - - 619 - - - 669 - - - 776 - - - 844 - - - 835 - - - 797 - - - 748 - - - 791 - - - 792 - - - 847 - - - 931 - - - 964 - - - 1,005 - - - 1,267 - - - 1,269 - - - 1,239 - - - 1,257 - - - 1,280 - - - 1,168 - - - 1,183 - - - 1,175 - - - 1,200 - + 430 + 409 + 311 + 269 + 370 + 603 + 545 + 583 + 408 + 391 + 384 + 365 + 463 + 298 + 355 + 369 + 361 + 525 + 548 + 540 + 438 + 429 + 420 + 419 + 486 + 508 + 477 + 447 + 484 + 561 + 645 + 596 + 530 + 499 + 468 + 446 + 571 + 483 + 526 + 440 + 478 + 704 + 749 + 745 + 556 + 500 + 542 + 516 + 511 + 490 + 530 + 433 + 468 + 580 + 741 + 676 + 568 + 561 + 514 + 499 + 555 + 472 + 468 + 478 + 453 + 681 + 683 + 664 + 568 + 502 + 494 + 393 + 457 + 472 + 461 + 414 + 429 + 578 + 659 + 595 + 396 + 424 + 400 + 395 + 476 + 405 + 419 + 408 + 428 + 572 + 704 + 695 + 525 + 492 + 482 + 451 + 471 + 372 + 425 + 373 + 461 + 654 + 770 + 721 + 573 + 552 + 527 + 511 + 652 + 563 + 598 + 575 + 702 + 991 + 1,129 + 1,118 + 928 + 785 + 748 + 797 + 948 + 880 - - 1,280 - + 1,129 - - 293 - + 269 + + Self-employed + - - 430 - - - 409 - - - 311 - - - 269 - - - 370 - - - 603 - - - 545 - - - 583 - - - 408 - - - 391 - - - 384 - - - 365 - - - 463 - - - 298 - - - 355 - - - 369 - - - 361 - - - 525 - - - 548 - - - 540 - - - 438 - - - 429 - - - 420 - - - 419 - - - 486 - - - 508 - - - 477 - - - 447 - - - 484 - - - 561 - - - 645 - - - 596 - - - 530 - - - 499 - - - 468 - - - 446 - - - 571 - - - 483 - - - 526 - - - 440 - - - 478 - - - 704 - - - 749 - - - 745 - - - 556 - - - 500 - - - 542 - - - 516 - - - 511 - - - 490 - - - 530 - - - 433 - - - 468 - - - 580 - - - 741 - - - 676 - - - 568 - - - 561 - - - 514 - - - 499 - - - 555 - - - 472 - - - 468 - - - 478 - - - 453 - - - 681 - - - 683 - - - 664 - - - 568 - - - 502 - - - 494 - - - 393 - - - 457 - - - 472 - - - 461 - - - 414 - - - 429 - - - 578 - - - 659 - - - 595 - - - 396 - - - 424 - - - 400 - - - 395 - - - 476 - - - 405 - - - 419 - - - 408 - - - 428 - - - 572 - - - 704 - - - 695 - - - 525 - - - 492 - - - 482 - - - 451 - - - 471 - - - 372 - - - 425 - - - 373 - - - 461 - - - 654 - - - 770 - - - 721 - - - 573 - - - 552 - - - 527 - - - 511 - - - 652 - - - 563 - - - 598 - - - 575 - - - 702 - - - 991 - - - 1,129 - - - 1,118 - - - 928 - - - 785 - - - 748 - - - 797 - - - 948 - - - 880 - + 239 + 262 + 213 + 218 + 206 + 188 + 222 + 186 + 213 + 226 + 273 + 178 + 194 + 209 + 181 + 216 + 206 + 187 + 191 + 243 + 256 + 247 + 234 + 249 + 263 + 250 + 217 + 255 + 264 + 246 + 249 + 271 + 266 + 275 + 297 + 327 + 324 + 304 + 279 + 248 + 271 + 295 + 270 + 302 + 287 + 338 + 308 + 299 + 302 + 260 + 260 + 242 + 287 + 306 + 291 + 324 + 362 + 301 + 353 + 341 + 346 + 363 + 312 + 273 + 299 + 268 + 282 + 249 + 282 + 255 + 319 + 327 + 341 + 332 + 300 + 334 + 251 + 245 + 291 + 306 + 299 + 275 + 257 + 287 + 376 + 300 + 311 + 240 + 276 + 258 + 324 + 315 + 304 + 338 + 336 + 326 + 338 + 340 + 346 + 338 + 366 + 364 + 345 + 378 + 414 + 396 + 411 + 559 + 659 + 586 + 625 + 488 + 530 + 472 + 552 + 569 + 636 + 610 + 592 + 609 + 730 + 680 - - 1,129 - + 730 - - 269 - + 178 + + Finance + - - 239 - - - 262 - - - 213 - - - 218 - - - 206 - - - 188 - - - 222 - - - 186 - - - 213 - - - 226 - - - 273 - - - 178 - - - 194 - - - 209 - - - 181 - - - 216 - - - 206 - - - 187 - - - 191 - - - 243 - - - 256 - - - 247 - - - 234 - - - 249 - - - 263 - - - 250 - - - 217 - - - 255 - - - 264 - - - 246 - - - 249 - - - 271 - - - 266 - - - 275 - - - 297 - - - 327 - - - 324 - - - 304 - - - 279 - - - 248 - - - 271 - - - 295 - - - 270 - - - 302 - - - 287 - - - 338 - - - 308 - - - 299 - - - 302 - - - 260 - - - 260 - - - 242 - - - 287 - - - 306 - - - 291 - - - 324 - - - 362 - - - 301 - - - 353 - - - 341 - - - 346 - - - 363 - - - 312 - - - 273 - - - 299 - - - 268 - - - 282 - - - 249 - - - 282 - - - 255 - - - 319 - - - 327 - - - 341 - - - 332 - - - 300 - - - 334 - - - 251 - - - 245 - - - 291 - - - 306 - - - 299 - - - 275 - - - 257 - - - 287 - - - 376 - - - 300 - - - 311 - - - 240 - - - 276 - - - 258 - - - 324 - - - 315 - - - 304 - - - 338 - - - 336 - - - 326 - - - 338 - - - 340 - - - 346 - - - 338 - - - 366 - - - 364 - - - 345 - - - 378 - - - 414 - - - 396 - - - 411 - - - 559 - - - 659 - - - 586 - - - 625 - - - 488 - - - 530 - - - 472 - - - 552 - - - 569 - - - 636 - - - 610 - - - 592 - - - 609 - - - 730 - - - 680 - + 228 + 240 + 226 + 197 + 195 + 216 + 190 + 213 + 187 + 224 + 184 + 200 + 232 + 235 + 211 + 232 + 191 + 249 + 289 + 256 + 268 + 281 + 320 + 258 + 267 + 318 + 287 + 292 + 340 + 373 + 345 + 343 + 299 + 312 + 337 + 322 + 327 + 310 + 357 + 323 + 320 + 358 + 284 + 342 + 305 + 303 + 311 + 283 + 403 + 363 + 343 + 312 + 302 + 335 + 307 + 312 + 374 + 358 + 290 + 290 + 252 + 301 + 261 + 255 + 288 + 307 + 309 + 300 + 260 + 255 + 268 + 204 + 233 + 268 + 298 + 293 + 289 + 299 + 329 + 263 + 235 + 211 + 229 + 227 + 233 + 295 + 252 + 231 + 281 + 303 + 307 + 371 + 316 + 307 + 261 + 315 + 285 + 323 + 323 + 324 + 361 + 337 + 350 + 409 + 380 + 434 + 494 + 540 + 571 + 637 + 639 + 561 + 536 + 513 + 570 + 566 + 657 + 646 + 619 + 665 + 623 + 708 - - 730 - + 708 - - 178 - + 184 + + Transportation and Utilities + - - 228 - - - 240 - - - 226 - - - 197 - - - 195 - - - 216 - - - 190 - - - 213 - - - 187 - - - 224 - - - 184 - - - 200 - - - 232 - - - 235 - - - 211 - - - 232 - - - 191 - - - 249 - - - 289 - - - 256 - - - 268 - - - 281 - - - 320 - - - 258 - - - 267 - - - 318 - - - 287 - - - 292 - - - 340 - - - 373 - - - 345 - - - 343 - - - 299 - - - 312 - - - 337 - - - 322 - - - 327 - - - 310 - - - 357 - - - 323 - - - 320 - - - 358 - - - 284 - - - 342 - - - 305 - - - 303 - - - 311 - - - 283 - - - 403 - - - 363 - - - 343 - - - 312 - - - 302 - - - 335 - - - 307 - - - 312 - - - 374 - - - 358 - - - 290 - - - 290 - - - 252 - - - 301 - - - 261 - - - 255 - - - 288 - - - 307 - - - 309 - - - 300 - - - 260 - - - 255 - - - 268 - - - 204 - - - 233 - - - 268 - - - 298 - - - 293 - - - 289 - - - 299 - - - 329 - - - 263 - - - 235 - - - 211 - - - 229 - - - 227 - - - 233 - - - 295 - - - 252 - - - 231 - - - 281 - - - 303 - - - 307 - - - 371 - - - 316 - - - 307 - - - 261 - - - 315 - - - 285 - - - 323 - - - 323 - - - 324 - - - 361 - - - 337 - - - 350 - - - 409 - - - 380 - - - 434 - - - 494 - - - 540 - - - 571 - - - 637 - - - 639 - - - 561 - - - 536 - - - 513 - - - 570 - - - 566 - - - 657 - - - 646 - - - 619 - - - 665 - - - 623 - - - 708 - + 236 + 223 + 192 + 191 + 190 + 183 + 228 + 198 + 231 + 153 + 129 + 168 + 194 + 189 + 193 + 232 + 178 + 242 + 236 + 226 + 214 + 321 + 302 + 310 + 368 + 331 + 313 + 280 + 257 + 274 + 270 + 221 + 235 + 262 + 233 + 243 + 331 + 316 + 319 + 274 + 260 + 300 + 289 + 255 + 255 + 260 + 275 + 267 + 243 + 291 + 284 + 239 + 230 + 227 + 231 + 236 + 208 + 219 + 217 + 204 + 276 + 245 + 267 + 257 + 223 + 247 + 222 + 187 + 211 + 251 + 199 + 202 + 287 + 260 + 263 + 272 + 226 + 225 + 237 + 217 + 183 + 206 + 183 + 190 + 248 + 251 + 249 + 188 + 216 + 242 + 309 + 205 + 224 + 218 + 242 + 210 + 271 + 289 + 267 + 245 + 269 + 329 + 359 + 309 + 337 + 316 + 331 + 421 + 522 + 563 + 558 + 541 + 506 + 499 + 511 + 547 + 538 + 480 + 493 + 539 + 657 + 591 - - 708 - + 657 - - 184 - + 129 + + Other + - - 236 - - - 223 - - - 192 - - - 191 - - - 190 - - - 183 - - - 228 - - - 198 - - - 231 - - - 153 - - - 129 - - - 168 - - - 194 - - - 189 - - - 193 - - - 232 - - - 178 - - - 242 - - - 236 - - - 226 - - - 214 - - - 321 - - - 302 - - - 310 - - - 368 - - - 331 - - - 313 - - - 280 - - - 257 - - - 274 - - - 270 - - - 221 - - - 235 - - - 262 - - - 233 - - - 243 - - - 331 - - - 316 - - - 319 - - - 274 - - - 260 - - - 300 - - - 289 - - - 255 - - - 255 - - - 260 - - - 275 - - - 267 - - - 243 - - - 291 - - - 284 - - - 239 - - - 230 - - - 227 - - - 231 - - - 236 - - - 208 - - - 219 - - - 217 - - - 204 - - - 276 - - - 245 - - - 267 - - - 257 - - - 223 - - - 247 - - - 222 - - - 187 - - - 211 - - - 251 - - - 199 - - - 202 - - - 287 - - - 260 - - - 263 - - - 272 - - - 226 - - - 225 - - - 237 - - - 217 - - - 183 - - - 206 - - - 183 - - - 190 - - - 248 - - - 251 - - - 249 - - - 188 - - - 216 - - - 242 - - - 309 - - - 205 - - - 224 - - - 218 - - - 242 - - - 210 - - - 271 - - - 289 - - - 267 - - - 245 - - - 269 - - - 329 - - - 359 - - - 309 - - - 337 - - - 316 - - - 331 - - - 421 - - - 522 - - - 563 - - - 558 - - - 541 - - - 506 - - - 499 - - - 511 - - - 547 - - - 538 - - - 480 - - - 493 - - - 539 - - - 657 - - - 591 - + 274 + 232 + 247 + 240 + 254 + 225 + 202 + 187 + 220 + 161 + 217 + 167 + 197 + 243 + 200 + 220 + 172 + 246 + 228 + 241 + 225 + 239 + 256 + 277 + 304 + 339 + 314 + 268 + 264 + 335 + 356 + 353 + 281 + 272 + 284 + 241 + 304 + 331 + 370 + 331 + 339 + 359 + 405 + 373 + 338 + 378 + 357 + 278 + 322 + 366 + 366 + 347 + 310 + 326 + 346 + 341 + 301 + 300 + 294 + 276 + 290 + 325 + 308 + 306 + 314 + 291 + 274 + 306 + 307 + 319 + 300 + 269 + 308 + 281 + 292 + 266 + 265 + 265 + 305 + 341 + 310 + 268 + 306 + 306 + 275 + 257 + 222 + 224 + 242 + 256 + 243 + 239 + 257 + 182 + 255 + 235 + 264 + 313 + 283 + 251 + 275 + 322 + 352 + 412 + 374 + 334 + 434 + 367 + 431 + 453 + 377 + 403 + 476 + 557 + 490 + 528 + 462 + 541 + 491 + 513 + 609 + 603 - - 657 - + 609 - - 129 - + 161 + + Information + - - 274 - - - 232 - - - 247 - - - 240 - - - 254 - - - 225 - - - 202 - - - 187 - - - 220 - - - 161 - - - 217 - - - 167 - - - 197 - - - 243 - - - 200 - - - 220 - - - 172 - - - 246 - - - 228 - - - 241 - - - 225 - - - 239 - - - 256 - - - 277 - - - 304 - - - 339 - - - 314 - - - 268 - - - 264 - - - 335 - - - 356 - - - 353 - - - 281 - - - 272 - - - 284 - - - 241 - - - 304 - - - 331 - - - 370 - - - 331 - - - 339 - - - 359 - - - 405 - - - 373 - - - 338 - - - 378 - - - 357 - - - 278 - - - 322 - - - 366 - - - 366 - - - 347 - - - 310 - - - 326 - - - 346 - - - 341 - - - 301 - - - 300 - - - 294 - - - 276 - - - 290 - - - 325 - - - 308 - - - 306 - - - 314 - - - 291 - - - 274 - - - 306 - - - 307 - - - 319 - - - 300 - - - 269 - - - 308 - - - 281 - - - 292 - - - 266 - - - 265 - - - 265 - - - 305 - - - 341 - - - 310 - - - 268 - - - 306 - - - 306 - - - 275 - - - 257 - - - 222 - - - 224 - - - 242 - - - 256 - - - 243 - - - 239 - - - 257 - - - 182 - - - 255 - - - 235 - - - 264 - - - 313 - - - 283 - - - 251 - - - 275 - - - 322 - - - 352 - - - 412 - - - 374 - - - 334 - - - 434 - - - 367 - - - 431 - - - 453 - - - 377 - - - 403 - - - 476 - - - 557 - - - 490 - - - 528 - - - 462 - - - 541 - - - 491 - - - 513 - - - 609 - - - 603 - + 125 + 112 + 140 + 95 + 131 + 102 + 144 + 143 + 130 + 96 + 117 + 151 + 161 + 109 + 148 + 148 + 164 + 163 + 206 + 210 + 219 + 233 + 241 + 275 + 263 + 279 + 266 + 257 + 260 + 255 + 264 + 270 + 231 + 211 + 220 + 255 + 243 + 321 + 267 + 268 + 251 + 239 + 224 + 224 + 248 + 182 + 257 + 224 + 236 + 194 + 216 + 168 + 190 + 172 + 174 + 191 + 178 + 185 + 187 + 173 + 168 + 204 + 177 + 178 + 145 + 160 + 142 + 156 + 168 + 162 + 172 + 128 + 105 + 119 + 116 + 132 + 158 + 114 + 103 + 132 + 170 + 116 + 137 + 108 + 143 + 139 + 109 + 77 + 110 + 114 + 112 + 140 + 124 + 120 + 132 + 125 + 169 + 193 + 155 + 143 + 170 + 157 + 141 + 144 + 166 + 168 + 173 + 219 + 232 + 224 + 252 + 320 + 303 + 347 + 373 + 358 + 362 + 261 + 243 + 256 + 313 + 300 - - 609 - + 373 - - 161 - + 77 + + Agriculture + - - 125 - - - 112 - - - 140 - - - 95 - - - 131 - - - 102 - - - 144 - - - 143 - - - 130 - - - 96 - - - 117 - - - 151 - - - 161 - - - 109 - - - 148 - - - 148 - - - 164 - - - 163 - - - 206 - - - 210 - - - 219 - - - 233 - - - 241 - - - 275 - - - 263 - - - 279 - - - 266 - - - 257 - - - 260 - - - 255 - - - 264 - - - 270 - - - 231 - - - 211 - - - 220 - - - 255 - - - 243 - - - 321 - - - 267 - - - 268 - - - 251 - - - 239 - - - 224 - - - 224 - - - 248 - - - 182 - - - 257 - - - 224 - - - 236 - - - 194 - - - 216 - - - 168 - - - 190 - - - 172 - - - 174 - - - 191 - - - 178 - - - 185 - - - 187 - - - 173 - - - 168 - - - 204 - - - 177 - - - 178 - - - 145 - - - 160 - - - 142 - - - 156 - - - 168 - - - 162 - - - 172 - - - 128 - - - 105 - - - 119 - - - 116 - - - 132 - - - 158 - - - 114 - - - 103 - - - 132 - - - 170 - - - 116 - - - 137 - - - 108 - - - 143 - - - 139 - - - 109 - - - 77 - - - 110 - - - 114 - - - 112 - - - 140 - - - 124 - - - 120 - - - 132 - - - 125 - - - 169 - - - 193 - - - 155 - - - 143 - - - 170 - - - 157 - - - 141 - - - 144 - - - 166 - - - 168 - - - 173 - - - 219 - - - 232 - - - 224 - - - 252 - - - 320 - - - 303 - - - 347 - - - 373 - - - 358 - - - 362 - - - 261 - - - 243 - - - 256 - - - 313 - - - 300 - + 154 + 173 + 152 + 135 + 73 + 109 + 77 + 110 + 124 + 113 + 192 + 196 + 188 + 193 + 267 + 140 + 109 + 130 + 113 + 141 + 101 + 118 + 145 + 192 + 195 + 187 + 269 + 151 + 89 + 89 + 114 + 125 + 92 + 97 + 137 + 120 + 159 + 172 + 161 + 154 + 133 + 94 + 113 + 173 + 98 + 136 + 148 + 137 + 184 + 168 + 153 + 107 + 99 + 106 + 140 + 103 + 88 + 102 + 131 + 165 + 153 + 107 + 139 + 84 + 66 + 76 + 69 + 100 + 127 + 85 + 118 + 127 + 140 + 139 + 117 + 81 + 79 + 35 + 55 + 76 + 78 + 77 + 125 + 139 + 128 + 127 + 123 + 67 + 64 + 59 + 40 + 54 + 53 + 47 + 80 + 96 + 113 + 135 + 175 + 108 + 94 + 86 + 125 + 111 + 84 + 97 + 119 + 229 + 245 + 251 + 241 + 176 + 136 + 182 + 180 + 195 + 150 + 166 + 180 + 292 + 318 + 285 - - 373 - + 318 - - 77 - + 35 - - - 154 - - - 173 - - - 152 - - - 135 - - - 73 - - - 109 - - - 77 - - - 110 - - - 124 - - - 113 - - - 192 - - - 196 - - - 188 - - - 193 - - - 267 - - - 140 - - - 109 - - - 130 - - - 113 - - - 141 - - - 101 - - - 118 - - - 145 - - - 192 - - - 195 - - - 187 - - - 269 - - - 151 - - - 89 - - - 89 - - - 114 - - - 125 - - - 92 - - - 97 - - - 137 - - - 120 - - - 159 - - - 172 - - - 161 - - - 154 - - - 133 - - - 94 - - - 113 - - - 173 - - - 98 - - - 136 - - - 148 - - - 137 - - - 184 - - - 168 - - - 153 - - - 107 - - - 99 - - - 106 - - - 140 - - - 103 - - - 88 - - - 102 - - - 131 - - - 165 - - - 153 - - - 107 - - - 139 - - - 84 - - - 66 - - - 76 - - - 69 - - - 100 - - - 127 - - - 85 - - - 118 - - - 127 - - - 140 - - - 139 - - - 117 - - - 81 - - - 79 - - - 35 - - - 55 - - - 76 - - - 78 - - - 77 - - - 125 - - - 139 - - - 128 - - - 127 - - - 123 - - - 67 - - - 64 - - - 59 - - - 40 - - - 54 - - - 53 - - - 47 - - - 80 - - - 96 - - - 113 - - - 135 - - - 175 - - - 108 - - - 94 - - - 86 - - - 125 - - - 111 - - - 84 - - - 97 - - - 119 - - - 229 - - - 245 - - - 251 - - - 241 - - - 176 - - - 136 - - - 182 - - - 180 - - - 195 - - - 150 - - - 166 - - - 180 - - - 292 - - - 318 - - - 285 - + + Mining and Extraction - - - 318 - + + + + + + + - - - 35 - + + 2000 + 2002 + 2004 + 2006 + 2008 + 2010 - - - - 19 - - - 25 - - - 17 - - - 20 - - - 27 - - - 13 - - - 16 - - - 23 - - - 25 - - - 39 - - - 11 - - - 20 - - - 11 - - - 27 - - - 14 - - - 24 - - - 34 - - - 26 - - - 17 - - - 18 - - - 23 - - - 32 - - - 20 - - - 27 - - - 33 - - - 35 - - - 28 - - - 33 - - - 25 - - - 35 - - - 19 - - - 32 - - - 42 - - - 36 - - - 32 - - - 45 - - - 54 - - - 41 - - - 46 - - - 41 - - - 40 - - - 36 - - - 43 - - - 20 - - - 25 - - - 31 - - - 34 - - - 32 - - - 31 - - - 24 - - - 22 - - - 34 - - - 22 - - - 27 - - - 28 - - - 10 - - - 8 - - - 15 - - - 20 - - - 16 - - - 29 - - - 25 - - - 32 - - - 19 - - - 16 - - - 25 - - - 22 - - - 12 - - - 12 - - - 2 - - - 18 - - - 23 - - - 26 - - - 25 - - - 14 - - - 17 - - - 20 - - - 31 - - - 25 - - - 32 - - - 14 - - - 15 - - - 22 - - - 25 - - - 35 - - - 33 - - - 24 - - - 17 - - - 22 - - - 33 - - - 33 - - - 33 - - - 25 - - - 9 - - - 16 - - - 24 - - - 28 - - - 16 - - - 28 - - - 28 - - - 28 - - - 28 - - - 13 - - - 17 - - - 25 - - - 15 - - - 32 - - - 46 - - - 59 - - - 63 - - - 105 - - - 125 - - - 98 - - - 100 - - - 95 - - - 93 - - - 76 - - - 84 - - - 96 - - - 89 - - - 68 - - - 79 - + 19 + 25 + 17 + 20 + 27 + 13 + 16 + 23 + 25 + 39 + 11 + 20 + 11 + 27 + 14 + 24 + 34 + 26 + 17 + 18 + 23 + 32 + 20 + 27 + 33 + 35 + 28 + 33 + 25 + 35 + 19 + 32 + 42 + 36 + 32 + 45 + 54 + 41 + 46 + 41 + 40 + 36 + 43 + 20 + 25 + 31 + 34 + 32 + 31 + 24 + 22 + 34 + 22 + 27 + 28 + 10 + 8 + 15 + 20 + 16 + 29 + 25 + 32 + 19 + 16 + 25 + 22 + 12 + 12 + 2 + 18 + 23 + 26 + 25 + 14 + 17 + 20 + 31 + 25 + 32 + 14 + 15 + 22 + 25 + 35 + 33 + 24 + 17 + 22 + 33 + 33 + 33 + 25 + 9 + 16 + 24 + 28 + 16 + 28 + 28 + 28 + 28 + 13 + 17 + 25 + 15 + 32 + 46 + 59 + 63 + 105 + 125 + 98 + 100 + 95 + 93 + 76 + 84 + 96 + 89 + 68 + 79 - - 125 - + 125 - - 2 - + 2 + + industry + \ No newline at end of file diff --git a/test/output/infinityLog.svg b/test/output/infinityLog.svg index 37e192fa18..29f8c25471 100644 --- a/test/output/infinityLog.svg +++ b/test/output/infinityLog.svg @@ -13,37 +13,29 @@ white-space: pre; } - - - 0.2 - - - 0.3 - - - 0.4 - - - 0.5 - - - 0.6 - - - 0.7 - - - - - - - - - 1 - - - 2 - + + + + + + + + + + + + + + 0.2 + 0.3 + 0.4 + 0.5 + 0.6 + 0.7 + + + 1 + 2 diff --git a/test/output/integerInterval.svg b/test/output/integerInterval.svg index f68049a639..45f71125ea 100644 --- a/test/output/integerInterval.svg +++ b/test/output/integerInterval.svg @@ -13,48 +13,39 @@ white-space: pre; } - - - 0 - - - 2 - - - 4 - - - 6 - - - 8 - - - 10 - - - 12 - - - 14 - - - 16 - + + + + + + + + + + - - - 2.0 - - - 3.0 - - - 4.0 - - - 5.0 - + + 0 + 2 + 4 + 6 + 8 + 10 + 12 + 14 + 16 + + + + + + + + + 2.0 + 3.0 + 4.0 + 5.0 diff --git a/test/output/intradayHistogram.svg b/test/output/intradayHistogram.svg index fc479c3443..75ea137278 100644 --- a/test/output/intradayHistogram.svg +++ b/test/output/intradayHistogram.svg @@ -13,63 +13,52 @@ white-space: pre; } - - - 0 - - - 1 - - - 2 - - - 3 - - - 4 - - - 5 - - - 6 - - - 7 - - - 8 - - - 9 - - - 10 - - - 11 - ↑ Frequency + + + + + + + + + + + + + - - - 14 - - - 16 - - - 18 - - - 20 - - - 22 - - - 24 - + + 0 + 1 + 2 + 3 + 4 + 5 + 6 + 7 + 8 + 9 + 10 + 11 + + + ↑ Frequency + + + + + + + + + + + 14 + 16 + 18 + 20 + 22 + 24 diff --git a/test/output/learningPoverty.svg b/test/output/learningPoverty.svg index c02da0c6f5..082a864ac5 100644 --- a/test/output/learningPoverty.svg +++ b/test/output/learningPoverty.svg @@ -13,353 +13,248 @@ white-space: pre; } - - - Niger - - - Chad - - - Madagascar - - - Yemen, Rep - - - Afghanistan - - - Burundi - - - Mali - - - Ethiopia - - - Congo, Dem Rep - - - Togo - - - Burkina Faso - - - Congo, Rep - - - Uganda - - - Cote d’Ivoire - - - Dominican Republic - - - South Africa - - - Benin - - - Cameroon - - - Honduras - - - Pakistan - - - Paraguay - - - Senegal - - - Nicaragua - - - Egypt, Arab Rep - - - Guatemala - - - Panama - - - Morocco - - - Tunisia - - - Kyrgyz Republic - - - Ecuador - - - Bangladesh - - - Peru - - - India - - - Argentina - - - Jordan - - - Cambodia - - - Kuwait - - - Colombia - - - Brazil - - - Botswana - - - Mexico - - - Oman - - - Uruguay - - - Saudi Arabia - - - Chile - - - Iran, Islamic Rep - - - Indonesia - - - Qatar - - - Armenia - - - United Arab Emirates - - - Costa Rica - - - Bahrain - - - Malta - - - Thailand - - - Azerbaijan - - - Turkey - - - Trinidad and Tobago - - - Romania - - - China - - - Cyprus - - - Sri Lanka - - - Georgia - - - Malaysia - - - Bulgaria - - - Israel - - - New Zealand - - - Australia - - - Slovak Republic - - - Serbia - - - United States - - - France - - - Portugal - - - Belgium - - - Poland - - - Norway - - - Hungary - - - Slovenia - - - Germany - - - Spain - - - Canada - - - Croatia - - - Latvia - - - Macao SAR, China - - - Denmark - - - Italy - - - United Kingdom - - - Russian Federation - - - Hong Kong SAR, China - - - Czech Republic - - - Korea, Rep - - - Lithuania - - - Singapore - - - Finland - - - Austria - - - Ireland - - - Sweden - - - Japan - - - Kazakhstan - - - Vietnam - - - Netherlands - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - 100% - - - - 80% - - - - 60% - - - - 40% - - - - 20% - - - - 0% - - - - 20% - - - - 40% - - - - 60% - - - - 80% - - - - 100% - + + Niger + Chad + Madagascar + Yemen, Rep + Afghanistan + Burundi + Mali + Ethiopia + Congo, Dem Rep + Togo + Burkina Faso + Congo, Rep + Uganda + Cote d’Ivoire + Dominican Republic + South Africa + Benin + Cameroon + Honduras + Pakistan + Paraguay + Senegal + Nicaragua + Egypt, Arab Rep + Guatemala + Panama + Morocco + Tunisia + Kyrgyz Republic + Ecuador + Bangladesh + Peru + India + Argentina + Jordan + Cambodia + Kuwait + Colombia + Brazil + Botswana + Mexico + Oman + Uruguay + Saudi Arabia + Chile + Iran, Islamic Rep + Indonesia + Qatar + Armenia + United Arab Emirates + Costa Rica + Bahrain + Malta + Thailand + Azerbaijan + Turkey + Trinidad and Tobago + Romania + China + Cyprus + Sri Lanka + Georgia + Malaysia + Bulgaria + Israel + New Zealand + Australia + Slovak Republic + Serbia + United States + France + Portugal + Belgium + Poland + Norway + Hungary + Slovenia + Germany + Spain + Canada + Croatia + Latvia + Macao SAR, China + Denmark + Italy + United Kingdom + Russian Federation + Hong Kong SAR, China + Czech Republic + Korea, Rep + Lithuania + Singapore + Finland + Austria + Ireland + Sweden + Japan + Kazakhstan + Vietnam + Netherlands + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 100% + 80% + 60% + 40% + 20% + 0% + 20% + 40% + 60% + 80% + 100% diff --git a/test/output/letterFrequencyBar.svg b/test/output/letterFrequencyBar.svg index f559a77824..d1b0b15ebb 100644 --- a/test/output/letterFrequencyBar.svg +++ b/test/output/letterFrequencyBar.svg @@ -13,115 +13,91 @@ white-space: pre; } - - - Z - - - Q - - - X - - - J - - - K - - - V - - - B - - - P - - - Y - - - G - - - F - - - W - - - M - - - U - - - C - - - L - - - D - - - R - - - H - - - S - - - N - - - I - - - O - - - A - - - T - - - E - + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - 0 - - - - 2 - - - - 4 - - - - 6 - - - - 8 - - - - 10 - - - - 12 - Frequency (%) → + + Z + Q + X + J + K + V + B + P + Y + G + F + W + M + U + C + L + D + R + H + S + N + I + O + A + T + E + + + + + + + + + + + + + + + + + + + + + 0 + 2 + 4 + 6 + 8 + 10 + 12 + + + Frequency (%) → diff --git a/test/output/letterFrequencyCloud.svg b/test/output/letterFrequencyCloud.svg index c20c1f93c9..cccdd61087 100644 --- a/test/output/letterFrequencyCloud.svg +++ b/test/output/letterFrequencyCloud.svg @@ -13,5 +13,32 @@ white-space: pre; } - ETAOINSHRDLCUMWFGYPBVKJXQZ + + E + T + A + O + I + N + S + H + R + D + L + C + U + M + W + F + G + Y + P + B + V + K + J + X + Q + Z + \ No newline at end of file diff --git a/test/output/letterFrequencyColumn.svg b/test/output/letterFrequencyColumn.svg index d20e00ea84..3ca1a31b8e 100644 --- a/test/output/letterFrequencyColumn.svg +++ b/test/output/letterFrequencyColumn.svg @@ -13,139 +13,109 @@ white-space: pre; } - - - - 0 - - - - 1 - - - - 2 - - - - 3 - - - - 4 - - - - 5 - - - - 6 - - - - 7 - - - - 8 - - - - 9 - - - - 10 - - - - 11 - - - - 12 - ↑ Frequency (%) + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 0 + 1 + 2 + 3 + 4 + 5 + 6 + 7 + 8 + 9 + 10 + 11 + 12 + + + ↑ Frequency (%) + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - A - - - B - - - C - - - D - - - E - - - F - - - G - - - H - - - I - - - J - - - K - - - L - - - M - - - N - - - O - - - P - - - Q - - - R - - - S - - - T - - - U - - - V - - - W - - - X - - - Y - - - Z - + + A + B + C + D + E + F + G + H + I + J + K + L + M + N + O + P + Q + R + S + T + U + V + W + X + Y + Z diff --git a/test/output/letterFrequencyDot.svg b/test/output/letterFrequencyDot.svg index 98a5dc9d56..932d1d8e3b 100644 --- a/test/output/letterFrequencyDot.svg +++ b/test/output/letterFrequencyDot.svg @@ -13,85 +13,64 @@ white-space: pre; } - - - A - - - B - - - C - - - D - - - E - - - F - - - G - - - H - - - I - - - J - - - K - - - L - - - M - - - N - - - O - - - P - - - Q - - - R - - - S - - - T - - - U - - - V - - - W - - - X - - - Y - - - Z - letter + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + A + B + C + D + E + F + G + H + I + J + K + L + M + N + O + P + Q + R + S + T + U + V + W + X + Y + Z + + + letter diff --git a/test/output/letterFrequencyLollipop.svg b/test/output/letterFrequencyLollipop.svg index d59d626856..8720939638 100644 --- a/test/output/letterFrequencyLollipop.svg +++ b/test/output/letterFrequencyLollipop.svg @@ -13,139 +13,112 @@ white-space: pre; } - - - - 0.00 - - - - 0.01 - - - - 0.02 - - - - 0.03 - - - - 0.04 - - - - 0.05 - - - - 0.06 - - - - 0.07 - - - - 0.08 - - - - 0.09 - - - - 0.10 - - - - 0.11 - - - - 0.12 - ↑ frequency + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 0.00 + 0.01 + 0.02 + 0.03 + 0.04 + 0.05 + 0.06 + 0.07 + 0.08 + 0.09 + 0.10 + 0.11 + 0.12 + + + ↑ frequency + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + A + B + C + D + E + F + G + H + I + J + K + L + M + N + O + P + Q + R + S + T + U + V + W + X + Y + Z - - - A - - - B - - - C - - - D - - - E - - - F - - - G - - - H - - - I - - - J - - - K - - - L - - - M - - - N - - - O - - - P - - - Q - - - R - - - S - - - T - - - U - - - V - - - W - - - X - - - Y - - - Z - letter + + letter diff --git a/test/output/letterFrequencyWheel.svg b/test/output/letterFrequencyWheel.svg index cd41d15de0..74f8f9a01b 100644 --- a/test/output/letterFrequencyWheel.svg +++ b/test/output/letterFrequencyWheel.svg @@ -44,5 +44,32 @@ - A8.2%B1.5%C2.8%D4.3%E12.7%F2.3%G2.0%H6.1%I7.0%J0.2%K0.8%L4.0%M2.4%N6.7%O7.5%P1.9%Q0.1%R6.0%S6.3%T9.1%U2.8%V1.0%W2.4%X0.1%Y2.0%Z0.1% + + A8.2% + B1.5% + C2.8% + D4.3% + E12.7% + F2.3% + G2.0% + H6.1% + I7.0% + J0.2% + K0.8% + L4.0% + M2.4% + N6.7% + O7.5% + P1.9% + Q0.1% + R6.0% + S6.3% + T9.1% + U2.8% + V1.0% + W2.4% + X0.1% + Y2.0% + Z0.1% + \ No newline at end of file diff --git a/test/output/likertSurvey.html b/test/output/likertSurvey.html index f1dd034873..1044b89969 100644 --- a/test/output/likertSurvey.html +++ b/test/output/likertSurvey.html @@ -55,45 +55,36 @@ white-space: pre; } - - - Q1 - - - Q2 - - - Q3 - - - Q4 - - - Q5 - Question + + Q1 + Q2 + Q3 + Q4 + Q5 - - - 60 - - - 40 - - - 20 - - - 0 - - - 20 - - - 40 - - - 60 - ← more disagree · Number of responses · more agree → + + Question + + + + + + + + + + + + 60 + 40 + 20 + 0 + 20 + 40 + 60 + + + ← more disagree · Number of responses · more agree → diff --git a/test/output/linearRegressionCars.svg b/test/output/linearRegressionCars.svg index f81e769548..35c8829baa 100644 --- a/test/output/linearRegressionCars.svg +++ b/test/output/linearRegressionCars.svg @@ -13,54 +13,49 @@ white-space: pre; } - - - 10 - - - 15 - - - 20 - - - 25 - - - 30 - - - 35 - - - 40 - - - 45 - ↑ economy (mpg) + + + + + + + + + - - - 2,000 - - - 2,500 - - - 3,000 - - - 3,500 - - - 4,000 - - - 4,500 - - - 5,000 - weight (lb) → + + 10 + 15 + 20 + 25 + 30 + 35 + 40 + 45 + + + ↑ economy (mpg) + + + + + + + + + + + + 2,000 + 2,500 + 3,000 + 3,500 + 4,000 + 4,500 + 5,000 + + + weight (lb) → diff --git a/test/output/linearRegressionMtcars.svg b/test/output/linearRegressionMtcars.svg index 35b4f50f59..281a18c973 100644 --- a/test/output/linearRegressionMtcars.svg +++ b/test/output/linearRegressionMtcars.svg @@ -13,72 +13,61 @@ white-space: pre; } - - - 60 - - - 80 - - - 100 - - - 120 - - - 140 - - - 160 - - - 180 - - - 200 - - - 220 - - - 240 - - - 260 - - - 280 - - - 300 - - - 320 - ↑ hp + + + + + + + + + + + + + + + - - - 2.0 - - - 2.5 - - - 3.0 - - - 3.5 - - - 4.0 - - - 4.5 - - - 5.0 - wt → + + 60 + 80 + 100 + 120 + 140 + 160 + 180 + 200 + 220 + 240 + 260 + 280 + 300 + 320 + + + ↑ hp + + + + + + + + + + + + 2.0 + 2.5 + 3.0 + 3.5 + 4.0 + 4.5 + 5.0 + + + wt → diff --git a/test/output/linearRegressionPenguins.svg b/test/output/linearRegressionPenguins.svg index e79620e94b..025b2bfbfb 100644 --- a/test/output/linearRegressionPenguins.svg +++ b/test/output/linearRegressionPenguins.svg @@ -13,61 +13,62 @@ white-space: pre; } - - - - 14 - - - - 15 - - - - 16 - - - - 17 - - - - 18 - - - - 19 - - - - 20 - - - - 21 - ↑ culmen_depth_mm + + + + + + + + + - - - - 35 - - - - 40 - - - - 45 - - - - 50 - - - - 55 - culmen_length_mm → + + + + + + + + + + + + 14 + 15 + 16 + 17 + 18 + 19 + 20 + 21 + + + ↑ culmen_depth_mm + + + + + + + + + + + + + + + + + 35 + 40 + 45 + 50 + 55 + + + culmen_length_mm → diff --git a/test/output/logDegenerate.svg b/test/output/logDegenerate.svg index 6642dc4f14..c4b30d7b81 100644 --- a/test/output/logDegenerate.svg +++ b/test/output/logDegenerate.svg @@ -13,64 +13,47 @@ white-space: pre; } - - - 100m - - - 200m - - - 300m - - - - - - - - - - - - - - - - - - - - - 1 - - - 2 - - - 3 - - - - - - - - - - - - - - - - - - - - - 10 - + + + + + + + + + + + + + + + + + + + + + + + 100m + 200m + 300m + + + + + + + 1 + 2 + 3 + + + + + + + 10 diff --git a/test/output/longLabels.svg b/test/output/longLabels.svg new file mode 100644 index 0000000000..84dbc6a68b --- /dev/null +++ b/test/output/longLabels.svg @@ -0,0 +1,94 @@ + + + + + + + + + + + + + + + + + + + + 0 + 2 + 4 + 6 + 8 + 10 + 12 + 14 + 16 + 18 + 20 + 22 + 24 + 26 + + + ↑ Responses (%) + + + + + + + + + + + Committed 671birthdays tomemory + Discovered howto “like” thingsmentally + Ex is doing toowell + Family in feudwith Zucker­-bergs + High schoolfriends all deadnow + Not enoughpolitics + + + + + + + + + + + + + + + + + + + + + + + + + + + + + \ No newline at end of file diff --git a/test/output/mandelbrot.svg b/test/output/mandelbrot.svg index 3713eb8637..68074a7b4e 100644 --- a/test/output/mandelbrot.svg +++ b/test/output/mandelbrot.svg @@ -13,63 +13,49 @@ white-space: pre; } - - - −1.0 - - - −0.8 - - - −0.6 - - - −0.4 - - - −0.2 - - - 0.0 - - - 0.2 - - - 0.4 - - - 0.6 - - - 0.8 - - - 1.0 - + + + + + + + + + + + + - - - −2.0 - - - −1.5 - - - −1.0 - - - −0.5 - - - 0.0 - - - 0.5 - - - 1.0 - + + −1.0 + −0.8 + −0.6 + −0.4 + −0.2 + 0.0 + 0.2 + 0.4 + 0.6 + 0.8 + 1.0 + + + + + + + + + + + + −2.0 + −1.5 + −1.0 + −0.5 + 0.0 + 0.5 + 1.0 diff --git a/test/output/markovChain.svg b/test/output/markovChain.svg index 0d614d0f9b..86abc10fb6 100644 --- a/test/output/markovChain.svg +++ b/test/output/markovChain.svg @@ -29,6 +29,20 @@ - ABC - 0.30.20.50.10.70.20.10.10.8 + + A + B + C + + + 0.3 + 0.2 + 0.5 + 0.1 + 0.7 + 0.2 + 0.1 + 0.1 + 0.8 + \ No newline at end of file diff --git a/test/output/metroInequality.svg b/test/output/metroInequality.svg index 7d1e89afec..ccfa66c249 100644 --- a/test/output/metroInequality.svg +++ b/test/output/metroInequality.svg @@ -13,129 +13,113 @@ white-space: pre; } - - - - 3.4 - - - - 3.6 - - - - 3.8 - - - - 4.0 - - - - 4.2 - - - - 4.4 - - - - 4.6 - - - - 4.8 - - - - 5.0 - - - - 5.2 - - - - 5.4 - - - - 5.6 - ↑ Inequality + + + + + + + + + + + + + - - - - 200k - - - - 300k - - - - - - - - - - - - - - - - - - - - - - - - - - - - 1M - - - - 2M - - - - 3M - - - - - - - - - - - - - - - - - - - - - - - - - - - - 10M - Population → + + + + + + + + + + + + + + + + 3.4 + 3.6 + 3.8 + 4.0 + 4.2 + 4.4 + 4.6 + 4.8 + 5.0 + 5.2 + 5.4 + 5.6 + + + ↑ Inequality + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 200k + 300k + + + + + + + 1M + 2M + 3M + + + + + + + 10M + + + Population → diff --git a/test/output/metroInequalityChange.svg b/test/output/metroInequalityChange.svg index f71930ac49..e11fc6aa8c 100644 --- a/test/output/metroInequalityChange.svg +++ b/test/output/metroInequalityChange.svg @@ -13,129 +13,113 @@ white-space: pre; } - - - - 3.5 - - - - 4.0 - - - - 4.5 - - - - 5.0 - - - - 5.5 - - - - 6.0 - - - - 6.5 - - - - 7.0 - - - - 7.5 - - - - 8.0 - - - - 8.5 - ↑ Inequality + + + + + + + + + + + + - - - - 200k - - - - 300k - - - - - - - - - - - - - - - - - - - - - - - - - - - - 1M - - - - 2M - - - - 3M - - - - - - - - - - - - - - - - - - - - - - - - - - - - 10M - - - - 20M - Population → + + + + + + + + + + + + + + + 3.5 + 4.0 + 4.5 + 5.0 + 5.5 + 6.0 + 6.5 + 7.0 + 7.5 + 8.0 + 8.5 + + + ↑ Inequality + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 200k + 300k + + + + + + + 1M + 2M + 3M + + + + + + + 10M + 20M + + + Population → @@ -334,5 +318,14 @@ - New YorkChicagoHoustonWashington, D.C.San FranciscoSan JoseFairfield, Conn.Binghamton, N.Y. + + New York + Chicago + Houston + Washington, D.C. + San Francisco + San Jose + Fairfield, Conn. + Binghamton, N.Y. + \ No newline at end of file diff --git a/test/output/metroUnemployment.svg b/test/output/metroUnemployment.svg index 340121e3c1..041e0444b8 100644 --- a/test/output/metroUnemployment.svg +++ b/test/output/metroUnemployment.svg @@ -13,57 +13,48 @@ white-space: pre; } - - - 0 - - - 2 - - - 4 - - - 6 - - - 8 - - - 10 - - - 12 - - - 14 - - - 16 - ↑ unemployment + + + + + + + + + + - - - 2000 - - - 2002 - - - 2004 - - - 2006 - - - 2008 - - - 2010 - - - 2012 - + + 0 + 2 + 4 + 6 + 8 + 10 + 12 + 14 + 16 + + + ↑ unemployment + + + + + + + + + + + + 2000 + 2002 + 2004 + 2006 + 2008 + 2010 + 2012 diff --git a/test/output/metroUnemploymentHighlight.svg b/test/output/metroUnemploymentHighlight.svg index bd2563c8ba..562f15b3d1 100644 --- a/test/output/metroUnemploymentHighlight.svg +++ b/test/output/metroUnemploymentHighlight.svg @@ -13,66 +13,59 @@ white-space: pre; } - - - - 0 - - - - 2 - - - - 4 - - - - 6 - - - - 8 - - - - 10 - - - - 12 - - - - 14 - - - - 16 - ↑ Unemployment (%) + + + + + + + + + + + + + + + + + + + + + + + + 0 + 2 + 4 + 6 + 8 + 10 + 12 + 14 + 16 + + + ↑ Unemployment (%) + + + + + + + + + - - - 2000 - - - 2002 - - - 2004 - - - 2006 - - - 2008 - - - 2010 - - - 2012 - + + 2000 + 2002 + 2004 + 2006 + 2008 + 2010 + 2012 diff --git a/test/output/metroUnemploymentIndex.svg b/test/output/metroUnemploymentIndex.svg index 281c42dd71..f8a8ddbc5b 100644 --- a/test/output/metroUnemploymentIndex.svg +++ b/test/output/metroUnemploymentIndex.svg @@ -13,54 +13,46 @@ white-space: pre; } - - - 4 - - - 6 - - - 8 - - - 10 - - - 12 - - - 14 - - - 16 - ↑ unemployment + + + + + + + + - - - 0 - - - 1,000 - - - 2,000 - - - 3,000 - - - 4,000 - - - 5,000 - - - 6,000 - - - 7,000 - + + 4 + 6 + 8 + 10 + 12 + 14 + 16 + + + ↑ unemployment + + + + + + + + + + + + + 0 + 1,000 + 2,000 + 3,000 + 4,000 + 5,000 + 6,000 + 7,000 diff --git a/test/output/metroUnemploymentMoving.svg b/test/output/metroUnemploymentMoving.svg index b0f0dbff29..9f082e3074 100644 --- a/test/output/metroUnemploymentMoving.svg +++ b/test/output/metroUnemploymentMoving.svg @@ -13,57 +13,48 @@ white-space: pre; } - - - 0 - - - 2 - - - 4 - - - 6 - - - 8 - - - 10 - - - 12 - - - 14 - - - 16 - ↑ unemployment + + + + + + + + + + - - - 2000 - - - 2002 - - - 2004 - - - 2006 - - - 2008 - - - 2010 - - - 2012 - + + 0 + 2 + 4 + 6 + 8 + 10 + 12 + 14 + 16 + + + ↑ unemployment + + + + + + + + + + + + 2000 + 2002 + 2004 + 2006 + 2008 + 2010 + 2012 diff --git a/test/output/metroUnemploymentNormalize.svg b/test/output/metroUnemploymentNormalize.svg index 8632532eda..02d83f207c 100644 --- a/test/output/metroUnemploymentNormalize.svg +++ b/test/output/metroUnemploymentNormalize.svg @@ -13,58 +13,53 @@ white-space: pre; } - - - - 0.8× - - - - 0.9× - - - - 1× - - - - 2× - - - - 3× - - - - 4× - - - - 5× - ↑ Change in unemployment (%) + + + + + + + + + + + + + + + + + + + + 0.8× + 0.9× + 1× + 2× + 3× + 4× + 5× + + + ↑ Change in unemployment (%) + + + + + + + + + - - - 2000 - - - 2002 - - - 2004 - - - 2006 - - - 2008 - - - 2010 - - - 2012 - + + 2000 + 2002 + 2004 + 2006 + 2008 + 2010 + 2012 diff --git a/test/output/metroUnemploymentRidgeline.svg b/test/output/metroUnemploymentRidgeline.svg index 6cb0ed6366..48d7415254 100644 --- a/test/output/metroUnemploymentRidgeline.svg +++ b/test/output/metroUnemploymentRidgeline.svg @@ -13,659 +13,652 @@ white-space: pre; } - - - Detroit-Livonia-Dearborn, MI Met Div + + + Detroit-Livonia-Dearborn, MI Met Div - - Detroit-Warren-Livonia, MI MSA - - - Warren-Troy-Farmington Hills, MI Met Div - - - Lawrence-Methuen-Salem, MA-NH NECTA Div - - - Los Angeles-Long Beach-Glendale, CA Met Div - - - Miami-Miami Beach-Kendall, FL Met Div - - - Los Angeles-Long Beach-Santa Ana, CA MSA - - - Lake County-Kenosha County, IL-WI Met Div - - - West Palm Beach-Boca Raton-Boynton Beach, FL Met Div - - - Chicago-Joliet-Naperville, IL Met Div - - - Chicago-Joliet-Naperville, IL-IN-WI MSA - - - Miami-Fort Lauderdale-Pompano Beach, FL MSA - - - Oakland-Fremont-Hayward, CA Met Div - - - Gary, IN Met Div - - - Tacoma, WA Met Div - - - San Francisco-Oakland-Fremont, CA MSA - - - Camden, NJ Met Div - - - Brockton-Bridgewater-Easton, MA NECTA Div - - - Seattle-Tacoma-Bellevue, WA MSA - - - Fort Lauderdale-Pompano Beach-Deerfield Beach, FL Met Div - - - New York-White Plains-Wayne, NY-NJ Met Div - - - Santa Ana-Anaheim-Irvine, CA Met Div - - - Seattle-Bellevue-Everett, WA Met Div - - - Newark-Union, NJ-PA Met Div - - - Taunton-Norton-Raynham, MA NECTA Div - - - Lowell-Billerica-Chelmsford, MA-NH NECTA Div - - - New York-Northern New Jersey-Long Island, NY-NJ-PA MSA - - - San Francisco-San Mateo-Redwood City, CA Met Div - - - Edison-New Brunswick, NJ Met Div - - - Philadelphia-Camden-Wilmington, PA-NJ-DE-MD MSA - - - Wilmington, DE-MD-NJ Met Div - - - Peabody, MA NECTA Div - - - Philadelphia, PA Met Div - - - Fort Worth-Arlington, TX Met Div - - - Dallas-Fort Worth-Arlington, TX MSA - - - Dallas-Plano-Irving, TX Met Div - - - Haverhill-North Andover-Amesbury, MA-NH NECTA Div - - - Boston-Cambridge-Quincy, MA-NH Met NECTA - - - Boston-Cambridge-Quincy, MA NECTA Div - - - Nassau-Suffolk, NY Met Div - - - Framingham, MA NECTA Div - - - Nashua, NH-MA NECTA Div - - - Washington-Arlington-Alexandria, DC-VA-MD-WV Met Div + + - - Washington-Arlington-Alexandria, DC-VA-MD-WV MSA + + - - Bethesda-Rockville-Frederick, MD Met Div + + - - - 2000 - - - 2002 - - - 2004 - - - 2006 - - - 2008 - - - 2010 + + + Detroit-Warren-Livonia, MI MSA - - 2012 - - - - + - + - + - + + + Warren-Troy-Farmington Hills, MI Met Div + - + - + - + - + + + Lawrence-Methuen-Salem, MA-NH NECTA Div + - + - + - + - + + + Los Angeles-Long Beach-Glendale, CA Met Div + - + - + - + - + + + Miami-Miami Beach-Kendall, FL Met Div + - + - + - + - + + + Los Angeles-Long Beach-Santa Ana, CA MSA + - + - + - + - + + + Lake County-Kenosha County, IL-WI Met Div + - + - + - + - + + + West Palm Beach-Boca Raton-Boynton Beach, FL Met Div + - + - + - + - + + + Chicago-Joliet-Naperville, IL Met Div + - + - + - + - + + + Chicago-Joliet-Naperville, IL-IN-WI MSA + - + - + - + - + + + Miami-Fort Lauderdale-Pompano Beach, FL MSA + - + - + - + - + + + Oakland-Fremont-Hayward, CA Met Div + - + - + - + - + + + Gary, IN Met Div + - + - + - + - + + + Tacoma, WA Met Div + - + - + - + - + + + San Francisco-Oakland-Fremont, CA MSA + - + - + - + - + + + Camden, NJ Met Div + - + - + - + - + + + Brockton-Bridgewater-Easton, MA NECTA Div + - + - + - + - + + + Seattle-Tacoma-Bellevue, WA MSA + - + - + - + - + + + Fort Lauderdale-Pompano Beach-Deerfield Beach, FL Met Div + - + - + - + - + + + New York-White Plains-Wayne, NY-NJ Met Div + - + - + - + - + + + Santa Ana-Anaheim-Irvine, CA Met Div + - + - + - + - + + + Seattle-Bellevue-Everett, WA Met Div + - + - + - + - + + + Newark-Union, NJ-PA Met Div + - + - + - + - + + + Taunton-Norton-Raynham, MA NECTA Div + - + - + - + - + + + Lowell-Billerica-Chelmsford, MA-NH NECTA Div + - + - + - + - + + + New York-Northern New Jersey-Long Island, NY-NJ-PA MSA + - + - + - + - + + + San Francisco-San Mateo-Redwood City, CA Met Div + - + - + - + - + + + Edison-New Brunswick, NJ Met Div + - + - + - + - + + + Philadelphia-Camden-Wilmington, PA-NJ-DE-MD MSA + - + - + - + - + + + Wilmington, DE-MD-NJ Met Div + - + - + - + - + + + Peabody, MA NECTA Div + - + - + - + - + + + Philadelphia, PA Met Div + - + - + - + - + + + Fort Worth-Arlington, TX Met Div + - + - + - + - + + + Dallas-Fort Worth-Arlington, TX MSA + - + - + - + - + + + Dallas-Plano-Irving, TX Met Div + - + - + - + - + + + Haverhill-North Andover-Amesbury, MA-NH NECTA Div + - + - + - + - + + + Boston-Cambridge-Quincy, MA-NH Met NECTA + - + - + - + - + + + Boston-Cambridge-Quincy, MA NECTA Div + - + - + - + - + + + Nassau-Suffolk, NY Met Div + - + - + - + - + + + Framingham, MA NECTA Div + - + - + - + - + + + Nashua, NH-MA NECTA Div + - + - + - + - + + + Washington-Arlington-Alexandria, DC-VA-MD-WV Met Div + - + - + - + - + + + Washington-Arlington-Alexandria, DC-VA-MD-WV MSA + - + - + - + - - - + + + Bethesda-Rockville-Frederick, MD Met Div - - + + + + + + + + - - + + 2000 + 2002 + 2004 + 2006 + 2008 + 2010 + 2012 - - - + - + - + \ No newline at end of file diff --git a/test/output/metroUnemploymentSlope.svg b/test/output/metroUnemploymentSlope.svg index fecf196792..bc3bdb7073 100644 --- a/test/output/metroUnemploymentSlope.svg +++ b/test/output/metroUnemploymentSlope.svg @@ -13,66 +13,59 @@ white-space: pre; } - - - - 0 - - - - 2 - - - - 4 - - - - 6 - - - - 8 - - - - 10 - - - - 12 - - - - 14 - - - - 16 - ↑ unemployment + + + + + + + + + + + + + + + + + + + + + + + + 0 + 2 + 4 + 6 + 8 + 10 + 12 + 14 + 16 + + + ↑ unemployment + + + + + + + + + - - - 2000 - - - 2002 - - - 2004 - - - 2006 - - - 2008 - - - 2010 - - - 2012 - + + 2000 + 2002 + 2004 + 2006 + 2008 + 2010 + 2012 diff --git a/test/output/metroUnemploymentStroke.svg b/test/output/metroUnemploymentStroke.svg index 0397aeabb0..f146ab05fb 100644 --- a/test/output/metroUnemploymentStroke.svg +++ b/test/output/metroUnemploymentStroke.svg @@ -13,57 +13,48 @@ white-space: pre; } - - - 0 - - - 2 - - - 4 - - - 6 - - - 8 - - - 10 - - - 12 - - - 14 - - - 16 - ↑ unemployment + + + + + + + + + + - - - 2000 - - - 2002 - - - 2004 - - - 2006 - - - 2008 - - - 2010 - - - 2012 - + + 0 + 2 + 4 + 6 + 8 + 10 + 12 + 14 + 16 + + + ↑ unemployment + + + + + + + + + + + + 2000 + 2002 + 2004 + 2006 + 2008 + 2010 + 2012 diff --git a/test/output/mobyDick.svg b/test/output/mobyDick.svg index 9e5f991e6f..cdbb9b9fea 100644 --- a/test/output/mobyDick.svg +++ b/test/output/mobyDick.svg @@ -13,5 +13,7 @@ white-space: pre; } - Call me Ishmael. Some years ago—never mind how long precisely—having little orno money in my purse, and nothing particular to interest me on shore, I thought Iwould sail about a little and see the watery part of the world. It is a way I have ofdriving off the spleen and regulating the circulation. Whenever I find myselfgrowing grim about the mouth; whenever it is a damp, drizzly November in mysoul; whenever I find myself involuntarily pausing before coffin warehouses, andbringing up the rear of every funeral I meet; and especially whenever my hypos getsuch an upper hand of me, that it requires a strong moral principle to prevent mefrom deliberately stepping into the street, and methodically knocking people’shats off—then, I account it high time to get to sea as soon as I can. This is mysubstitute for pistol and ball. With a philosophical flourish Cato throws himselfupon his sword; I quietly take to the ship. There is nothing surprising in this. If theybut knew it, almost all men in their degree, some time or other, cherish very nearlythe same feelings towards the ocean with me.There now is your insular city of the Manhattoes, belted round by wharves asIndian isles by coral reefs—commerce surrounds it with her surf. Right and left, thestreets take you waterward. Its extreme downtown is the battery, where that noblemole is washed by waves, and cooled by breezes, which a few hours previouswere out of sight of land. Look at the crowds of water-gazers there.Circumambulate the city of a dreamy Sabbath afternoon. Go from Corlears Hook toCoenties Slip, and from thence, by Whitehall, northward. What do yousee?—Posted like silent sentinels all around the town, stand thousands uponthousands of mortal men fixed in ocean reveries. Some leaning against the spiles;some seated upon the pier-heads; some looking over the bulwarks of ships fromChina; some high aloft in the rigging, as if striving to get a still better seawardpeep. But these are all landsmen; of week days pent up in lath and plaster—tied tocounters, nailed to benches, clinched to desks. How then is this? Are the greenfields gone? What do they here?But look! here come more crowds, pacing straight for the water, and seeminglybound for a dive. Strange! Nothing will content them but the extremest limit of theland; loitering under the shady lee of yonder warehouses will not suffice. No. Theymust get just as nigh the water as they possibly can without falling in. And therethey stand—miles of them—leagues. Inlanders all, they come from lanes and alleys,streets and avenues—north, east, south, and west. Yet here they all unite. Tell me,does the magnetic virtue of the needles of the compasses of all those ships attractthem thither?Once more. Say you are in the country; in some high land of lakes. Take almostany path you please, and ten to one it carries you down in a dale, and leaves youthere by a pool in the stream. There is magic in it. Let the most absent-minded ofmen be plunged in his deepest reveries—stand that man on his legs, set his feet a-going, and he will infallibly lead you to water, if water there be in all that region.Should you ever be athirst in the great American desert, try this experiment, ifyour caravan happen to be supplied with a metaphysical professor. Yes, as everyone knows, meditation and water are wedded for ever.But here is an artist. He desires to paint you the dreamiest, shadiest, quietest,most enchanting bit of romantic landscape in all the valley of the Saco. What is thechief element he employs? There stand his trees, each with a hollow trunk, as if ahermit and a crucifix were within; and here sleeps his meadow, and there sleep hiscattle; and up from yonder cottage goes a sleepy smoke. Deep into distantwoodlands winds a mazy way, reaching to overlapping spurs of mountains bathedin their hill-side blue. But though the picture lies thus tranced, and though thispine-tree shakes down its sighs like leaves upon this shepherd’s head, yet all werevain, unless the shepherd’s eye were fixed upon the magic stream before him. Govisit the Prairies in June, when for scores on scores of miles you wade knee-deepamong Tiger-lilies—what is the one charm wanting?—Water—there is not a drop ofwater there! Were Niagara but a cataract of sand, would you travel your thousandmiles to see it? Why did the poor poet of Tennessee, upon suddenly receiving twohandfuls of silver, deliberate whether to buy him a coat, which he sadly needed, orinvest his money in a pedestrian trip to Rockaway Beach? Why is almost everyrobust healthy boy with a robust healthy soul in him, at some time or other crazyto go to sea? Why upon your first voyage as a passenger, did you yourself feelsuch a mystical vibration, when first told that you and your ship were now out ofsight of land? Why did the old Persians hold the sea holy? Why did the Greeks giveit a separate deity, and own brother of Jove? Surely all this is not without meaning.And still deeper the meaning of that story of Narcissus, who because he could notgrasp the tormenting, mild image he saw in the fountain, plunged into it and wasdrowned. But that same image, we ourselves see in all rivers and oceans. It is theimage of the ungraspable phantom of life; and this is the key to it all.Now, when I say that I am in the habit of going to sea whenever I begin to growhazy about the eyes, and begin to be over conscious of my lungs, I do not mean tohave it inferred that I ever go to sea as a passenger. For to go as a passenger youmust needs have a purse, and a purse is but a rag unless you have something in it.Besides, passengers get sea-sick—grow quarrelsome—don’t sleep of nights—do notenjoy themselves much, as a general thing;—no, I never go as a passenger; nor,though I am something of a salt, do I ever go to sea as a Commodore, or a Captain,or a Cook. I abandon the glory and distinction of such offices to those who likethem. For my part, I abominate all honorable respectable toils, trials, andtribulations of every kind whatsoever. It is quite as much as I can do to take careof myself, without taking care of ships, barques, brigs, schooners, and what not.And as for going as cook,—though I confess there is considerable glory in that, acook being a sort of officer on ship-board—yet, somehow, I never fancied broilingfowls;—though once broiled, judiciously buttered, and judgmatically salted andpeppered, there is no one who will speak more respectfully, not to sayreverentially, of a broiled fowl than I will. It is out of the idolatrous dotings of theold Egyptians upon broiled ibis and roasted river horse, that you see the mummiesof those creatures in their huge bake-houses the pyramids.No, when I go to sea, I go as a simple sailor, right before the mast, plumb downinto the forecastle, aloft there to the royal mast-head. True, they rather order meabout some, and make me jump from spar to spar, like a grasshopper in a Maymeadow. And at first, this sort of thing is unpleasant enough. It touches one’ssense of honor, particularly if you come of an old established family in the land,the Van Rensselaers, or Randolphs, or Hardicanutes. And more than all, if justprevious to putting your hand into the tar-pot, you have been lording it as acountry schoolmaster, making the tallest boys stand in awe of you. The transitionis a keen one, I assure you, from a schoolmaster to a sailor, and requires a strongdecoction of Seneca and the Stoics to enable you to grin and bear it. But even thiswears off in time.What of it, if some old hunks of a sea-captain orders me to get a broom and sweepdown the decks? What does that indignity amount to, weighed, I mean, in thescales of the New Testament? Do you think the archangel Gabriel thinks anythingthe less of me, because I promptly and respectfully obey that old hunks in thatparticular instance? Who ain’t a slave? Tell me that. Well, then, however the oldsea-captains may order me about—however they may thump and punch me about, Ihave the satisfaction of knowing that it is all right; that everybody else is one wayor other served in much the same way—either in a physical or metaphysical point ofview, that is; and so the universal thump is passed round, and all hands should rubeach other’s shoulder-blades, and be content.Again, I always go to sea as a sailor, because they make a point of paying me formy trouble, whereas they never pay passengers a single penny that I ever heardof. On the contrary, passengers themselves must pay. And there is all thedifference in the world between paying and being paid. The act of paying isperhaps the most uncomfortable infliction that the two orchard thieves entailedupon us. But being paid,—what will compare with it? The urbane activity with whicha man receives money is really marvellous, considering that we so earnestlybelieve money to be the root of all earthly ills, and that on no account can amonied man enter heaven. Ah! how cheerfully we consign ourselves to perdition!Finally, I always go to sea as a sailor, because of the wholesome exercise and pureair of the fore-castle deck. For as in this world, head winds are far more prevalentthan winds from astern (that is, if you never violate the Pythagorean maxim), so forthe most part the Commodore on the quarter-deck gets his atmosphere at secondhand from the sailors on the forecastle. He thinks he breathes it first; but not so. Inmuch the same way do the commonalty lead their leaders in many other things, atthe same time that the leaders little suspect it. But wherefore it was that afterhaving repeatedly smelt the sea as a merchant sailor, I should now take it into myhead to go on a whaling voyage; this the invisible police officer of the Fates, whohas the constant surveillance of me, and secretly dogs me, and influences me insome unaccountable way—he can better answer than any one else. And, doubtless,my going on this whaling voyage, formed part of the grand programme ofProvidence that was drawn up a long time ago. It came in as a sort of briefinterlude and solo between more extensive performances. I take it that this part ofthe bill must have run something like this:“Grand Contested Election for the Presidency of the United States. “WHALINGVOYAGE BY ONE ISHMAEL. “BLOODY BATTLE IN AFFGHANISTAN.”Though I cannot tell why it was exactly that those stage managers, the Fates, putme down for this shabby part of a whaling voyage, when others were set down formagnificent parts in high tragedies, and short and easy parts in genteel comedies,and jolly parts in farces—though I cannot tell why this was exactly; yet, now that Irecall all the circumstances, I think I can see a little into the springs and motiveswhich being cunningly presented to me under various disguises, induced me to setabout performing the part I did, besides cajoling me into the delusion that it was achoice resulting from my own unbiased freewill and discriminating judgment.Chief among these motives was the overwhelming idea of the great whale himself.Such a portentous and mysterious monster roused all my curiosity. Then the wildand distant seas where he rolled his island bulk; the undeliverable, nameless perilsof the whale; these, with all the attending marvels of a thousand Patagonian sightsand sounds, helped to sway me to my wish. With other men, perhaps, such thingswould not have been inducements; but as for me, I am tormented with aneverlasting itch for things remote. I love to sail forbidden seas, and land onbarbarous coasts. Not ignoring what is good, I am quick to perceive a horror, andcould still be social with it—would they let me—since it is but well to be on friendlyterms with all the inmates of the place one lodges in.By reason of these things, then, the whaling voyage was welcome; the great flood-gates of the wonder-world swung open, and in the wild conceits that swayed meto my purpose, two and two there floated into my inmost soul, endlessprocessions of the whale, and, mid most of them all, one grand hooded phantom,like a snow hill in the air. + + Call me Ishmael. Some years ago—never mind how long precisely—having little orno money in my purse, and nothing particular to interest me on shore, I thought Iwould sail about a little and see the watery part of the world. It is a way I have ofdriving off the spleen and regulating the circulation. Whenever I find myselfgrowing grim about the mouth; whenever it is a damp, drizzly November in mysoul; whenever I find myself involuntarily pausing before coffin warehouses, andbringing up the rear of every funeral I meet; and especially whenever my hypos getsuch an upper hand of me, that it requires a strong moral principle to prevent mefrom deliberately stepping into the street, and methodically knocking people’shats off—then, I account it high time to get to sea as soon as I can. This is mysubstitute for pistol and ball. With a philosophical flourish Cato throws himselfupon his sword; I quietly take to the ship. There is nothing surprising in this. If theybut knew it, almost all men in their degree, some time or other, cherish very nearlythe same feelings towards the ocean with me.There now is your insular city of the Manhattoes, belted round by wharves asIndian isles by coral reefs—commerce surrounds it with her surf. Right and left, thestreets take you waterward. Its extreme downtown is the battery, where that noblemole is washed by waves, and cooled by breezes, which a few hours previouswere out of sight of land. Look at the crowds of water-gazers there.Circumambulate the city of a dreamy Sabbath afternoon. Go from Corlears Hook toCoenties Slip, and from thence, by Whitehall, northward. What do yousee?—Posted like silent sentinels all around the town, stand thousands uponthousands of mortal men fixed in ocean reveries. Some leaning against the spiles;some seated upon the pier-heads; some looking over the bulwarks of ships fromChina; some high aloft in the rigging, as if striving to get a still better seawardpeep. But these are all landsmen; of week days pent up in lath and plaster—tied tocounters, nailed to benches, clinched to desks. How then is this? Are the greenfields gone? What do they here?But look! here come more crowds, pacing straight for the water, and seeminglybound for a dive. Strange! Nothing will content them but the extremest limit of theland; loitering under the shady lee of yonder warehouses will not suffice. No. Theymust get just as nigh the water as they possibly can without falling in. And therethey stand—miles of them—leagues. Inlanders all, they come from lanes and alleys,streets and avenues—north, east, south, and west. Yet here they all unite. Tell me,does the magnetic virtue of the needles of the compasses of all those ships attractthem thither?Once more. Say you are in the country; in some high land of lakes. Take almostany path you please, and ten to one it carries you down in a dale, and leaves youthere by a pool in the stream. There is magic in it. Let the most absent-minded ofmen be plunged in his deepest reveries—stand that man on his legs, set his feet a-going, and he will infallibly lead you to water, if water there be in all that region.Should you ever be athirst in the great American desert, try this experiment, ifyour caravan happen to be supplied with a metaphysical professor. Yes, as everyone knows, meditation and water are wedded for ever.But here is an artist. He desires to paint you the dreamiest, shadiest, quietest,most enchanting bit of romantic landscape in all the valley of the Saco. What is thechief element he employs? There stand his trees, each with a hollow trunk, as if ahermit and a crucifix were within; and here sleeps his meadow, and there sleep hiscattle; and up from yonder cottage goes a sleepy smoke. Deep into distantwoodlands winds a mazy way, reaching to overlapping spurs of mountains bathedin their hill-side blue. But though the picture lies thus tranced, and though thispine-tree shakes down its sighs like leaves upon this shepherd’s head, yet all werevain, unless the shepherd’s eye were fixed upon the magic stream before him. Govisit the Prairies in June, when for scores on scores of miles you wade knee-deepamong Tiger-lilies—what is the one charm wanting?—Water—there is not a drop ofwater there! Were Niagara but a cataract of sand, would you travel your thousandmiles to see it? Why did the poor poet of Tennessee, upon suddenly receiving twohandfuls of silver, deliberate whether to buy him a coat, which he sadly needed, orinvest his money in a pedestrian trip to Rockaway Beach? Why is almost everyrobust healthy boy with a robust healthy soul in him, at some time or other crazyto go to sea? Why upon your first voyage as a passenger, did you yourself feelsuch a mystical vibration, when first told that you and your ship were now out ofsight of land? Why did the old Persians hold the sea holy? Why did the Greeks giveit a separate deity, and own brother of Jove? Surely all this is not without meaning.And still deeper the meaning of that story of Narcissus, who because he could notgrasp the tormenting, mild image he saw in the fountain, plunged into it and wasdrowned. But that same image, we ourselves see in all rivers and oceans. It is theimage of the ungraspable phantom of life; and this is the key to it all.Now, when I say that I am in the habit of going to sea whenever I begin to growhazy about the eyes, and begin to be over conscious of my lungs, I do not mean tohave it inferred that I ever go to sea as a passenger. For to go as a passenger youmust needs have a purse, and a purse is but a rag unless you have something in it.Besides, passengers get sea-sick—grow quarrelsome—don’t sleep of nights—do notenjoy themselves much, as a general thing;—no, I never go as a passenger; nor,though I am something of a salt, do I ever go to sea as a Commodore, or a Captain,or a Cook. I abandon the glory and distinction of such offices to those who likethem. For my part, I abominate all honorable respectable toils, trials, andtribulations of every kind whatsoever. It is quite as much as I can do to take careof myself, without taking care of ships, barques, brigs, schooners, and what not.And as for going as cook,—though I confess there is considerable glory in that, acook being a sort of officer on ship-board—yet, somehow, I never fancied broilingfowls;—though once broiled, judiciously buttered, and judgmatically salted andpeppered, there is no one who will speak more respectfully, not to sayreverentially, of a broiled fowl than I will. It is out of the idolatrous dotings of theold Egyptians upon broiled ibis and roasted river horse, that you see the mummiesof those creatures in their huge bake-houses the pyramids.No, when I go to sea, I go as a simple sailor, right before the mast, plumb downinto the forecastle, aloft there to the royal mast-head. True, they rather order meabout some, and make me jump from spar to spar, like a grasshopper in a Maymeadow. And at first, this sort of thing is unpleasant enough. It touches one’ssense of honor, particularly if you come of an old established family in the land,the Van Rensselaers, or Randolphs, or Hardicanutes. And more than all, if justprevious to putting your hand into the tar-pot, you have been lording it as acountry schoolmaster, making the tallest boys stand in awe of you. The transitionis a keen one, I assure you, from a schoolmaster to a sailor, and requires a strongdecoction of Seneca and the Stoics to enable you to grin and bear it. But even thiswears off in time.What of it, if some old hunks of a sea-captain orders me to get a broom and sweepdown the decks? What does that indignity amount to, weighed, I mean, in thescales of the New Testament? Do you think the archangel Gabriel thinks anythingthe less of me, because I promptly and respectfully obey that old hunks in thatparticular instance? Who ain’t a slave? Tell me that. Well, then, however the oldsea-captains may order me about—however they may thump and punch me about, Ihave the satisfaction of knowing that it is all right; that everybody else is one wayor other served in much the same way—either in a physical or metaphysical point ofview, that is; and so the universal thump is passed round, and all hands should rubeach other’s shoulder-blades, and be content.Again, I always go to sea as a sailor, because they make a point of paying me formy trouble, whereas they never pay passengers a single penny that I ever heardof. On the contrary, passengers themselves must pay. And there is all thedifference in the world between paying and being paid. The act of paying isperhaps the most uncomfortable infliction that the two orchard thieves entailedupon us. But being paid,—what will compare with it? The urbane activity with whicha man receives money is really marvellous, considering that we so earnestlybelieve money to be the root of all earthly ills, and that on no account can amonied man enter heaven. Ah! how cheerfully we consign ourselves to perdition!Finally, I always go to sea as a sailor, because of the wholesome exercise and pureair of the fore-castle deck. For as in this world, head winds are far more prevalentthan winds from astern (that is, if you never violate the Pythagorean maxim), so forthe most part the Commodore on the quarter-deck gets his atmosphere at secondhand from the sailors on the forecastle. He thinks he breathes it first; but not so. Inmuch the same way do the commonalty lead their leaders in many other things, atthe same time that the leaders little suspect it. But wherefore it was that afterhaving repeatedly smelt the sea as a merchant sailor, I should now take it into myhead to go on a whaling voyage; this the invisible police officer of the Fates, whohas the constant surveillance of me, and secretly dogs me, and influences me insome unaccountable way—he can better answer than any one else. And, doubtless,my going on this whaling voyage, formed part of the grand programme ofProvidence that was drawn up a long time ago. It came in as a sort of briefinterlude and solo between more extensive performances. I take it that this part ofthe bill must have run something like this:“Grand Contested Election for the Presidency of the United States. “WHALINGVOYAGE BY ONE ISHMAEL. “BLOODY BATTLE IN AFFGHANISTAN.”Though I cannot tell why it was exactly that those stage managers, the Fates, putme down for this shabby part of a whaling voyage, when others were set down formagnificent parts in high tragedies, and short and easy parts in genteel comedies,and jolly parts in farces—though I cannot tell why this was exactly; yet, now that Irecall all the circumstances, I think I can see a little into the springs and motiveswhich being cunningly presented to me under various disguises, induced me to setabout performing the part I did, besides cajoling me into the delusion that it was achoice resulting from my own unbiased freewill and discriminating judgment.Chief among these motives was the overwhelming idea of the great whale himself.Such a portentous and mysterious monster roused all my curiosity. Then the wildand distant seas where he rolled his island bulk; the undeliverable, nameless perilsof the whale; these, with all the attending marvels of a thousand Patagonian sightsand sounds, helped to sway me to my wish. With other men, perhaps, such thingswould not have been inducements; but as for me, I am tormented with aneverlasting itch for things remote. I love to sail forbidden seas, and land onbarbarous coasts. Not ignoring what is good, I am quick to perceive a horror, andcould still be social with it—would they let me—since it is but well to be on friendlyterms with all the inmates of the place one lodges in.By reason of these things, then, the whaling voyage was welcome; the great flood-gates of the wonder-world swung open, and in the wild conceits that swayed meto my purpose, two and two there floated into my inmost soul, endlessprocessions of the whale, and, mid most of them all, one grand hooded phantom,like a snow hill in the air. + \ No newline at end of file diff --git a/test/output/mobyDickFaceted.svg b/test/output/mobyDickFaceted.svg index c138bac747..e492f99d5d 100644 --- a/test/output/mobyDickFaceted.svg +++ b/test/output/mobyDickFaceted.svg @@ -13,316 +13,279 @@ white-space: pre; } - - - lower + + + consonant + + + + + + + + + + + + + + + + + + + + + 0 + 200 + 400 + 600 + 800 + 1,000 + 1,200 - - upper - - - - - - - - vowel - - - - - 0 - - - - 200 - - - - 400 - - - - 600 - - - - 800 - - - - 1,000 - - - - 1,200 - - ↑ Frequency - - - - 0 - - - - 200 - - - - 400 - - - - 600 - - - - 800 - - - - 1,000 - - - - 1,200 - - - - - - A - - - B - - - C - - - D - - - E - - - F - - - G - - - H - - - I - - - J - - - K - - - L - - - M - - - N - - - O - - - P - - - Q - - - R - - - S - - - T - - - U - - - V - - - W - - - X - - - Y - - - Z - - - - - A - - - B - - - C - - - D - - - E - - - F - - - G - - - H - - - I - - - J - - - K - - - L - - - M - - - N - - - O - - - P - - - Q - - - R - - - S - - - T - - - U - - - V - - - W - - - X - - - Y - - - Z - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + - + - + + + + + + + + + + + + + + + + + + + + + 0 + 200 + 400 + 600 + 800 + 1,000 + 1,200 + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + A + B + C + D + E + F + G + H + I + J + K + L + M + N + O + P + Q + R + S + T + U + V + W + X + Y + Z + - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + - + - + + + lower + + + vowel + + + + + + + + + + - - - - - - + + + + + + - + - + + + upper + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + A + B + C + D + E + F + G + H + I + J + K + L + M + N + O + P + Q + R + S + T + U + V + W + X + Y + Z + - - - - - - + + + + + + - + + + ↑ Frequency + \ No newline at end of file diff --git a/test/output/mobyDickLetterFrequency.svg b/test/output/mobyDickLetterFrequency.svg index 8bf63d99e2..5f1e0dafe2 100644 --- a/test/output/mobyDickLetterFrequency.svg +++ b/test/output/mobyDickLetterFrequency.svg @@ -13,139 +13,109 @@ white-space: pre; } - - - - 0 - - - - 100 - - - - 200 - - - - 300 - - - - 400 - - - - 500 - - - - 600 - - - - 700 - - - - 800 - - - - 900 - - - - 1,000 - - - - 1,100 - - - - 1,200 - ↑ Frequency + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 0 + 100 + 200 + 300 + 400 + 500 + 600 + 700 + 800 + 900 + 1,000 + 1,100 + 1,200 + + + ↑ Frequency + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - A - - - B - - - C - - - D - - - E - - - F - - - G - - - H - - - I - - - J - - - K - - - L - - - M - - - N - - - O - - - P - - - Q - - - R - - - S - - - T - - - U - - - V - - - W - - - X - - - Y - - - Z - + + A + B + C + D + E + F + G + H + I + J + K + L + M + N + O + P + Q + R + S + T + U + V + W + X + Y + Z diff --git a/test/output/mobyDickLetterPairs.svg b/test/output/mobyDickLetterPairs.svg index 672c31500e..75932be4e7 100644 --- a/test/output/mobyDickLetterPairs.svg +++ b/test/output/mobyDickLetterPairs.svg @@ -13,88 +13,63 @@ white-space: pre; } - - - * - - - A - - - B - - - C - - - D - - - E - - - F - - - G - - - H - - - I - - - J - - - K - - - L - - - M - - - N - - - O - - - P - - - Q - - - R - - - S - - - T - - - U - - - V - - - W - - - X - - - Y - - - Z - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + * + A + B + C + D + E + F + G + H + I + J + K + L + M + N + O + P + Q + R + S + T + U + V + W + X + Y + Z @@ -125,5 +100,383 @@ - ***********************AAAAAAAAAAAAAAAAAAAAAAABBBBBBBBBBCCCCCCCCCCCCDDDDDDDDDDDEEEEEEEEEEEEEEEEEEEEEEEEEFFFFFFFFFFFFFFGGGGGGGGGGGHHHHHHHHHHHIIIIIIIIIIIIIIIIIIIIIIIJJJKKKKKKKKKKLLLLLLLLLLLLLLLLLLLLMMMMMMMMMMMMMMNNNNNNNNNNNNOOOOOOOOOOOOOOOOOOOOOPPPPPPPPPPPPPPQQQRRRRRRRRRRRRRRRRSSSSSSSSSSSSSSSSSSSSSSTTTTTTTTTTTTTTTTTTUUUUUUUUUUUUUUUUUUUVVVVVVVVWWWWWWWWWXXXYYYYYYYYYYYYYYYYYYZZZZ + + * + * + * + * + * + * + * + * + * + * + * + * + * + * + * + * + * + * + * + * + * + * + * + A + A + A + A + A + A + A + A + A + A + A + A + A + A + A + A + A + A + A + A + A + A + A + B + B + B + B + B + B + B + B + B + B + C + C + C + C + C + C + C + C + C + C + C + C + D + D + D + D + D + D + D + D + D + D + D + E + E + E + E + E + E + E + E + E + E + E + E + E + E + E + E + E + E + E + E + E + E + E + E + E + F + F + F + F + F + F + F + F + F + F + F + F + F + F + G + G + G + G + G + G + G + G + G + G + G + H + H + H + H + H + H + H + H + H + H + H + I + I + I + I + I + I + I + I + I + I + I + I + I + I + I + I + I + I + I + I + I + I + I + J + J + J + K + K + K + K + K + K + K + K + K + K + L + L + L + L + L + L + L + L + L + L + L + L + L + L + L + L + L + L + L + L + M + M + M + M + M + M + M + M + M + M + M + M + M + M + N + N + N + N + N + N + N + N + N + N + N + N + O + O + O + O + O + O + O + O + O + O + O + O + O + O + O + O + O + O + O + O + O + P + P + P + P + P + P + P + P + P + P + P + P + P + P + Q + Q + Q + R + R + R + R + R + R + R + R + R + R + R + R + R + R + R + R + S + S + S + S + S + S + S + S + S + S + S + S + S + S + S + S + S + S + S + S + S + S + T + T + T + T + T + T + T + T + T + T + T + T + T + T + T + T + T + T + U + U + U + U + U + U + U + U + U + U + U + U + U + U + U + U + U + U + U + V + V + V + V + V + V + V + V + W + W + W + W + W + W + W + W + W + X + X + X + Y + Y + Y + Y + Y + Y + Y + Y + Y + Y + Y + Y + Y + Y + Y + Y + Y + Y + Z + Z + Z + Z + \ No newline at end of file diff --git a/test/output/mobyDickLetterPosition.svg b/test/output/mobyDickLetterPosition.svg index 4cf362beac..e7e595f136 100644 --- a/test/output/mobyDickLetterPosition.svg +++ b/test/output/mobyDickLetterPosition.svg @@ -13,129 +13,96 @@ white-space: pre; } - - - A - - - B - - - C - - - D - - - E - - - F - - - G - - - H - - - I - - - J - - - K - - - L - - - M - - - N - - - O - - - P - - - Q - - - R - - - S - - - T - - - U - - - V - - - W - - - X - - - Y - - - Z - + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - 0 - - - 1 - - - 2 - - - 3 - - - 4 - - - 5 - - - 6 - - - 7 - - - 8 - - - 9 - - - 10 - - - 11 - - - 12 - - - 13 - Position within word + + A + B + C + D + E + F + G + H + I + J + K + L + M + N + O + P + Q + R + S + T + U + V + W + X + Y + Z + + + + + + + + + + + + + + + + + + + 0 + 1 + 2 + 3 + 4 + 5 + 6 + 7 + 8 + 9 + 10 + 11 + 12 + 13 + + + Position within word diff --git a/test/output/mobyDickLetterRelativeFrequency.svg b/test/output/mobyDickLetterRelativeFrequency.svg index bddfb60f70..00540f64f6 100644 --- a/test/output/mobyDickLetterRelativeFrequency.svg +++ b/test/output/mobyDickLetterRelativeFrequency.svg @@ -13,139 +13,109 @@ white-space: pre; } - - - - 0 - - - - 1 - - - - 2 - - - - 3 - - - - 4 - - - - 5 - - - - 6 - - - - 7 - - - - 8 - - - - 9 - - - - 10 - - - - 11 - - - - 12 - ↑ Frequency (%) + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 0 + 1 + 2 + 3 + 4 + 5 + 6 + 7 + 8 + 9 + 10 + 11 + 12 + + + ↑ Frequency (%) + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - A - - - B - - - C - - - D - - - E - - - F - - - G - - - H - - - I - - - J - - - K - - - L - - - M - - - N - - - O - - - P - - - Q - - - R - - - S - - - T - - - U - - - V - - - W - - - X - - - Y - - - Z - + + A + B + C + D + E + F + G + H + I + J + K + L + M + N + O + P + Q + R + S + T + U + V + W + X + Y + Z diff --git a/test/output/morleyBoxplot.svg b/test/output/morleyBoxplot.svg index 124d0c1b56..e0843ea9c2 100644 --- a/test/output/morleyBoxplot.svg +++ b/test/output/morleyBoxplot.svg @@ -13,60 +13,58 @@ white-space: pre; } - - - 1 - - - 2 - - - 3 - - - 4 - - - 5 - Expt + + + + + + - - - - 650 - - - - 700 - - - - 750 - - - - 800 - - - - 850 - - - - 900 - - - - 950 - - - - 1,000 - - - - 1,050 - Speed → + + 1 + 2 + 3 + 4 + 5 + + + Expt + + + + + + + + + + + + + + + + + + + + + + + + + 650 + 700 + 750 + 800 + 850 + 900 + 950 + 1,000 + 1,050 + + + Speed → diff --git a/test/output/moviesProfitByGenre.svg b/test/output/moviesProfitByGenre.svg index 8adb649180..738f51487a 100644 --- a/test/output/moviesProfitByGenre.svg +++ b/test/output/moviesProfitByGenre.svg @@ -13,72 +13,62 @@ white-space: pre; } - - - Adventure - - - Action - - - Horror - - - Romantic Comedy - - - Concert/Performance - - - Musical - - - Comedy - - - Thriller/Suspense - - - Drama - - - Black Comedy - - - Documentary - - - Western - - - Other - + + + + + + + + + + + + + + - - - - 0 - - - - 200 - - - - 400 - - - - 600 - - - - 800 - - - - 1,000 - Profit ($M) → + + Adventure + Action + Horror + Romantic Comedy + Concert/Performance + Musical + Comedy + Thriller/Suspense + Drama + Black Comedy + Documentary + Western + Other + + + + + + + + + + + + + + + + + + + 0 + 200 + 400 + 600 + 800 + 1,000 + + + Profit ($M) → diff --git a/test/output/moviesRatingByGenre.svg b/test/output/moviesRatingByGenre.svg index 736cb2c0be..52a72a4b4c 100644 --- a/test/output/moviesRatingByGenre.svg +++ b/test/output/moviesRatingByGenre.svg @@ -13,3144 +13,3320 @@ white-space: pre; } - - - - Documentary + + + - - - Black Comedy + + Documentary - - - Drama + + + + + + + + + + + + - - - Musical + + + + + + + + + + + + - - - Western + + 0 + 1 + 2 + 3 + 4 + 5 + 6 + 7 + 8 + 9 + 10 - - - N/A - - - - Adventure - - - - Thriller/Suspense - - - - Action - - - - Concert/Performance - - - - Comedy - - - - Romantic Comedy - - - - Horror + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - 0 - - - - 1 - - - - 2 - - - - 3 - - - - 4 - - - - 5 - - - - 6 - - - - 7 - + + + - - 8 - + + Black Comedy - - 9 - + + + + + + + + + + + + - - 10 - - IMDB Rating → - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + Drama + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - + + + + + + + + + + + + + + + + - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - + + + + + + - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - + + + + + + + + + + + + - - - - + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - + + - - - - - - - - - - - - - - - - - - - - - - - - - + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + - - - - - - - - - - - - - - + + + - - - - - - - - + + + - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + - - + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + - + + + + + + Musical + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - + + + + + + Western + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - + + + + + + N/A + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Adventure + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - + + + + + + Thriller/Suspense + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - + + + + + + + - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - + + + + + + Action + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - + + + + + + + + + + + + + + - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - + + + + + + + + + - - - - - - - - - - - - - - - + + + + + - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - + + + + + + Concert/Performance + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + Comedy + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + - - + + - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - + - - - - - - - - - - - + + - - - - - - - - - - - - - - - - + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - + + + + + + Romantic Comedy + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - + + + + + + Horror + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + IMDB Rating → + \ No newline at end of file diff --git a/test/output/multiplicationTable.svg b/test/output/multiplicationTable.svg index 62c9632384..bf541780b0 100644 --- a/test/output/multiplicationTable.svg +++ b/test/output/multiplicationTable.svg @@ -13,632 +13,804 @@ white-space: pre; } - - - 2 + + + - - 3 + + 2 - - 4 + + - - 5 + + 2 - - 6 - - - 7 + + - - 8 + + - - 9 + + 4 - - - 2 + + + - - 3 + + 3 - - 4 - - - 5 + + - - 6 + + - - 7 + + 6 - - 8 + + + + - - 9 + + 4 - - - + - + + + + 8 - 4 - - - + + + - - + + 5 - 6 - - - + - + + + + 10 - 8 - - - + + + - - + + 6 - 10 - - - + - + + + + 12 - 12 - + + + + + + 7 + - + - + + + + 14 - 14 - + + + + + + 8 + - + - + + + + 16 - 16 - + + + + + + 9 + - + - + + + + 18 - 18 - + + + + + + 3 + - + - + + + + 6 - 6 - + - + - + + + + 9 - 9 - + - + - + + + + 12 - 12 - + - + - + + + + 15 - 15 - + - + - + + + + 18 - 18 - + - + - + + + + 21 - 21 - + - + - + + + + 24 - 24 - + - + - + + + + 27 - 27 - + + + + + + 4 + - + - + + + + 8 - 8 - + - + - + + + + 12 - 12 - + - + - + + + + 16 - 16 - + - + - + + + + 20 - 20 - + - + - + + + + 24 - 24 - + - + - + + + + 28 - 28 - + - + - + + + + 32 - 32 - + - + - + + + + 36 - 36 - + + + + + + 5 + - + - + + + + 10 - 10 - + - + - + + + + 15 - 15 - + - + - + + + + 20 - 20 - + - + - + + + + 25 - 25 - + - + - + + + + 30 - 30 - + - + - + + + + 35 - 35 - + - + - + + + + 40 - 40 - + - + - + + + + 45 - 45 - + + + + + + 6 + - + - + + + + 12 - 12 - + - + - + + + + 18 - 18 - + - + - + + + + 24 - 24 - + - + - + + + + 30 - 30 - + - + - + + + + 36 - 36 - + - + - + + + + 42 - 42 - + - + - + + + + 48 - 48 - + - + - + + + + 54 - 54 - + + + + + + 7 + - + - + + + + 14 - 14 - + - + - + + + + 21 - 21 - + - + - + + + + 28 - 28 - + - + - + + + + 35 - 35 - + - + - + + + + 42 - 42 - + - + - + + + + 49 - 49 - + - + - + + + + 56 - 56 - + - + - + + + + 63 - 63 - + + + + + + 8 + - + - + + + + 16 - 16 - + - + - + + + + 24 - 24 - + - + - + + + + 32 - 32 - + - + - + + + + 40 - 40 - + - + - + + + + 48 - 48 - + - + - + + + + 56 - 56 - + - + - + + + + 64 - 64 - + - + - + + + + 72 - 72 - + + + + + + 9 + - + - + + + + 18 - 18 - + - + - + + + + 27 - 27 - + - + - + + + + 36 - 36 - + - + - + + + + 45 - 45 - + - + - + + + + 54 - 54 - + - + - + + + + 63 - 63 - + - + - + + + + 72 - 72 - + - + - + + + + 81 - 81 \ No newline at end of file diff --git a/test/output/musicRevenue.svg b/test/output/musicRevenue.svg index b2313345bb..1ca982b7ae 100644 --- a/test/output/musicRevenue.svg +++ b/test/output/musicRevenue.svg @@ -13,178 +13,120 @@ white-space: pre; } - - - - 0 - - - - 2 - - - - 4 - - - - 6 - - - - 8 - - - - 10 - - - - 12 - - - - 14 - - - - 16 - - - - 18 - - - - 20 - - - - 22 - ↑ Annual revenue (billions, adj.) + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 0 + 2 + 4 + 6 + 8 + 10 + 12 + 14 + 16 + 18 + 20 + 22 + + + ↑ Annual revenue (billions, adj.) + + + + + + + + + + + - - - 1975 - - - 1980 - - - 1985 - - - 1990 - - - 1995 - - - 2000 - - - 2005 - - - 2010 - - - 2015 - + + 1975 + 1980 + 1985 + 1990 + 1995 + 2000 + 2005 + 2010 + 2015 - - 8 - Track - Tape - - - CD - Disc - - - CD Single - Disc - - - Cassette - Tape - - - Cassette Single - Tape - - - DVD Audio - Other - - - Download Album - Download - - - Download Music Video - Download - - - Download Single - Download - - - Kiosk - Other - - - LP/EP - Vinyl - - - Limited Tier Paid Subscription - Streaming - - - Music Video (Physical) - Other - - - On-Demand Streaming (Ad-Supported) - Streaming - - - Other Ad-Supported Streaming - Streaming - - - Other Digital - Download - - - Other Tapes - Tape - - - Paid Subscription - Streaming - - - Ringtones & Ringbacks - Download - - - SACD - Disc - - - SoundExchange Distributions - Streaming - - - Synchronization - Other - - - Vinyl Single - Vinyl - + 8 - Track + Tape + CD + Disc + CD Single + Disc + Cassette + Tape + Cassette Single + Tape + DVD Audio + Other + Download Album + Download + Download Music Video + Download + Download Single + Download + Kiosk + Other + LP/EP + Vinyl + Limited Tier Paid Subscription + Streaming + Music Video (Physical) + Other + On-Demand Streaming (Ad-Supported) + Streaming + Other Ad-Supported Streaming + Streaming + Other Digital + Download + Other Tapes + Tape + Paid Subscription + Streaming + Ringtones & Ringbacks + Download + SACD + Disc + SoundExchange Distributions + Streaming + Synchronization + Other + Vinyl Single + Vinyl diff --git a/test/output/npmVersions.svg b/test/output/npmVersions.svg index e6d6f60f7d..4a5ad01e84 100644 --- a/test/output/npmVersions.svg +++ b/test/output/npmVersions.svg @@ -13,231 +13,120 @@ white-space: pre; } - - - 3 - - - 2 - - - 1 - - - 0 - + + + + + - - - - 0 - - - - 200,000 - - - - 400,000 - - - - 600,000 - - - - 800,000 - - - - 1,000,000 - - - - 1,200,000 - - - - 1,400,000 - downloads → + + 3 + 2 + 1 + 0 + + + + + + + + + + + + + + + + + + + + + + + 0 + 200,000 + 400,000 + 600,000 + 800,000 + 1,000,000 + 1,200,000 + 1,400,000 + + + downloads → - - 0.5.0 - - - 0.5.1 - - - 0.5.2 - - - 0.6.0 - - - 0.6.1 - - - 0.6.2 - - - 0.7.0 - - - 0.7.1 - - - 0.8.0 - - - 0.8.1 - - - 1.0.0 - - - 1.0.1 - - - 1.0.2 - - - 1.0.3 - - - 1.1.0 - - - 1.1.1 - - - 1.2.0 - - - 1.2.1 - - - 1.2.2 - - - 1.2.3 - - - 1.2.4 - - - 2.0.0 - - - 2.0.1 - - - 2.0.2 - - - 2.0.3 - - - 2.1.0 - - - 2.2.0 - - - 2.3.0 - - - 2.3.1 - - - 2.3.2 - - - 2.3.3 - - - 2.4.0 - - - 2.5.0 - - - 2.5.1 - - - 2.6.0 - - - 2.7.0 - - - 2.7.1 - - - 2.8.0 - - - 2.9.0 - - - 2.9.1 - - - 2.10.0 - - - 2.11.0 - - - 2.12.0 - - - 2.12.1 - - - 3.0.0 - - - 3.0.1 - - - 3.0.2 - - - 3.0.3 - - - 3.0.4 - - - 3.1.0 - - - 3.1.1 - - - 3.1.2 - - - 3.1.3 - - - 3.1.4 - - - 3.1.5 - - - 3.1.6 - - - 3.2.0 - - - 3.2.1 - + 0.5.0 + 0.5.1 + 0.5.2 + 0.6.0 + 0.6.1 + 0.6.2 + 0.7.0 + 0.7.1 + 0.8.0 + 0.8.1 + 1.0.0 + 1.0.1 + 1.0.2 + 1.0.3 + 1.1.0 + 1.1.1 + 1.2.0 + 1.2.1 + 1.2.2 + 1.2.3 + 1.2.4 + 2.0.0 + 2.0.1 + 2.0.2 + 2.0.3 + 2.1.0 + 2.2.0 + 2.3.0 + 2.3.1 + 2.3.2 + 2.3.3 + 2.4.0 + 2.5.0 + 2.5.1 + 2.6.0 + 2.7.0 + 2.7.1 + 2.8.0 + 2.9.0 + 2.9.1 + 2.10.0 + 2.11.0 + 2.12.0 + 2.12.1 + 3.0.0 + 3.0.1 + 3.0.2 + 3.0.3 + 3.0.4 + 3.1.0 + 3.1.1 + 3.1.2 + 3.1.3 + 3.1.4 + 3.1.5 + 3.1.6 + 3.2.0 + 3.2.1 + + + 1.2.1 + 1.2.4 + 2.12.1 + 3.1.1 + 3.1.6 + 3.2.0 + 3.2.1 - 1.2.11.2.42.12.13.1.13.1.63.2.03.2.1 diff --git a/test/output/opacityLegend.svg b/test/output/opacityLegend.svg index 2b44e03426..340cb04010 100644 --- a/test/output/opacityLegend.svg +++ b/test/output/opacityLegend.svg @@ -16,22 +16,29 @@ - 0 + + 0 - 2 + + 2 - 4 + + 4 - 6 + + 6 - 8 + + 8 - 10 + + 10 - Quantitative + + Quantitative \ No newline at end of file diff --git a/test/output/opacityLegendColor.svg b/test/output/opacityLegendColor.svg index b1d6f29ed7..a467007677 100644 --- a/test/output/opacityLegendColor.svg +++ b/test/output/opacityLegendColor.svg @@ -16,22 +16,29 @@ - 0 + + 0 - 2 + + 2 - 4 + + 4 - 6 + + 6 - 8 + + 8 - 10 + + 10 - Linear + + Linear \ No newline at end of file diff --git a/test/output/opacityLegendLinear.svg b/test/output/opacityLegendLinear.svg index 983d9c22da..6a7d69b4de 100644 --- a/test/output/opacityLegendLinear.svg +++ b/test/output/opacityLegendLinear.svg @@ -16,22 +16,29 @@ - 0 + + 0 - 2 + + 2 - 4 + + 4 - 6 + + 6 - 8 + + 8 - 10 + + 10 - Linear + + Linear \ No newline at end of file diff --git a/test/output/opacityLegendLog.svg b/test/output/opacityLegendLog.svg index da36a834e7..1b3dbf4161 100644 --- a/test/output/opacityLegendLog.svg +++ b/test/output/opacityLegendLog.svg @@ -16,34 +16,45 @@ - 1 + + 1 - 2 + + 2 - 3 + + 3 - + + - + + - + + - + + - + + - + + - 10 + + 10 - Log + + Log \ No newline at end of file diff --git a/test/output/opacityLegendRange.svg b/test/output/opacityLegendRange.svg index fe29b98f12..6e693b9c3d 100644 --- a/test/output/opacityLegendRange.svg +++ b/test/output/opacityLegendRange.svg @@ -16,22 +16,29 @@ - 0.0 + + 0.0 - 0.2 + + 0.2 - 0.4 + + 0.4 - 0.6 + + 0.6 - 0.8 + + 0.8 - 1.0 + + 1.0 - Range + + Range \ No newline at end of file diff --git a/test/output/opacityLegendSqrt.svg b/test/output/opacityLegendSqrt.svg index 777c8c2387..eb998b35e5 100644 --- a/test/output/opacityLegendSqrt.svg +++ b/test/output/opacityLegendSqrt.svg @@ -16,22 +16,29 @@ - 0.0 + + 0.0 - 0.2 + + 0.2 - 0.4 + + 0.4 - 0.6 + + 0.6 - 0.8 + + 0.8 - 1.0 + + 1.0 - Sqrt + + Sqrt \ No newline at end of file diff --git a/test/output/ordinalBar.svg b/test/output/ordinalBar.svg index 793b9d692f..25b5591ca8 100644 --- a/test/output/ordinalBar.svg +++ b/test/output/ordinalBar.svg @@ -13,55 +13,48 @@ white-space: pre; } - - - - 0 - - - - A - - - - B - - - - C - - - - D - - - - E - - - - F - + + + + + + + + + + + + + + + + + + + + 0 + A + B + C + D + E + F + + + + + + + + - - - 0 - - - 1 - - - 2 - - - 3 - - - 4 - - - 5 - + + 0 + 1 + 2 + 3 + 4 + 5 diff --git a/test/output/penguinAnnotated.svg b/test/output/penguinAnnotated.svg index 94885ff75d..57ef8a5158 100644 --- a/test/output/penguinAnnotated.svg +++ b/test/output/penguinAnnotated.svg @@ -13,69 +13,54 @@ white-space: pre; } - - - Adelie - - - Gentoo - - - Chinstrap - species + + + + - - - 0 - - - 20 - - - 40 - - - 60 - - - 80 - - - 100 - - - 120 - - - 140 - Frequency → + + Adelie + Gentoo + Chinstrap + + + species + + + + + + + + + + + + + 0 + 20 + 40 + 60 + 80 + 100 + 120 + 140 + + + Frequency → - - FEMALE (73) - - - FEMALE (34) - - - FEMALE (58) - - - MALE (73) - - - MALE (34) - - - MALE (61) - - - null (6) - - - null (5) - + FEMALE (73) + FEMALE (34) + FEMALE (58) + MALE (73) + MALE (34) + MALE (61) + null (6) + null (5) + + + Count of penguinsgrouped by species and colored by sex - Count of penguinsgrouped by species and colored by sex \ No newline at end of file diff --git a/test/output/penguinCulmen.svg b/test/output/penguinCulmen.svg index 02ae4c1549..bd23be06d3 100644 --- a/test/output/penguinCulmen.svg +++ b/test/output/penguinCulmen.svg @@ -13,2914 +13,2987 @@ white-space: pre; } - - - Adelie + + + FEMALE - - Chinstrap + + + + + + - - Gentoo - species - - - - FEMALE - - - MALE + + + + + + - - - sex - - - - 35 - + + 35 + 40 + 45 + 50 + 55 - - 40 - + + + - - 45 - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - 50 - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - 55 - - ↑ culmen_length_mm - - - 35 - + + + + + + + - - 40 - + + + + + + - - 45 - + + 35 + 40 + 45 + 50 + 55 - - 50 - + + + - - 55 - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - 35 - + + + + + + + - - 40 - + + + + + + - - 45 - + + 35 + 40 + 45 + 50 + 55 - - 50 - + + + - - 55 - + + + - - - - 15 - + + 15 + 20 + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - 20 - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - 15 - + + + MALE - - 20 - + + + + + + - - - - 15 - + + + - - 20 - - culmen_depth_mm → - - - + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + - - - + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + 15 + 20 - - - + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - + + + Adelie + + + + + + + + + + + + + + + + + + 15 + 20 + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - + + + + + + + + + + Chinstrap - - + + + Gentoo + + + + + + + + + + + + + + + + + + 15 + 20 + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - + + + + + + species + + + sex + + + ↑ culmen_length_mm + + + culmen_depth_mm → + \ No newline at end of file diff --git a/test/output/penguinCulmenArray.svg b/test/output/penguinCulmenArray.svg index a5acddeee8..0e462164d8 100644 --- a/test/output/penguinCulmenArray.svg +++ b/test/output/penguinCulmenArray.svg @@ -13,3248 +13,3315 @@ white-space: pre; } - - - Adelie + + + FEMALE - - Chinstrap + + + + + + - - Gentoo - species - - - - FEMALE - - - MALE + + + + + + - - - sex - - - - 35 - + + 35 + 40 + 45 + 50 + 55 - - 40 - + + + - - 45 - - - - 50 - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - 55 - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - 35 - + + + + + + + - - 40 - + + + + + + - - 45 - + + 35 + 40 + 45 + 50 + 55 - - 50 - + + + - - 55 - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - 35 - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - 40 - + + + + + + + + - - 45 - + + + + + + - - 50 - + + 35 + 40 + 45 + 50 + 55 - - 55 - + + + - - - - 15 - + + + - - 20 - + + 15 + 20 - - - - 15 - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - 20 - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - 15 - + + + MALE - - 20 - + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + 15 + 20 - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - + + + Adelie + + + + + + + + + + + + + + + + + + 15 + 20 + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - + + + + + - + + + Chinstrap + + + + + Gentoo + + + + + + + + + + + + + + + + + + 15 + 20 + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - + + + + + + species + + + sex + \ No newline at end of file diff --git a/test/output/penguinCulmenDelaunay.svg b/test/output/penguinCulmenDelaunay.svg index cf8386068e..f7e7af50ed 100644 --- a/test/output/penguinCulmenDelaunay.svg +++ b/test/output/penguinCulmenDelaunay.svg @@ -13,72 +13,61 @@ white-space: pre; } - - - 34 - - - 36 - - - 38 - - - 40 - - - 42 - - - 44 - - - 46 - - - 48 - - - 50 - - - 52 - - - 54 - - - 56 - - - 58 - ↑ culmen_length_mm + + + + + + + + + + + + + + - - - 14 - - - 15 - - - 16 - - - 17 - - - 18 - - - 19 - - - 20 - - - 21 - culmen_depth_mm → + + 34 + 36 + 38 + 40 + 42 + 44 + 46 + 48 + 50 + 52 + 54 + 56 + 58 + + + ↑ culmen_length_mm + + + + + + + + + + + + + 14 + 15 + 16 + 17 + 18 + 19 + 20 + 21 + + + culmen_depth_mm → diff --git a/test/output/penguinCulmenDelaunayMesh.svg b/test/output/penguinCulmenDelaunayMesh.svg index 5386cc79cd..3f5aa02d05 100644 --- a/test/output/penguinCulmenDelaunayMesh.svg +++ b/test/output/penguinCulmenDelaunayMesh.svg @@ -13,72 +13,61 @@ white-space: pre; } - - - 34 - - - 36 - - - 38 - - - 40 - - - 42 - - - 44 - - - 46 - - - 48 - - - 50 - - - 52 - - - 54 - - - 56 - - - 58 - ↑ culmen_length_mm + + + + + + + + + + + + + + - - - 14 - - - 15 - - - 16 - - - 17 - - - 18 - - - 19 - - - 20 - - - 21 - culmen_depth_mm → + + 34 + 36 + 38 + 40 + 42 + 44 + 46 + 48 + 50 + 52 + 54 + 56 + 58 + + + ↑ culmen_length_mm + + + + + + + + + + + + + 14 + 15 + 16 + 17 + 18 + 19 + 20 + 21 + + + culmen_depth_mm → diff --git a/test/output/penguinCulmenDelaunaySpecies.svg b/test/output/penguinCulmenDelaunaySpecies.svg index 5677e8ed9e..9127e36f45 100644 --- a/test/output/penguinCulmenDelaunaySpecies.svg +++ b/test/output/penguinCulmenDelaunaySpecies.svg @@ -13,72 +13,61 @@ white-space: pre; } - - - 34 - - - 36 - - - 38 - - - 40 - - - 42 - - - 44 - - - 46 - - - 48 - - - 50 - - - 52 - - - 54 - - - 56 - - - 58 - ↑ culmen_length_mm + + + + + + + + + + + + + + - - - 14 - - - 15 - - - 16 - - - 17 - - - 18 - - - 19 - - - 20 - - - 21 - culmen_depth_mm → + + 34 + 36 + 38 + 40 + 42 + 44 + 46 + 48 + 50 + 52 + 54 + 56 + 58 + + + ↑ culmen_length_mm + + + + + + + + + + + + + 14 + 15 + 16 + 17 + 18 + 19 + 20 + 21 + + + culmen_depth_mm → diff --git a/test/output/penguinCulmenMarkFacet.svg b/test/output/penguinCulmenMarkFacet.svg index a6d9782f26..dcf4a57c7c 100644 --- a/test/output/penguinCulmenMarkFacet.svg +++ b/test/output/penguinCulmenMarkFacet.svg @@ -13,2893 +13,2899 @@ white-space: pre; } - - - Adelie + + + FEMALE - - Chinstrap + + + + + + - - Gentoo - species - - - - FEMALE - - - MALE - - - - sex - - - - 35 - - - 40 + + 35 + 40 + 45 + 50 + 55 - - 45 + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - 50 + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - 55 - ↑ culmen_length_mm - - - 35 + + + + + + + - - 40 + + 35 + 40 + 45 + 50 + 55 - - 45 - - - 50 + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - 55 + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - 35 - - - 40 - - - 45 + + + + + + + - - 50 + + 35 + 40 + 45 + 50 + 55 - - 55 - - - - - 15 + + + - - 20 + + 15 + 20 - - - - 15 + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - 20 + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - 15 + + + MALE - - 20 - culmen_depth_mm → - - - + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + 15 + 20 - - - + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + Adelie - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + - - - + + 15 + 20 + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + Chinstrap - - + + + Gentoo + + + + + + + 15 + 20 + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - + + + + + + species + + + sex + + + ↑ culmen_length_mm + + + culmen_depth_mm → + \ No newline at end of file diff --git a/test/output/penguinCulmenVoronoi.svg b/test/output/penguinCulmenVoronoi.svg index 7c9cd5a4a7..10a43cdac1 100644 --- a/test/output/penguinCulmenVoronoi.svg +++ b/test/output/penguinCulmenVoronoi.svg @@ -13,72 +13,61 @@ white-space: pre; } - - - 34 - - - 36 - - - 38 - - - 40 - - - 42 - - - 44 - - - 46 - - - 48 - - - 50 - - - 52 - - - 54 - - - 56 - - - 58 - ↑ culmen_length_mm + + + + + + + + + + + + + + - - - 14 - - - 15 - - - 16 - - - 17 - - - 18 - - - 19 - - - 20 - - - 21 - culmen_depth_mm → + + 34 + 36 + 38 + 40 + 42 + 44 + 46 + 48 + 50 + 52 + 54 + 56 + 58 + + + ↑ culmen_length_mm + + + + + + + + + + + + + 14 + 15 + 16 + 17 + 18 + 19 + 20 + 21 + + + culmen_depth_mm → diff --git a/test/output/penguinDensity.svg b/test/output/penguinDensity.svg index 97e6f84414..08617640e1 100644 --- a/test/output/penguinDensity.svg +++ b/test/output/penguinDensity.svg @@ -13,42 +13,41 @@ white-space: pre; } - - - 35 - - - 40 - - - 45 - - - 50 - - - 55 - ↑ culmen_length_mm + + + + + + - - - 180 - - - 190 - - - 200 - - - 210 - - - 220 - - - 230 - flipper_length_mm → + + 35 + 40 + 45 + 50 + 55 + + + ↑ culmen_length_mm + + + + + + + + + + + 180 + 190 + 200 + 210 + 220 + 230 + + + flipper_length_mm → diff --git a/test/output/penguinDensityFill.html b/test/output/penguinDensityFill.html index 897fca4c42..4a988a4825 100644 --- a/test/output/penguinDensityFill.html +++ b/test/output/penguinDensityFill.html @@ -16,18 +16,23 @@ - 0.0 + + 0.0 - 0.5 + + 0.5 - 1.0 + + 1.0 - 1.5 + + 1.5 - Density + + Density - - - 35 - - - 40 - - - 45 - - - 50 - - - 55 - ↑ culmen_length_mm - - - - Biscoe - - - Dream - - - Torgersen - island - - - - 180 - - - 200 - - - 220 - - - - - 180 - - - 200 + + + Biscoe + + + + + + + + + + 35 + 40 + 45 + 50 + 55 + + + + + + + + 180 + 200 + 220 - - 220 - - - - - 180 - - - 200 - - - 220 - flipper_length_mm → - - - + - - - - - - - - - + + + + + + + + + - + - + + + Dream + + + + + + + + 180 + 200 + 220 + - + - - - - - + + + + + - + - + + + Torgersen + + + + + + + + 180 + 200 + 220 + - + - - - + + + @@ -159,6 +156,15 @@ - + + + + island + + + ↑ culmen_length_mm + + + flipper_length_mm → \ No newline at end of file diff --git a/test/output/penguinDensityZ.html b/test/output/penguinDensityZ.html index 6aafd7fbd5..61dbf13852 100644 --- a/test/output/penguinDensityZ.html +++ b/test/output/penguinDensityZ.html @@ -51,231 +51,142 @@ white-space: pre; } - - - 35 + + + Biscoe + + + + + + + + + + 35 + 40 + 45 + 50 + 55 + + + + + + + + 180 + 200 + 220 - - 40 - - - 45 - - - 50 - - - 55 - ↑ culmen_length_mm - - - - Biscoe - - - Dream - - - Torgersen - island - - - - 180 - - - 200 - - - 220 - - - - - 180 - - - 200 - - - 220 - - - - - 180 - - - 200 - - - 220 - flipper_length_mm → - - - + - - Adelie - - - Adelie - - - Adelie - - - Adelie - - - Adelie - - - Adelie - - - Adelie - - - Adelie - - - Adelie - - - Gentoo - - - Gentoo - - - Gentoo - - - Gentoo - - - Gentoo - - - Gentoo - - - Gentoo - - - Gentoo - - - Gentoo - + Adelie + Adelie + Adelie + Adelie + Adelie + Adelie + Adelie + Adelie + Adelie + Gentoo + Gentoo + Gentoo + Gentoo + Gentoo + Gentoo + Gentoo + Gentoo + Gentoo - + - + + + Dream + + + + + + + + 180 + 200 + 220 + - + - - Adelie - - - Adelie - - - Adelie - - - Adelie - - - Adelie - - - Adelie - - - Adelie - - - Adelie - - - Adelie - - - Chinstrap - - - Chinstrap - - - Chinstrap - - - Chinstrap - - - Chinstrap - - - Chinstrap - - - Chinstrap - - - Chinstrap - - - Chinstrap - + Adelie + Adelie + Adelie + Adelie + Adelie + Adelie + Adelie + Adelie + Adelie + Chinstrap + Chinstrap + Chinstrap + Chinstrap + Chinstrap + Chinstrap + Chinstrap + Chinstrap + Chinstrap - + - + + + Torgersen + + + + + + + + 180 + 200 + 220 + - + - - Adelie - - - Adelie - - - Adelie - - - Adelie - - - Adelie - - - Adelie - - - Adelie - - - Adelie - - - Adelie - + Adelie + Adelie + Adelie + Adelie + Adelie + Adelie + Adelie + Adelie + Adelie - + + + + island + + + ↑ culmen_length_mm + + + flipper_length_mm → \ No newline at end of file diff --git a/test/output/penguinDodge.svg b/test/output/penguinDodge.svg index a3428476ad..0c5acf53f2 100644 --- a/test/output/penguinDodge.svg +++ b/test/output/penguinDodge.svg @@ -13,28 +13,26 @@ white-space: pre; } - - - 3,000 - - - 3,500 - - - 4,000 - - - 4,500 - - - 5,000 - - - 5,500 - - - 6,000 - body_mass_g → + + + + + + + + + + + 3,000 + 3,500 + 4,000 + 4,500 + 5,000 + 5,500 + 6,000 + + + body_mass_g → diff --git a/test/output/penguinDodgeHexbin.svg b/test/output/penguinDodgeHexbin.svg index cf69ceb296..a6282aa416 100644 --- a/test/output/penguinDodgeHexbin.svg +++ b/test/output/penguinDodgeHexbin.svg @@ -13,748 +13,765 @@ white-space: pre; } - - - Adelie + + + Adelie - - Chinstrap + + + + + + + + - - Gentoo - - - - - 3,000 - - - - 3,500 - - - - 4,000 - - - - 4,500 - - - - 5,000 - - - - 5,500 - - - - 6,000 - - body_mass_g → - - - + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - + + + + + - + + + + + - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - + - - - - - - - - - - - - + + + + + + + + + + - - - - - - - - + + + + + + - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + - - - - - - - - - - - - - - - - - - + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + - - + + + Chinstrap + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - + + + + + + - - - - - + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + Gentoo + + + + + + + + + + + + + + + + + + + + + 3,000 + 3,500 + 4,000 + 4,500 + 5,000 + 5,500 + 6,000 + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + - - - - - - - + + + + + + + + + + + - + + + + - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + - - - - - - - + + + + - - - + + + + + + + - - - - - - - - + - - - - - - - - - - - - - - - - - - - - - + + + - - - - - - - - + + - - - - - - - - - - - - - - - - - - - - - - - - + + + + + body_mass_g → + \ No newline at end of file diff --git a/test/output/penguinDodgeVoronoi.svg b/test/output/penguinDodgeVoronoi.svg index 3656f2878f..11235bca70 100644 --- a/test/output/penguinDodgeVoronoi.svg +++ b/test/output/penguinDodgeVoronoi.svg @@ -13,28 +13,26 @@ white-space: pre; } - - - 3,000 - - - 3,500 - - - 4,000 - - - 4,500 - - - 5,000 - - - 5,500 - - - 6,000 - body_mass_g → + + + + + + + + + + + 3,000 + 3,500 + 4,000 + 4,500 + 5,000 + 5,500 + 6,000 + + + body_mass_g → diff --git a/test/output/penguinFacetAnnotated.svg b/test/output/penguinFacetAnnotated.svg index 22ea2d9faf..4d83f42650 100644 --- a/test/output/penguinFacetAnnotated.svg +++ b/test/output/penguinFacetAnnotated.svg @@ -13,100 +13,101 @@ white-space: pre; } - - - Biscoe + + + Biscoe - - Dream + + + + - - Torgersen - island - - - - 0 - - - 20 - - - 40 - - - 60 - - - 80 + + Adelie + Chinstrap + Gentoo - - 100 + + + + + + + - - 120 - Frequency → - - - Adelie - - - Chinstrap + + + Dream - - Gentoo + + + + - - - - Adelie + + Adelie + Chinstrap + Gentoo - - Chinstrap + + + + + + + - - Gentoo - species - - - Adelie - - - Chinstrap + + + Torgersen + + + + + + + + Adelie + Chinstrap + Gentoo + + + + + + + + + + + + 0 + 20 + 40 + 60 + 80 + 100 + 120 + + + + + + - - Gentoo + + Torgersen Island only has Adelie penguins! - - - - - - - - - + + island - - - - - - - - - + + species - - - - - - - - Torgersen Island only has Adelie penguins! + + Frequency → \ No newline at end of file diff --git a/test/output/penguinFacetAnnotatedX.svg b/test/output/penguinFacetAnnotatedX.svg index 0544b94b53..964c378852 100644 --- a/test/output/penguinFacetAnnotatedX.svg +++ b/test/output/penguinFacetAnnotatedX.svg @@ -13,88 +13,93 @@ white-space: pre; } - - - Adelie + + + Biscoe - - Chinstrap + + + + - - Gentoo - species - - - - Biscoe - - - Dream + + Adelie + Chinstrap + Gentoo - - Torgersen - island - - - - 0 + + + + - - 50 + + 0 + 50 + 100 - - 100 + + + + + + + - - - 0 + + + Dream - - 50 + + + + - - 100 + + 0 + 50 + 100 + + + + + + + + - - - 0 + + + Torgersen - - 50 + + + + - - 100 - Frequency → - - - - - - - - - + + 0 + 50 + 100 - - - + - - - - - + + + - - - - - - - + + Torgersen Islandonly has Adeliepenguins! - Torgersen Islandonly has Adeliepenguins! + + + island + + + species + + + Frequency → \ No newline at end of file diff --git a/test/output/penguinFacetDodge.svg b/test/output/penguinFacetDodge.svg index 098282e899..8f4ff6ae84 100644 --- a/test/output/penguinFacetDodge.svg +++ b/test/output/penguinFacetDodge.svg @@ -13,399 +13,415 @@ white-space: pre; } - - - Adelie + + + Adelie - - Chinstrap + + + + + + + + - - Gentoo + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - 3,000 - + + + Chinstrap - - 3,500 - + + + + + + + + - - 4,000 - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - 4,500 - + + + + Gentoo - - 5,000 - + + + + + + + + - - 5,500 - + + + + + + + + - - 6,000 - - body_mass_g → - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + 3,000 + 3,500 + 4,000 + 4,500 + 5,000 + 5,500 + 6,000 - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + body_mass_g → \ No newline at end of file diff --git a/test/output/penguinFacetDodgeIdentity.svg b/test/output/penguinFacetDodgeIdentity.svg index 0bcd3c95b7..d92d6064f4 100644 --- a/test/output/penguinFacetDodgeIdentity.svg +++ b/test/output/penguinFacetDodgeIdentity.svg @@ -13,399 +13,415 @@ white-space: pre; } - - - Adelie + + + Adelie - - Chinstrap + + + + + + + + - - Gentoo + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - 3,000 - + + + Chinstrap - - 3,500 - + + + + + + + + - - 4,000 - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - 4,500 - + + + + Gentoo - - 5,000 - + + + + + + + + - - 5,500 - + + + + + + + + - - 6,000 - - body_mass_g → - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + 3,000 + 3,500 + 4,000 + 4,500 + 5,000 + 5,500 + 6,000 - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + body_mass_g → \ No newline at end of file diff --git a/test/output/penguinFacetDodgeIsland.html b/test/output/penguinFacetDodgeIsland.html index 70e930e518..ff5a9bf015 100644 --- a/test/output/penguinFacetDodgeIsland.html +++ b/test/output/penguinFacetDodgeIsland.html @@ -51,400 +51,416 @@ white-space: pre; } - - - Adelie + + + Adelie - - Chinstrap + + + + + + + + - - Gentoo + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - 3,000 - + + + Chinstrap - - 3,500 - + + + + + + + + - - 4,000 - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - 4,500 - + + + + Gentoo - - 5,000 - + + + + + + + + - - 5,500 - + + + + + + + + - - 6,000 - - body_mass_g → - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + 3,000 + 3,500 + 4,000 + 4,500 + 5,000 + 5,500 + 6,000 - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + body_mass_g → \ No newline at end of file diff --git a/test/output/penguinFacetDodgeSymbol.html b/test/output/penguinFacetDodgeSymbol.html index dcc331d247..5331a9403c 100644 --- a/test/output/penguinFacetDodgeSymbol.html +++ b/test/output/penguinFacetDodgeSymbol.html @@ -57,43 +57,41 @@ white-space: pre; } - - - - 2,500 - - - - 3,000 - - - - 3,500 - - - - 4,000 - - - - 4,500 - - - - 5,000 - - - - 5,500 - - - - 6,000 - - - - 6,500 - ↑ body_mass_g + + + + + + + + + + + + + + + + + + + + + + + + 2,500 + 3,000 + 3,500 + 4,000 + 4,500 + 5,000 + 5,500 + 6,000 + 6,500 + + + ↑ body_mass_g diff --git a/test/output/penguinIslandUnknown.svg b/test/output/penguinIslandUnknown.svg index b084332949..8608f59d88 100644 --- a/test/output/penguinIslandUnknown.svg +++ b/test/output/penguinIslandUnknown.svg @@ -13,45 +13,42 @@ white-space: pre; } - - - 0 - - - 20 - - - 40 - - - 60 - - - 80 - - - 100 - - - 120 - - - 140 - - - 160 - ↑ Frequency + + + + + + + + + + - - - FEMALE - - - MALE - - - - sex + + 0 + 20 + 40 + 60 + 80 + 100 + 120 + 140 + 160 + + + ↑ Frequency + + + + + + + + FEMALE + MALE + + + sex diff --git a/test/output/penguinMass.svg b/test/output/penguinMass.svg index eb320d2aaf..c4b7955ea9 100644 --- a/test/output/penguinMass.svg +++ b/test/output/penguinMass.svg @@ -13,76 +13,69 @@ white-space: pre; } - - - - 0 - - - - 10 - - - - 20 - - - - 30 - - - - 40 - - - - 50 - - - - 60 - - - - 70 - - - - 80 - - - - 90 - ↑ Frequency + + + + + + + + + + + + + + + + + + + + + + + + + + 0 + 10 + 20 + 30 + 40 + 50 + 60 + 70 + 80 + 90 + + + ↑ Frequency + + + + + + + + + + + + + + 2,500 + 3,000 + 3,500 + 4,000 + 4,500 + 5,000 + 5,500 + 6,000 + 6,500 - - - 2,500 - - - 3,000 - - - 3,500 - - - 4,000 - - - 4,500 - - - 5,000 - - - 5,500 - - - 6,000 - - - 6,500 - Body mass (g) → + + Body mass (g) → diff --git a/test/output/penguinMassSex.svg b/test/output/penguinMassSex.svg index 8427ac8095..065f9882de 100644 --- a/test/output/penguinMassSex.svg +++ b/test/output/penguinMassSex.svg @@ -13,143 +13,128 @@ white-space: pre; } - - - FEMALE + + + FEMALE + + + + + + + + + + + 0 + 10 + 20 + 30 + 40 + 50 - - MALE - - - - sex - - - - 2,500 - - - 3,000 - - - 3,500 - - - 4,000 - - - 4,500 - - - 5,000 - - - 5,500 - - - 6,000 - - - 6,500 - Body mass (g) → - - - - 0 - - - 10 - - - 20 - - - 30 - - - 40 - - - 50 - ↑ Frequency - - - - 0 - - - 10 - - - 20 - - - 30 - - - 40 - - - 50 - - - - - 0 - - - 10 - - - 20 - - - 30 - - - 40 - - - 50 - - - - - - - - - + + + + + + - + - + + + MALE + + + + + + + + + + + 0 + 10 + 20 + 30 + 40 + 50 + - - - - - - - + + + + + + + - + - + + + + + + + + + + + 0 + 10 + 20 + 30 + 40 + 50 + + + + + + + + + + + + + + 2,500 + 3,000 + 3,500 + 4,000 + 4,500 + 5,000 + 5,500 + 6,000 + 6,500 + - - - - - + + + + + - + + + sex + + + ↑ Frequency + + + Body mass (g) → + \ No newline at end of file diff --git a/test/output/penguinMassSexSpecies.svg b/test/output/penguinMassSexSpecies.svg index 0d0155fb43..4bdc3c636e 100644 --- a/test/output/penguinMassSexSpecies.svg +++ b/test/output/penguinMassSexSpecies.svg @@ -13,186 +13,192 @@ white-space: pre; } - - - Adelie + + + FEMALE + + + + + + + + + + 0 + 10 + 20 + 30 + 40 - - Chinstrap - - - Gentoo - species - - - - FEMALE - - - MALE - - - - sex - - - - 0 - - - 10 - - - 20 + + + + - - 30 + + - - 40 - ↑ Frequency - - - 0 - - - 10 + + + + + + + - - 20 + + 0 + 10 + 20 + 30 + 40 - - 30 + + + + + - - 40 + + - - - 0 - - - 10 + + + + + + + - - 20 + + 0 + 10 + 20 + 30 + 40 - - 30 + + + - - 40 - - - - - 4,000 + + 4,000 + 6,000 - - 6,000 - - - - - 4,000 + + + + + - - 6,000 + + - - - 4,000 + + + MALE - - 6,000 - Body mass (g) → - - - - - + + + + - + - + - - - - + + + + - + - - - - - - + + + + - - + + 4,000 + 6,000 - - - - - - + + + + - + - - - - - - + + + Adelie - - + + + + + + 4,000 + 6,000 - - - - - - + + + + - + - - - - - - - - - + + + Chinstrap - + + + Gentoo + + + + + + + 4,000 + 6,000 + - - + + - + + + species + + + sex + + + ↑ Frequency + + + Body mass (g) → + \ No newline at end of file diff --git a/test/output/penguinMassSpecies.svg b/test/output/penguinMassSpecies.svg index 4f8e31d610..008bae66db 100644 --- a/test/output/penguinMassSpecies.svg +++ b/test/output/penguinMassSpecies.svg @@ -13,139 +13,100 @@ white-space: pre; } - - - - 0 - - - - 10 - - - - 20 - - - - 30 - - - - 40 - - - - 50 - - - - 60 - - - - 70 - - - - 80 - - - - 90 - ↑ Frequency + + + + + + + + + + + + + + + + + + + + + + + + + + 0 + 10 + 20 + 30 + 40 + 50 + 60 + 70 + 80 + 90 + + + ↑ Frequency + + + + + + + + + + + + + + 2,500 + 3,000 + 3,500 + 4,000 + 4,500 + 5,000 + 5,500 + 6,000 + 6,500 - - - 2,500 - - - 3,000 - - - 3,500 - - - 4,000 - - - 4,500 - - - 5,000 - - - 5,500 - - - 6,000 - - - 6,500 - Body mass (g) → + + Body mass (g) → - - Adelie FEMALE (6) - Adelie null (1) - - - Adelie FEMALE (42) + <rect x="41" y="343.93617021276594" width="72" height="26.063829787234056" fill="#4e79a7"><title>Adelie FEMALE (6) + Adelie null (1) + Adelie FEMALE (42) Adelie MALE (3) - Adelie null (2) - - - Adelie MALE (32) + Adelie null (2) + Adelie MALE (32) Adelie FEMALE (25) - Adelie null (1) - - - Adelie MALE (30) - Adelie null (1) - - - Adelie MALE (8) - - - Chinstrap FEMALE (2) - - - Chinstrap FEMALE (11) - Chinstrap MALE (4) - - - Chinstrap FEMALE (20) - Chinstrap MALE (15) - - - Chinstrap MALE (12) - Chinstrap FEMALE (1) - - - Chinstrap MALE (3) - - - Gentoo FEMALE (1) - - - Gentoo FEMALE (14) - Gentoo null (1) - - - Gentoo FEMALE (35) + Adelie null (1) + Adelie MALE (30) + Adelie null (1) + Adelie MALE (8) + Chinstrap FEMALE (2) + Chinstrap FEMALE (11) + Chinstrap MALE (4) + Chinstrap FEMALE (20) + Chinstrap MALE (15) + Chinstrap MALE (12) + Chinstrap FEMALE (1) + Chinstrap MALE (3) + Gentoo FEMALE (1) + Gentoo FEMALE (14) + Gentoo null (1) + Gentoo FEMALE (35) Gentoo null (3) - Gentoo MALE (2) - - - Gentoo MALE (26) - Gentoo FEMALE (8) - - - Gentoo MALE (29) - - - Gentoo MALE (4) - + Gentoo MALE (2) + Gentoo MALE (26) + Gentoo FEMALE (8) + Gentoo MALE (29) + Gentoo MALE (4) diff --git a/test/output/penguinSex.svg b/test/output/penguinSex.svg index 7c17930777..646c30c79a 100644 --- a/test/output/penguinSex.svg +++ b/test/output/penguinSex.svg @@ -13,45 +13,42 @@ white-space: pre; } - - - 0 - - - 20 - - - 40 - - - 60 - - - 80 - - - 100 - - - 120 - - - 140 - - - 160 - ↑ Frequency + + + + + + + + + + - - - FEMALE - - - MALE - - - - sex + + 0 + 20 + 40 + 60 + 80 + 100 + 120 + 140 + 160 + + + ↑ Frequency + + + + + + + + FEMALE + MALE + + + sex diff --git a/test/output/penguinSexMassCulmenSpecies.svg b/test/output/penguinSexMassCulmenSpecies.svg index ca0ecacc23..2d8921d854 100644 --- a/test/output/penguinSexMassCulmenSpecies.svg +++ b/test/output/penguinSexMassCulmenSpecies.svg @@ -13,269 +13,285 @@ white-space: pre; } - - - 34 - - - - 36 - - - - 38 - - - - 40 - - - - 42 - - - - 44 - - - - 46 - - - - 48 - - - - 50 - - - - 52 - - - - 54 - - - - 56 - - - - 58 - - ↑ culmen_length_mm - - - - FEMALE - - - MALE - - - - sex - - - - - 3k - - - - 3.5k - - - - 4k - - - - 4.5k - - - - 5k - - - - 5.5k - - - - 6k - - - - - - 3k - - - - 3.5k - - - - 4k - - - - 4.5k - - - - 5k - - - - 5.5k - - - - 6k - - - - - - 3k - - - - 3.5k - - - - 4k - - - - 4.5k - - - - 5k - - - - 5.5k - - - - 6k - body_mass_g → - - - + + + FEMALE + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 34 + 36 + 38 + 40 + 42 + 44 + 46 + 48 + 50 + 52 + 54 + 56 + 58 + + + + + + + + + + + + + + + + + + + + + 3k + 3.5k + 4k + 4.5k + 5k + 5.5k + 6k + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - + + + MALE + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 3k + 3.5k + 4k + 4.5k + 5k + 5.5k + 6k + + - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 3k + 3.5k + 4k + 4.5k + 5k + 5.5k + 6k + + - - - - - - - - + + + + + + + + + + sex + + + ↑ culmen_length_mm + + + body_mass_g → + \ No newline at end of file diff --git a/test/output/penguinSizeSymbols.html b/test/output/penguinSizeSymbols.html index 7f9b091ce8..601091321b 100644 --- a/test/output/penguinSizeSymbols.html +++ b/test/output/penguinSizeSymbols.html @@ -57,85 +57,80 @@ white-space: pre; } - - - - 175 - - - - 180 - - - - 185 - - - - 190 - - - - 195 - - - - 200 - - - - 205 - - - - 210 - - - - 215 - - - - 220 - - - - 225 - - - - 230 - ↑ Flipper length (mm) + + + + + + + + + + + + + - - - - 3,000 - - - - 3,500 - - - - 4,000 - - - - 4,500 - - - - 5,000 - - - - 5,500 - - - - 6,000 - Body mass (g) → + + + + + + + + + + + + + + + + 175 + 180 + 185 + 190 + 195 + 200 + 205 + 210 + 215 + 220 + 225 + 230 + + + ↑ Flipper length (mm) + + + + + + + + + + + + + + + + + + + + + 3,000 + 3,500 + 4,000 + 4,500 + 5,000 + 5,500 + 6,000 + + + Body mass (g) → diff --git a/test/output/penguinSpeciesCheysson.html b/test/output/penguinSpeciesCheysson.html index d738ee1746..0f448e99b5 100644 --- a/test/output/penguinSpeciesCheysson.html +++ b/test/output/penguinSpeciesCheysson.html @@ -51,42 +51,41 @@ white-space: pre; } - - - 0 - - - 20 - - - 40 - - - 60 - - - 80 - - - 100 - - - 120 - - - 140 - ↑ Frequency + + + + + + + + + - - - Adelie - - - Chinstrap - - - Gentoo - species + + 0 + 20 + 40 + 60 + 80 + 100 + 120 + 140 + + + ↑ Frequency + + + + + + + + Adelie + Chinstrap + Gentoo + + + species diff --git a/test/output/penguinSpeciesGradient.svg b/test/output/penguinSpeciesGradient.svg index 5632d89865..8fd1fa7812 100644 --- a/test/output/penguinSpeciesGradient.svg +++ b/test/output/penguinSpeciesGradient.svg @@ -13,42 +13,41 @@ white-space: pre; } - - - 0 - - - 20 - - - 40 - - - 60 - - - 80 - - - 100 - - - 120 - - - 140 - ↑ Frequency + + + + + + + + + - - - Adelie - - - Chinstrap - - - Gentoo - species + + 0 + 20 + 40 + 60 + 80 + 100 + 120 + 140 + + + ↑ Frequency + + + + + + + + Adelie + Chinstrap + Gentoo + + + species diff --git a/test/output/penguinSpeciesGroup.svg b/test/output/penguinSpeciesGroup.svg index 5fcf723b47..52fa48f8c0 100644 --- a/test/output/penguinSpeciesGroup.svg +++ b/test/output/penguinSpeciesGroup.svg @@ -13,47 +13,45 @@ white-space: pre; } - - - 0.0 - - - 0.1 - - - 0.2 - - - 0.3 - - - 0.4 - - - 0.5 - - - 0.6 - - - 0.7 - - - 0.8 - - - 0.9 - - - 1.0 - Frequency → + + + + + + + + + + + + + + + 0.0 + 0.1 + 0.2 + 0.3 + 0.4 + 0.5 + 0.6 + 0.7 + 0.8 + 0.9 + 1.0 + + + Frequency → - AdelieChinstrapGentoo + + Adelie + Chinstrap + Gentoo + diff --git a/test/output/penguinSpeciesIsland.svg b/test/output/penguinSpeciesIsland.svg index ed03003172..92ba6a289d 100644 --- a/test/output/penguinSpeciesIsland.svg +++ b/test/output/penguinSpeciesIsland.svg @@ -13,50 +13,51 @@ white-space: pre; } - - - - 0 - - - - 20 - - - - 40 - - - - 60 - - - - 80 - - - - 100 - - - - 120 - - - - 140 - ↑ Frequency + + + + + + + + + + + + + + + + + + + + + + 0 + 20 + 40 + 60 + 80 + 100 + 120 + 140 + + + ↑ Frequency + + + + + + + + Adelie + Chinstrap + Gentoo - - - Adelie - - - Chinstrap - - - Gentoo - species + + species diff --git a/test/output/penguinSpeciesIslandRelative.svg b/test/output/penguinSpeciesIslandRelative.svg index f398761afe..e4e0a94f6f 100644 --- a/test/output/penguinSpeciesIslandRelative.svg +++ b/test/output/penguinSpeciesIslandRelative.svg @@ -13,76 +13,80 @@ white-space: pre; } - - - 0 + + + + + + Adelie + + + + + + + + + + + + + + + + 0 + 10 + 20 + 30 + 40 + 50 + 60 + 70 + 80 + 90 + 100 - - 10 - - - 20 - - - 30 - - - 40 - - - 50 - - - 60 - - - 70 - - - 80 + + + + - - 90 + + - - 100 - ↑ Frequency (%) - - - Adelie + + + - - Chinstrap + + Chinstrap - - Gentoo - species - - - - - + - + - - - + + + - - + + Gentoo - - - + - + + + species + + + ↑ Frequency (%) + \ No newline at end of file diff --git a/test/output/penguinSpeciesIslandSex.svg b/test/output/penguinSpeciesIslandSex.svg index d9c38a70e7..4eb7e4d6d0 100644 --- a/test/output/penguinSpeciesIslandSex.svg +++ b/test/output/penguinSpeciesIslandSex.svg @@ -13,144 +13,171 @@ white-space: pre; } - - - 0 - - - - 5 - - - - 10 - - - - 15 - - - - 20 - - - - 25 - - - - 30 - - - - 35 - - - - 40 - - - - 45 - - - - 50 - - - - 55 - - - - 60 - - - - 65 - - - - 70 - - ↑ Frequency - - - - Adelie - - - Chinstrap - - - Gentoo - species - - - - FEMALE - - - MALE + + + Adelie + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 0 + 5 + 10 + 15 + 20 + 25 + 30 + 35 + 40 + 45 + 50 + 55 + 60 + 65 + 70 + + + + + + + + FEMALE + MALE + N/A - - N/A - - - - - FEMALE - - - MALE - - - N/A - sex - - - - FEMALE - - - MALE - - - N/A - - - - - - - - - - - + + + + + + + + - + - + + + Chinstrap + + + + + + + + + + + + + + + + + + + + + + + + + FEMALE + MALE + N/A + - - + + - + - + + + Gentoo + + + + + + + + + + + + + + + + + + + + + + + + + FEMALE + MALE + N/A + - - - + + + - + + + species + + + ↑ Frequency + + + sex + \ No newline at end of file diff --git a/test/output/penguinVoronoi1D.svg b/test/output/penguinVoronoi1D.svg index 09eeac6353..1a4791753c 100644 --- a/test/output/penguinVoronoi1D.svg +++ b/test/output/penguinVoronoi1D.svg @@ -13,1398 +13,712 @@ white-space: pre; } - - - 3,000 - - - 3,500 - - - 4,000 - - - 4,500 - - - 5,000 - - - 5,500 - - - 6,000 - body_mass_g → + + + + + + + + + + + 3,000 + 3,500 + 4,000 + 4,500 + 5,000 + 5,500 + 6,000 + + + body_mass_g → - - Adelie (MALE) - Torgersen - - - Adelie (FEMALE) - Torgersen - - - Adelie (FEMALE) - Torgersen - - - Adelie (FEMALE) - Torgersen - - - Adelie (MALE) - Torgersen - - - Adelie (FEMALE) - Torgersen - - - Adelie (MALE) - Torgersen - - - Adelie (null) - Torgersen - - - Adelie (null) - Torgersen - - - Adelie (null) - Torgersen - - - Adelie (null) - Torgersen - - - Adelie (FEMALE) - Torgersen - - - Adelie (MALE) - Torgersen - - - Adelie (MALE) - Torgersen - - - Adelie (FEMALE) - Torgersen - - - Adelie (FEMALE) - Torgersen - - - Adelie (MALE) - Torgersen - - - Adelie (FEMALE) - Torgersen - - - Adelie (MALE) - Torgersen - - - Adelie (FEMALE) - Biscoe - - - Adelie (MALE) - Biscoe - - - Adelie (FEMALE) - Biscoe - - - Adelie (MALE) - Biscoe - - - Adelie (MALE) - Biscoe - - - Adelie (FEMALE) - Biscoe - - - Adelie (MALE) - Biscoe - - - Adelie (FEMALE) - Biscoe - - - Adelie (FEMALE) - Biscoe - - - Adelie (MALE) - Biscoe - - - Adelie (FEMALE) - Dream - - - Adelie (MALE) - Dream - - - Adelie (FEMALE) - Dream - - - Adelie (MALE) - Dream - - - Adelie (FEMALE) - Dream - - - Adelie (MALE) - Dream - - - Adelie (MALE) - Dream - - - Adelie (FEMALE) - Dream - - - Adelie (FEMALE) - Dream - - - Adelie (MALE) - Dream - - - Adelie (FEMALE) - Dream - - - Adelie (MALE) - Dream - - - Adelie (FEMALE) - Dream - - - Adelie (MALE) - Dream - - - Adelie (FEMALE) - Dream - - - Adelie (MALE) - Dream - - - Adelie (MALE) - Dream - - - Adelie (null) - Dream - - - Adelie (FEMALE) - Dream - - - Adelie (MALE) - Dream - - - Adelie (FEMALE) - Biscoe - - - Adelie (MALE) - Biscoe - - - Adelie (FEMALE) - Biscoe - - - Adelie (MALE) - Biscoe - - - Adelie (FEMALE) - Biscoe - - - Adelie (MALE) - Biscoe - - - Adelie (FEMALE) - Biscoe - - - Adelie (MALE) - Biscoe - - - Adelie (FEMALE) - Biscoe - - - Adelie (MALE) - Biscoe - - - Adelie (FEMALE) - Biscoe - - - Adelie (MALE) - Biscoe - - - Adelie (FEMALE) - Biscoe - - - Adelie (MALE) - Biscoe - - - Adelie (FEMALE) - Biscoe - - - Adelie (MALE) - Biscoe - - - Adelie (FEMALE) - Biscoe - - - Adelie (MALE) - Biscoe - - - Adelie (FEMALE) - Torgersen - - - Adelie (MALE) - Torgersen - - - Adelie (FEMALE) - Torgersen - - - Adelie (MALE) - Torgersen - - - Adelie (FEMALE) - Torgersen - - - Adelie (MALE) - Torgersen - - - Adelie (FEMALE) - Torgersen - - - Adelie (MALE) - Torgersen - - - Adelie (FEMALE) - Torgersen - - - Adelie (MALE) - Torgersen - - - Adelie (FEMALE) - Torgersen - - - Adelie (MALE) - Torgersen - - - Adelie (FEMALE) - Torgersen - - - Adelie (MALE) - Torgersen - - - Adelie (FEMALE) - Torgersen - - - Adelie (MALE) - Torgersen - - - Adelie (FEMALE) - Dream - - - Adelie (MALE) - Dream - - - Adelie (MALE) - Dream - - - Adelie (FEMALE) - Dream - - - Adelie (MALE) - Dream - - - Adelie (FEMALE) - Dream - - - Adelie (FEMALE) - Dream - - - Adelie (MALE) - Dream - - - Adelie (FEMALE) - Dream - - - Adelie (MALE) - Dream - - - Adelie (FEMALE) - Dream - - - Adelie (MALE) - Dream - - - Adelie (FEMALE) - Dream - - - Adelie (MALE) - Dream - - - Adelie (FEMALE) - Dream - - - Adelie (MALE) - Dream - - - Adelie (FEMALE) - Biscoe - - - Adelie (MALE) - Biscoe - - - Adelie (FEMALE) - Biscoe - - - Adelie (MALE) - Biscoe - - - Adelie (FEMALE) - Biscoe - - - Adelie (MALE) - Biscoe - - - Adelie (FEMALE) - Biscoe - - - Adelie (MALE) - Biscoe - - - Adelie (FEMALE) - Biscoe - - - Adelie (MALE) - Biscoe - - - Adelie (FEMALE) - Biscoe - - - Adelie (MALE) - Biscoe - - - Adelie (FEMALE) - Biscoe - - - Adelie (MALE) - Biscoe - - - Adelie (FEMALE) - Biscoe - - - Adelie (MALE) - Biscoe - - - Adelie (FEMALE) - Torgersen - - - Adelie (MALE) - Torgersen - - - Adelie (FEMALE) - Torgersen - - - Adelie (MALE) - Torgersen - - - Adelie (FEMALE) - Torgersen - - - Adelie (MALE) - Torgersen - - - Adelie (FEMALE) - Torgersen - - - Adelie (MALE) - Torgersen - - - Adelie (FEMALE) - Torgersen - - - Adelie (MALE) - Torgersen - - - Adelie (FEMALE) - Torgersen - - - Adelie (MALE) - Torgersen - - - Adelie (FEMALE) - Torgersen - - - Adelie (MALE) - Torgersen - - - Adelie (FEMALE) - Torgersen - - - Adelie (MALE) - Torgersen - - - Adelie (FEMALE) - Dream - - - Adelie (MALE) - Dream - - - Adelie (FEMALE) - Dream - - - Adelie (MALE) - Dream - - - Adelie (FEMALE) - Dream - - - Adelie (MALE) - Dream - - - Adelie (FEMALE) - Dream - - - Adelie (MALE) - Dream - - - Adelie (FEMALE) - Dream - - - Adelie (MALE) - Dream - - - Adelie (FEMALE) - Dream - - - Adelie (MALE) - Dream - - - Adelie (FEMALE) - Dream - - - Adelie (MALE) - Dream - - - Adelie (MALE) - Dream - - - Adelie (FEMALE) - Dream - - - Adelie (FEMALE) - Dream - - - Adelie (MALE) - Dream - - - Adelie (FEMALE) - Dream - - - Adelie (MALE) - Dream - - - Chinstrap (FEMALE) - Dream - - - Chinstrap (MALE) - Dream - - - Chinstrap (MALE) - Dream - - - Chinstrap (FEMALE) - Dream - - - Chinstrap (MALE) - Dream - - - Chinstrap (FEMALE) - Dream - - - Chinstrap (FEMALE) - Dream - - - Chinstrap (MALE) - Dream - - - Chinstrap (FEMALE) - Dream - - - Chinstrap (MALE) - Dream - - - Chinstrap (FEMALE) - Dream - - - Chinstrap (MALE) - Dream - - - Chinstrap (FEMALE) - Dream - - - Chinstrap (MALE) - Dream - - - Chinstrap (FEMALE) - Dream - - - Chinstrap (MALE) - Dream - - - Chinstrap (MALE) - Dream - - - Chinstrap (FEMALE) - Dream - - - Chinstrap (FEMALE) - Dream - - - Chinstrap (MALE) - Dream - - - Chinstrap (FEMALE) - Dream - - - Chinstrap (MALE) - Dream - - - Chinstrap (FEMALE) - Dream - - - Chinstrap (MALE) - Dream - - - Chinstrap (FEMALE) - Dream - - - Chinstrap (MALE) - Dream - - - Chinstrap (FEMALE) - Dream - - - Chinstrap (MALE) - Dream - - - Chinstrap (FEMALE) - Dream - - - Chinstrap (MALE) - Dream - - - Chinstrap (FEMALE) - Dream - - - Chinstrap (MALE) - Dream - - - Chinstrap (FEMALE) - Dream - - - Chinstrap (MALE) - Dream - - - Chinstrap (MALE) - Dream - - - Chinstrap (FEMALE) - Dream - - - Chinstrap (FEMALE) - Dream - - - Chinstrap (MALE) - Dream - - - Chinstrap (FEMALE) - Dream - - - Chinstrap (MALE) - Dream - - - Chinstrap (MALE) - Dream - - - Chinstrap (FEMALE) - Dream - - - Chinstrap (MALE) - Dream - - - Chinstrap (FEMALE) - Dream - - - Chinstrap (FEMALE) - Dream - - - Chinstrap (MALE) - Dream - - - Chinstrap (FEMALE) - Dream - - - Chinstrap (MALE) - Dream - - - Chinstrap (MALE) - Dream - - - Chinstrap (FEMALE) - Dream - - - Chinstrap (FEMALE) - Dream - - - Chinstrap (MALE) - Dream - - - Chinstrap (FEMALE) - Dream - - - Chinstrap (MALE) - Dream - - - Chinstrap (FEMALE) - Dream - - - Chinstrap (MALE) - Dream - - - Chinstrap (FEMALE) - Dream - - - Chinstrap (MALE) - Dream - - - Chinstrap (MALE) - Dream - - - Chinstrap (FEMALE) - Dream - - - Chinstrap (MALE) - Dream - - - Chinstrap (FEMALE) - Dream - - - Chinstrap (FEMALE) - Dream - - - Chinstrap (MALE) - Dream - - - Chinstrap (FEMALE) - Dream - - - Chinstrap (MALE) - Dream - - - Chinstrap (MALE) - Dream - - - Chinstrap (FEMALE) - Dream - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (null) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (null) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (null) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (null) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - - - Gentoo (FEMALE) - Biscoe - - - Gentoo (MALE) - Biscoe - + Adelie (MALE) + Torgersen + Adelie (FEMALE) + Torgersen + Adelie (FEMALE) + Torgersen + Adelie (FEMALE) + Torgersen + Adelie (MALE) + Torgersen + Adelie (FEMALE) + Torgersen + Adelie (MALE) + Torgersen + Adelie (null) + Torgersen + Adelie (null) + Torgersen + Adelie (null) + Torgersen + Adelie (null) + Torgersen + Adelie (FEMALE) + Torgersen + Adelie (MALE) + Torgersen + Adelie (MALE) + Torgersen + Adelie (FEMALE) + Torgersen + Adelie (FEMALE) + Torgersen + Adelie (MALE) + Torgersen + Adelie (FEMALE) + Torgersen + Adelie (MALE) + Torgersen + Adelie (FEMALE) + Biscoe + Adelie (MALE) + Biscoe + Adelie (FEMALE) + Biscoe + Adelie (MALE) + Biscoe + Adelie (MALE) + Biscoe + Adelie (FEMALE) + Biscoe + Adelie (MALE) + Biscoe + Adelie (FEMALE) + Biscoe + Adelie (FEMALE) + Biscoe + Adelie (MALE) + Biscoe + Adelie (FEMALE) + Dream + Adelie (MALE) + Dream + Adelie (FEMALE) + Dream + Adelie (MALE) + Dream + Adelie (FEMALE) + Dream + Adelie (MALE) + Dream + Adelie (MALE) + Dream + Adelie (FEMALE) + Dream + Adelie (FEMALE) + Dream + Adelie (MALE) + Dream + Adelie (FEMALE) + Dream + Adelie (MALE) + Dream + Adelie (FEMALE) + Dream + Adelie (MALE) + Dream + Adelie (FEMALE) + Dream + Adelie (MALE) + Dream + Adelie (MALE) + Dream + Adelie (null) + Dream + Adelie (FEMALE) + Dream + Adelie (MALE) + Dream + Adelie (FEMALE) + Biscoe + Adelie (MALE) + Biscoe + Adelie (FEMALE) + Biscoe + Adelie (MALE) + Biscoe + Adelie (FEMALE) + Biscoe + Adelie (MALE) + Biscoe + Adelie (FEMALE) + Biscoe + Adelie (MALE) + Biscoe + Adelie (FEMALE) + Biscoe + Adelie (MALE) + Biscoe + Adelie (FEMALE) + Biscoe + Adelie (MALE) + Biscoe + Adelie (FEMALE) + Biscoe + Adelie (MALE) + Biscoe + Adelie (FEMALE) + Biscoe + Adelie (MALE) + Biscoe + Adelie (FEMALE) + Biscoe + Adelie (MALE) + Biscoe + Adelie (FEMALE) + Torgersen + Adelie (MALE) + Torgersen + Adelie (FEMALE) + Torgersen + Adelie (MALE) + Torgersen + Adelie (FEMALE) + Torgersen + Adelie (MALE) + Torgersen + Adelie (FEMALE) + Torgersen + Adelie (MALE) + Torgersen + Adelie (FEMALE) + Torgersen + Adelie (MALE) + Torgersen + Adelie (FEMALE) + Torgersen + Adelie (MALE) + Torgersen + Adelie (FEMALE) + Torgersen + Adelie (MALE) + Torgersen + Adelie (FEMALE) + Torgersen + Adelie (MALE) + Torgersen + Adelie (FEMALE) + Dream + Adelie (MALE) + Dream + Adelie (MALE) + Dream + Adelie (FEMALE) + Dream + Adelie (MALE) + Dream + Adelie (FEMALE) + Dream + Adelie (FEMALE) + Dream + Adelie (MALE) + Dream + Adelie (FEMALE) + Dream + Adelie (MALE) + Dream + Adelie (FEMALE) + Dream + Adelie (MALE) + Dream + Adelie (FEMALE) + Dream + Adelie (MALE) + Dream + Adelie (FEMALE) + Dream + Adelie (MALE) + Dream + Adelie (FEMALE) + Biscoe + Adelie (MALE) + Biscoe + Adelie (FEMALE) + Biscoe + Adelie (MALE) + Biscoe + Adelie (FEMALE) + Biscoe + Adelie (MALE) + Biscoe + Adelie (FEMALE) + Biscoe + Adelie (MALE) + Biscoe + Adelie (FEMALE) + Biscoe + Adelie (MALE) + Biscoe + Adelie (FEMALE) + Biscoe + Adelie (MALE) + Biscoe + Adelie (FEMALE) + Biscoe + Adelie (MALE) + Biscoe + Adelie (FEMALE) + Biscoe + Adelie (MALE) + Biscoe + Adelie (FEMALE) + Torgersen + Adelie (MALE) + Torgersen + Adelie (FEMALE) + Torgersen + Adelie (MALE) + Torgersen + Adelie (FEMALE) + Torgersen + Adelie (MALE) + Torgersen + Adelie (FEMALE) + Torgersen + Adelie (MALE) + Torgersen + Adelie (FEMALE) + Torgersen + Adelie (MALE) + Torgersen + Adelie (FEMALE) + Torgersen + Adelie (MALE) + Torgersen + Adelie (FEMALE) + Torgersen + Adelie (MALE) + Torgersen + Adelie (FEMALE) + Torgersen + Adelie (MALE) + Torgersen + Adelie (FEMALE) + Dream + Adelie (MALE) + Dream + Adelie (FEMALE) + Dream + Adelie (MALE) + Dream + Adelie (FEMALE) + Dream + Adelie (MALE) + Dream + Adelie (FEMALE) + Dream + Adelie (MALE) + Dream + Adelie (FEMALE) + Dream + Adelie (MALE) + Dream + Adelie (FEMALE) + Dream + Adelie (MALE) + Dream + Adelie (FEMALE) + Dream + Adelie (MALE) + Dream + Adelie (MALE) + Dream + Adelie (FEMALE) + Dream + Adelie (FEMALE) + Dream + Adelie (MALE) + Dream + Adelie (FEMALE) + Dream + Adelie (MALE) + Dream + Chinstrap (FEMALE) + Dream + Chinstrap (MALE) + Dream + Chinstrap (MALE) + Dream + Chinstrap (FEMALE) + Dream + Chinstrap (MALE) + Dream + Chinstrap (FEMALE) + Dream + Chinstrap (FEMALE) + Dream + Chinstrap (MALE) + Dream + Chinstrap (FEMALE) + Dream + Chinstrap (MALE) + Dream + Chinstrap (FEMALE) + Dream + Chinstrap (MALE) + Dream + Chinstrap (FEMALE) + Dream + Chinstrap (MALE) + Dream + Chinstrap (FEMALE) + Dream + Chinstrap (MALE) + Dream + Chinstrap (MALE) + Dream + Chinstrap (FEMALE) + Dream + Chinstrap (FEMALE) + Dream + Chinstrap (MALE) + Dream + Chinstrap (FEMALE) + Dream + Chinstrap (MALE) + Dream + Chinstrap (FEMALE) + Dream + Chinstrap (MALE) + Dream + Chinstrap (FEMALE) + Dream + Chinstrap (MALE) + Dream + Chinstrap (FEMALE) + Dream + Chinstrap (MALE) + Dream + Chinstrap (FEMALE) + Dream + Chinstrap (MALE) + Dream + Chinstrap (FEMALE) + Dream + Chinstrap (MALE) + Dream + Chinstrap (FEMALE) + Dream + Chinstrap (MALE) + Dream + Chinstrap (MALE) + Dream + Chinstrap (FEMALE) + Dream + Chinstrap (FEMALE) + Dream + Chinstrap (MALE) + Dream + Chinstrap (FEMALE) + Dream + Chinstrap (MALE) + Dream + Chinstrap (MALE) + Dream + Chinstrap (FEMALE) + Dream + Chinstrap (MALE) + Dream + Chinstrap (FEMALE) + Dream + Chinstrap (FEMALE) + Dream + Chinstrap (MALE) + Dream + Chinstrap (FEMALE) + Dream + Chinstrap (MALE) + Dream + Chinstrap (MALE) + Dream + Chinstrap (FEMALE) + Dream + Chinstrap (FEMALE) + Dream + Chinstrap (MALE) + Dream + Chinstrap (FEMALE) + Dream + Chinstrap (MALE) + Dream + Chinstrap (FEMALE) + Dream + Chinstrap (MALE) + Dream + Chinstrap (FEMALE) + Dream + Chinstrap (MALE) + Dream + Chinstrap (MALE) + Dream + Chinstrap (FEMALE) + Dream + Chinstrap (MALE) + Dream + Chinstrap (FEMALE) + Dream + Chinstrap (FEMALE) + Dream + Chinstrap (MALE) + Dream + Chinstrap (FEMALE) + Dream + Chinstrap (MALE) + Dream + Chinstrap (MALE) + Dream + Chinstrap (FEMALE) + Dream + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (null) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (null) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (null) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (null) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe + Gentoo (FEMALE) + Biscoe + Gentoo (MALE) + Biscoe diff --git a/test/output/polylinear.svg b/test/output/polylinear.svg index e8332febc0..88f14a7316 100644 --- a/test/output/polylinear.svg +++ b/test/output/polylinear.svg @@ -13,134 +13,128 @@ white-space: pre; } - - - - 05 - - - - 06 - - - - 07 - - - - 08 - - - - 09 - - - - 10 - - - - 11 - - - - 12 - - - - 13 - - - - 14 - - - - 15 - - - - 16 - - - - 17 - - - - 18 - - - - 19 - - - - 20 - - - - 21 - - - - 22 - - - - 23 - - - - 24 - - - - 25 - - - - 26 - - - - 27 - date → + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 05 + 06 + 07 + 08 + 09 + 10 + 11 + 12 + 13 + 14 + 15 + 16 + 17 + 18 + 19 + 20 + 21 + 22 + 23 + 24 + 25 + 26 + 27 + + + date → - - - - - - - - - - - - - - - - - - - - - - + + + + + + + + + + + + + + + + + + + + + + - - - - + + + + - - - - + + + + + + + Initiate + Begin + Entry + Test + Drive + Drive + Brake + Stop + Shutdown - InitiateBeginEntryTestDriveDriveBrakeStopShutdown \ No newline at end of file diff --git a/test/output/projectionBleedEdges2.svg b/test/output/projectionBleedEdges2.svg index 5046446f68..b1af6ad33a 100644 --- a/test/output/projectionBleedEdges2.svg +++ b/test/output/projectionBleedEdges2.svg @@ -13,30 +13,28 @@ white-space: pre; } - - - 1 + + + 1 - - 2 - - - - + - + - + - + + + 2 + - + - + - + \ No newline at end of file diff --git a/test/output/projectionFitBertin1953.svg b/test/output/projectionFitBertin1953.svg index 6b57a79f35..29200805f2 100644 --- a/test/output/projectionFitBertin1953.svg +++ b/test/output/projectionFitBertin1953.svg @@ -13,21 +13,19 @@ white-space: pre; } - - - a - - - b - - + + a + + + b + diff --git a/test/output/projectionHeightEqualEarth.svg b/test/output/projectionHeightEqualEarth.svg index c379e4a053..419a217896 100644 --- a/test/output/projectionHeightEqualEarth.svg +++ b/test/output/projectionHeightEqualEarth.svg @@ -13,36 +13,34 @@ white-space: pre; } - - - 0 + + + 0 - - 1 - - - - + - + - + - + - + + + 1 + - + - + - + - + \ No newline at end of file diff --git a/test/output/projectionHeightGeometry.svg b/test/output/projectionHeightGeometry.svg index 8e293909eb..2080d79823 100644 --- a/test/output/projectionHeightGeometry.svg +++ b/test/output/projectionHeightGeometry.svg @@ -13,24 +13,22 @@ white-space: pre; } - - - 0 + + + 0 - - 1 - - - - + - + - + + + 1 + - + - + \ No newline at end of file diff --git a/test/output/projectionHeightMercator.svg b/test/output/projectionHeightMercator.svg index cf6c8df668..b71ba12991 100644 --- a/test/output/projectionHeightMercator.svg +++ b/test/output/projectionHeightMercator.svg @@ -13,36 +13,34 @@ white-space: pre; } - - - 0 + + + 0 - - 1 - - - - + - + - + - + - + + + 1 + - + - + - + - + \ No newline at end of file diff --git a/test/output/projectionHeightOrthographic.svg b/test/output/projectionHeightOrthographic.svg index b7f68c727d..6609f0b076 100644 --- a/test/output/projectionHeightOrthographic.svg +++ b/test/output/projectionHeightOrthographic.svg @@ -13,68 +13,64 @@ white-space: pre; } - - - 0 + + + 0 - - 1 - - - - - 0 - - - 1 - - - - + - + - + - + - + + + 1 + + + 0 + - + - + - + - + - + - + - + - + - + - + + + 1 + - + - + - + - + \ No newline at end of file diff --git a/test/output/randomBins.svg b/test/output/randomBins.svg index 764f5626fc..ca56ffdabf 100644 --- a/test/output/randomBins.svg +++ b/test/output/randomBins.svg @@ -13,69 +13,56 @@ white-space: pre; } - - - 0 - - - 5 - - - 10 - - - 15 - - - 20 - - - 25 - - - 30 - - - 35 - - - 40 - - - 45 - - - 50 - - - 55 - - - 60 - ↑ Frequency + + + + + + + + + + + + + + - - - 0 - - - 1 - - - 2 - - - 3 - - - 4 - - - 5 - - - 6 - + + 0 + 5 + 10 + 15 + 20 + 25 + 30 + 35 + 40 + 45 + 50 + 55 + 60 + + + ↑ Frequency + + + + + + + + + + + + 0 + 1 + 2 + 3 + 4 + 5 + 6 diff --git a/test/output/randomBinsXY.svg b/test/output/randomBinsXY.svg index 2125c7aaa1..10c441cf91 100644 --- a/test/output/randomBinsXY.svg +++ b/test/output/randomBinsXY.svg @@ -13,66 +13,51 @@ white-space: pre; } - - - 2 - - - 4 - - - 6 - - - 8 - - - 10 - - - 12 - - - 14 - - - 16 - - - 18 - + + + + + + + + + + - - - 0 - - - 2 - - - 4 - - - 6 - - - 8 - - - 10 - - - 12 - - - 14 - - - 16 - - - 18 - + + 2 + 4 + 6 + 8 + 10 + 12 + 14 + 16 + 18 + + + + + + + + + + + + + + + 0 + 2 + 4 + 6 + 8 + 10 + 12 + 14 + 16 + 18 diff --git a/test/output/randomQuantile.svg b/test/output/randomQuantile.svg index b6c8eaa30a..b9622f0458 100644 --- a/test/output/randomQuantile.svg +++ b/test/output/randomQuantile.svg @@ -13,57 +13,45 @@ white-space: pre; } - - - 0.0 - - - 0.1 - - - 0.2 - - - 0.3 - - - 0.4 - - - 0.5 - - - 0.6 - - - 0.7 - - - 0.8 - - - 0.9 - - - 1.0 - + + + + + + + + + + + + - - - −2 - - - −1 - - - 0 - - - 1 - - - 2 - + + 0.0 + 0.1 + 0.2 + 0.3 + 0.4 + 0.5 + 0.6 + 0.7 + 0.8 + 0.9 + 1.0 + + + + + + + + + + −2 + −1 + 0 + 1 + 2 diff --git a/test/output/randomWalk.svg b/test/output/randomWalk.svg index de90ad9a83..f091a6ec7e 100644 --- a/test/output/randomWalk.svg +++ b/test/output/randomWalk.svg @@ -13,75 +13,57 @@ white-space: pre; } - - - −35 - - - −30 - - - −25 - - - −20 - - - −15 - - - −10 - - - −5 - - - 0 - - - 5 - - - 10 - - - 15 - - - 20 - + + + + + + + + + + + + + - - - 0 - - - 50 - - - 100 - - - 150 - - - 200 - - - 250 - - - 300 - - - 350 - - - 400 - - - 450 - + + −35 + −30 + −25 + −20 + −15 + −10 + −5 + 0 + 5 + 10 + 15 + 20 + + + + + + + + + + + + + + + 0 + 50 + 100 + 150 + 200 + 250 + 300 + 350 + 400 + 450 diff --git a/test/output/rasterPenguinsBarycentric.svg b/test/output/rasterPenguinsBarycentric.svg index d4b280b2b0..fb5f3197e5 100644 --- a/test/output/rasterPenguinsBarycentric.svg +++ b/test/output/rasterPenguinsBarycentric.svg @@ -13,66 +13,57 @@ white-space: pre; } - - - 175 - - - 180 - - - 185 - - - 190 - - - 195 - - - 200 - - - 205 - - - 210 - - - 215 - - - 220 - - - 225 - - - 230 - ↑ flipper_length_mm + + + + + + + + + + + + + - - - 3,000 - - - 3,500 - - - 4,000 - - - 4,500 - - - 5,000 - - - 5,500 - - - 6,000 - body_mass_g → + + 175 + 180 + 185 + 190 + 195 + 200 + 205 + 210 + 215 + 220 + 225 + 230 + + + ↑ flipper_length_mm + + + + + + + + + + + + 3,000 + 3,500 + 4,000 + 4,500 + 5,000 + 5,500 + 6,000 + + + body_mass_g → diff --git a/test/output/rasterPenguinsBlur.svg b/test/output/rasterPenguinsBlur.svg index 7c3011612f..5058069f86 100644 --- a/test/output/rasterPenguinsBlur.svg +++ b/test/output/rasterPenguinsBlur.svg @@ -13,66 +13,57 @@ white-space: pre; } - - - 175 - - - 180 - - - 185 - - - 190 - - - 195 - - - 200 - - - 205 - - - 210 - - - 215 - - - 220 - - - 225 - - - 230 - ↑ flipper_length_mm + + + + + + + + + + + + + - - - 3,000 - - - 3,500 - - - 4,000 - - - 4,500 - - - 5,000 - - - 5,500 - - - 6,000 - body_mass_g → + + 175 + 180 + 185 + 190 + 195 + 200 + 205 + 210 + 215 + 220 + 225 + 230 + + + ↑ flipper_length_mm + + + + + + + + + + + + 3,000 + 3,500 + 4,000 + 4,500 + 5,000 + 5,500 + 6,000 + + + body_mass_g → diff --git a/test/output/rasterPenguinsRandomWalk.svg b/test/output/rasterPenguinsRandomWalk.svg index 5954235b11..9df56baa3b 100644 --- a/test/output/rasterPenguinsRandomWalk.svg +++ b/test/output/rasterPenguinsRandomWalk.svg @@ -13,66 +13,57 @@ white-space: pre; } - - - 175 - - - 180 - - - 185 - - - 190 - - - 195 - - - 200 - - - 205 - - - 210 - - - 215 - - - 220 - - - 225 - - - 230 - ↑ flipper_length_mm + + + + + + + + + + + + + - - - 3,000 - - - 3,500 - - - 4,000 - - - 4,500 - - - 5,000 - - - 5,500 - - - 6,000 - body_mass_g → + + 175 + 180 + 185 + 190 + 195 + 200 + 205 + 210 + 215 + 220 + 225 + 230 + + + ↑ flipper_length_mm + + + + + + + + + + + + 3,000 + 3,500 + 4,000 + 4,500 + 5,000 + 5,500 + 6,000 + + + body_mass_g → diff --git a/test/output/rasterVapor.svg b/test/output/rasterVapor.svg index b312e89706..cb533b5f1a 100644 --- a/test/output/rasterVapor.svg +++ b/test/output/rasterVapor.svg @@ -13,57 +13,45 @@ white-space: pre; } - - - −80 - - - −60 - - - −40 - - - −20 - - - 0 - - - 20 - - - 40 - - - 60 - - - 80 - + + + + + + + + + + - - - −150 - - - −100 - - - −50 - - - 0 - - - 50 - - - 100 - - - 150 - + + −80 + −60 + −40 + −20 + 0 + 20 + 40 + 60 + 80 + + + + + + + + + + + + −150 + −100 + −50 + 0 + 50 + 100 + 150 diff --git a/test/output/rasterVaporPeters.svg b/test/output/rasterVaporPeters.svg index c9a2bac9cb..52be7731ce 100644 --- a/test/output/rasterVaporPeters.svg +++ b/test/output/rasterVaporPeters.svg @@ -13,57 +13,45 @@ white-space: pre; } - - - -80 - - - -60 - - - -40 - - - -20 - - - 0 - - - 20 - - - 40 - - - 60 - - - 80 - + + + + + + + + + + - - - −150 - - - −100 - - - −50 - - - 0 - - - 50 - - - 100 - - - 150 - + + -80 + -60 + -40 + -20 + 0 + 20 + 40 + 60 + 80 + + + + + + + + + + + + −150 + −100 + −50 + 0 + 50 + 100 + 150 diff --git a/test/output/rectBand.svg b/test/output/rectBand.svg index 4337be4705..9a06bab5db 100644 --- a/test/output/rectBand.svg +++ b/test/output/rectBand.svg @@ -13,54 +13,46 @@ white-space: pre; } - - - - A - - - - B - - - - C - + + + + - - - 0.0 - - - 0.1 - - - 0.2 - - - 0.3 - - - 0.4 - - - 0.5 - - - 0.6 - - - 0.7 - - - 0.8 - - - 0.9 - - - 1.0 - + + + + + + + A + B + C + + + + + + + + + + + + + + + + 0.0 + 0.1 + 0.2 + 0.3 + 0.4 + 0.5 + 0.6 + 0.7 + 0.8 + 0.9 + 1.0 diff --git a/test/output/seattlePrecipitationDensity.svg b/test/output/seattlePrecipitationDensity.svg index c4bd5d2e9d..0f7b3616a0 100644 --- a/test/output/seattlePrecipitationDensity.svg +++ b/test/output/seattlePrecipitationDensity.svg @@ -13,51 +13,47 @@ white-space: pre; } - - - 1 - - - 2 - - - 3 - - - 4 - - - 5 - - - 6 - - - 7 - - - 8 - - - 9 - ↑ wind + + + + + + + + + + - - - −5 - - - 0 - - - 5 - - - 10 - - - 15 - temp_min → + + 1 + 2 + 3 + 4 + 5 + 6 + 7 + 8 + 9 + + + ↑ wind + + + + + + + + + + −5 + 0 + 5 + 10 + 15 + + + temp_min → diff --git a/test/output/seattlePrecipitationRule.svg b/test/output/seattlePrecipitationRule.svg index 90fbd9f39e..c7a8341146 100644 --- a/test/output/seattlePrecipitationRule.svg +++ b/test/output/seattlePrecipitationRule.svg @@ -13,19 +13,17 @@ white-space: pre; } - - - 2012 - - - 2013 - - - 2014 - - - 2015 - + + + + + + + + 2012 + 2013 + 2014 + 2015 diff --git a/test/output/seattlePrecipitationSum.svg b/test/output/seattlePrecipitationSum.svg index 81d7fbd84d..da4dfb089c 100644 --- a/test/output/seattlePrecipitationSum.svg +++ b/test/output/seattlePrecipitationSum.svg @@ -13,84 +13,66 @@ white-space: pre; } - - - 0 - - - 10 - - - 20 - - - 30 - - - 40 - - - 50 - - - 60 - - - 70 - - - 80 - - - 90 - - - 100 - - - 110 - - - 120 - - - 130 - ↑ precipitation + + + + + + + + + + + + + + + - - - Fri 11 - - - Dec 13 - - - Tue 15 - - - Thu 17 - - - Sat 19 - - - Mon 21 - - - Wed 23 - - - Fri 25 - - - Dec 27 - - - Tue 29 - - - Thu 31 - + + 0 + 10 + 20 + 30 + 40 + 50 + 60 + 70 + 80 + 90 + 100 + 110 + 120 + 130 + + + ↑ precipitation + + + + + + + + + + + + + + + + Fri 11 + Dec 13 + Tue 15 + Thu 17 + Sat 19 + Mon 21 + Wed 23 + Fri 25 + Dec 27 + Tue 29 + Thu 31 @@ -122,7 +104,30 @@ - 133132132122954232456347507780836351515529251816 + + 133 + 132 + 132 + 122 + 95 + 42 + 32 + 45 + 63 + 47 + 50 + 77 + 80 + 83 + 63 + 51 + 51 + 55 + 29 + 25 + 18 + 16 + diff --git a/test/output/seattleTemperatureBand.svg b/test/output/seattleTemperatureBand.svg index 20868228d2..3570599b10 100644 --- a/test/output/seattleTemperatureBand.svg +++ b/test/output/seattleTemperatureBand.svg @@ -13,53 +13,50 @@ white-space: pre; } - - - - 20 - - - - 30 - - - - 40 - - - - 50 - - - - 60 - - - - 70 - - - - 80 - - - - 90 - ↑ Temperature (°F) + + + + + + + + + - - - 2012 - - - 2013 - - - 2014 - - - 2015 - + + + + + + + + + + + + 20 + 30 + 40 + 50 + 60 + 70 + 80 + 90 + + + ↑ Temperature (°F) + + + + + + + + + 2012 + 2013 + 2014 + 2015 diff --git a/test/output/seattleTemperatureCell.svg b/test/output/seattleTemperatureCell.svg index b27adfa1e8..d0f7affe2c 100644 --- a/test/output/seattleTemperatureCell.svg +++ b/test/output/seattleTemperatureCell.svg @@ -13,138 +13,99 @@ white-space: pre; } - - - J - - - F - - - M - - - A - - - M - - - J - - - J - - - A - - - S - - - O - - - N - - - D - + + + + + + + + + + + + + - - - 1 - - - 2 - - - 3 - - - 4 - - - 5 - - - 6 - - - 7 - - - 8 - - - 9 - - - 10 - - - 11 - - - 12 - - - 13 - - - 14 - - - 15 - - - 16 - - - 17 - - - 18 - - - 19 - - - 20 - - - 21 - - - 22 - - - 23 - - - 24 - - - 25 - - - 26 - - - 27 - - - 28 - - - 29 - - - 30 - - - 31 - + + J + F + M + A + M + J + J + A + S + O + N + D + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 1 + 2 + 3 + 4 + 5 + 6 + 7 + 8 + 9 + 10 + 11 + 12 + 13 + 14 + 15 + 16 + 17 + 18 + 19 + 20 + 21 + 22 + 23 + 24 + 25 + 26 + 27 + 28 + 29 + 30 + 31 diff --git a/test/output/sfCovidDeaths.svg b/test/output/sfCovidDeaths.svg index 3889510e90..54bb86183c 100644 --- a/test/output/sfCovidDeaths.svg +++ b/test/output/sfCovidDeaths.svg @@ -13,57 +13,51 @@ white-space: pre; } - - - 0 - - - 5 - - - 10 - - - 15 - - - 20 - - - 25 - - - 30 - - - 35 - - - 40 - - - 45 - ↑ case_count + + + + + + + + + + + - - - April - - - July - - - October - - - 2021 - - - April - - - July - specimen_collection_date → + + 0 + 5 + 10 + 15 + 20 + 25 + 30 + 35 + 40 + 45 + + + ↑ case_count + + + + + + + + + + + April + July + October + 2021 + April + July + + + specimen_collection_date → diff --git a/test/output/sfTemperatureBand.svg b/test/output/sfTemperatureBand.svg index 03d1551f24..5538505657 100644 --- a/test/output/sfTemperatureBand.svg +++ b/test/output/sfTemperatureBand.svg @@ -13,72 +13,63 @@ white-space: pre; } - - - - 40 - - - - 45 - - - - 50 - - - - 55 - - - - 60 - - - - 65 - - - - 70 - - - - 75 - - - - 80 - ↑ Daily temperature range (°F) + + + + + + + + + + - - - October - - - 2011 - - - April - - - July - - - October - - - 2012 - - - April - - - July - - - October - + + + + + + + + + + + + + 40 + 45 + 50 + 55 + 60 + 65 + 70 + 75 + 80 + + + ↑ Daily temperature range (°F) + + + + + + + + + + + + + + October + 2011 + April + July + October + 2012 + April + July + October diff --git a/test/output/sfTemperatureBandArea.svg b/test/output/sfTemperatureBandArea.svg index ead5278e8c..c109fd42ac 100644 --- a/test/output/sfTemperatureBandArea.svg +++ b/test/output/sfTemperatureBandArea.svg @@ -13,96 +13,81 @@ white-space: pre; } - - - - 42 - - - - 44 - - - - 46 - - - - 48 - - - - 50 - - - - 52 - - - - 54 - - - - 56 - - - - 58 - - - - 60 - - - - 62 - - - - 64 - - - - 66 - - - - 68 - - - - 70 - ↑ Daily temperature range (°F) + + + + + + + + + + + + + + + + - - - October - - - 2011 - - - April - - - July - - - October - - - 2012 - - - April - - - July - - - October - + + + + + + + + + + + + + + + + + + + 42 + 44 + 46 + 48 + 50 + 52 + 54 + 56 + 58 + 60 + 62 + 64 + 66 + 68 + 70 + + + ↑ Daily temperature range (°F) + + + + + + + + + + + + + + October + 2011 + April + July + October + 2012 + April + July + October diff --git a/test/output/shorthandArea.svg b/test/output/shorthandArea.svg index 0a99ae9b25..ad3565ece5 100644 --- a/test/output/shorthandArea.svg +++ b/test/output/shorthandArea.svg @@ -13,60 +13,47 @@ white-space: pre; } - - - 0 - - - 20 - - - 40 - - - 60 - - - 80 - - - 100 - - - 120 - - - 140 - - - 160 - + + + + + + + + + + - - - Jan 07 - - - Jan 14 - - - Jan 21 - - - Jan 28 - - - Feb 04 - - - Feb 11 - - - Feb 18 - - - Feb 25 - + + 0 + 20 + 40 + 60 + 80 + 100 + 120 + 140 + 160 + + + + + + + + + + + + + Jan 07 + Jan 14 + Jan 21 + Jan 28 + Feb 04 + Feb 11 + Feb 18 + Feb 25 diff --git a/test/output/shorthandAreaY.svg b/test/output/shorthandAreaY.svg index 4a91f46cc4..7ae7324127 100644 --- a/test/output/shorthandAreaY.svg +++ b/test/output/shorthandAreaY.svg @@ -13,60 +13,47 @@ white-space: pre; } - - - 0 - - - 20 - - - 40 - - - 60 - - - 80 - - - 100 - - - 120 - - - 140 - - - 160 - + + + + + + + + + + - - - 0 - - - 5 - - - 10 - - - 15 - - - 20 - - - 25 - - - 30 - - - 35 - + + 0 + 20 + 40 + 60 + 80 + 100 + 120 + 140 + 160 + + + + + + + + + + + + + 0 + 5 + 10 + 15 + 20 + 25 + 30 + 35 diff --git a/test/output/shorthandBarY.svg b/test/output/shorthandBarY.svg index 107b61b2df..78963152ca 100644 --- a/test/output/shorthandBarY.svg +++ b/test/output/shorthandBarY.svg @@ -13,156 +13,111 @@ white-space: pre; } - - - 0 - - - 20 - - - 40 - - - 60 - - - 80 - - - 100 - - - 120 - - - 140 - - - 160 - + + + + + + + + + + - - - 0 - - - 1 - - - 2 - - - 3 - - - 4 - - - 5 - - - 6 - - - 7 - - - 8 - - - 9 - - - 10 - - - 11 - - - 12 - - - 13 - - - 14 - - - 15 - - - 16 - - - 17 - - - 18 - - - 19 - - - 20 - - - 21 - - - 22 - - - 23 - - - 24 - - - 25 - - - 26 - - - 27 - - - 28 - - - 29 - - - 30 - - - 31 - - - 32 - - - 33 - - - 34 - - - 35 - - - 36 - - - 37 - - - 38 - - - 39 - + + 0 + 20 + 40 + 60 + 80 + 100 + 120 + 140 + 160 + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 0 + 1 + 2 + 3 + 4 + 5 + 6 + 7 + 8 + 9 + 10 + 11 + 12 + 13 + 14 + 15 + 16 + 17 + 18 + 19 + 20 + 21 + 22 + 23 + 24 + 25 + 26 + 27 + 28 + 29 + 30 + 31 + 32 + 33 + 34 + 35 + 36 + 37 + 38 + 39 diff --git a/test/output/shorthandBinRectY.svg b/test/output/shorthandBinRectY.svg index 30272f7118..7939b9b7e0 100644 --- a/test/output/shorthandBinRectY.svg +++ b/test/output/shorthandBinRectY.svg @@ -13,57 +13,48 @@ white-space: pre; } - - - 0 - - - 2 - - - 4 - - - 6 - - - 8 - - - 10 - - - 12 - - - 14 - - - 16 - ↑ Frequency + + + + + + + + + + - - - 150 - - - 155 - - - 160 - - - 165 - - - 170 - - - 175 - - - 180 - + + 0 + 2 + 4 + 6 + 8 + 10 + 12 + 14 + 16 + + + ↑ Frequency + + + + + + + + + + + + 150 + 155 + 160 + 165 + 170 + 175 + 180 diff --git a/test/output/shorthandBoxX.svg b/test/output/shorthandBoxX.svg index 71c26b77b2..1fb9925595 100644 --- a/test/output/shorthandBoxX.svg +++ b/test/output/shorthandBoxX.svg @@ -13,22 +13,19 @@ white-space: pre; } - - - 155 - - - 160 - - - 165 - - - 170 - - - 175 - + + + + + + + + + 155 + 160 + 165 + 170 + 175 diff --git a/test/output/shorthandCell.svg b/test/output/shorthandCell.svg index 4721f7de92..5a3ac01698 100644 --- a/test/output/shorthandCell.svg +++ b/test/output/shorthandCell.svg @@ -13,51 +13,41 @@ white-space: pre; } - - - Ava - - - Emma - - - Jacob - - - Mason - - - Mia - - - Noah - - - Olivia - + + + + + + + + - - - Ava - - - Emma - - - Jacob - - - Mason - - - Mia - - - Noah - - - Olivia - + + Ava + Emma + Jacob + Mason + Mia + Noah + Olivia + + + + + + + + + + + + Ava + Emma + Jacob + Mason + Mia + Noah + Olivia diff --git a/test/output/shorthandCellX.svg b/test/output/shorthandCellX.svg index e59faec337..3a06ee8840 100644 --- a/test/output/shorthandCellX.svg +++ b/test/output/shorthandCellX.svg @@ -13,127 +13,89 @@ white-space: pre; } - - - 0 - - - 1 - - - 2 - - - 3 - - - 4 - - - 5 - - - 6 - - - 7 - - - 8 - - - 9 - - - 10 - - - 11 - - - 12 - - - 13 - - - 14 - - - 15 - - - 16 - - - 17 - - - 18 - - - 19 - - - 20 - - - 21 - - - 22 - - - 23 - - - 24 - - - 25 - - - 26 - - - 27 - - - 28 - - - 29 - - - 30 - - - 31 - - - 32 - - - 33 - - - 34 - - - 35 - - - 36 - - - 37 - - - 38 - - - 39 - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 0 + 1 + 2 + 3 + 4 + 5 + 6 + 7 + 8 + 9 + 10 + 11 + 12 + 13 + 14 + 15 + 16 + 17 + 18 + 19 + 20 + 21 + 22 + 23 + 24 + 25 + 26 + 27 + 28 + 29 + 30 + 31 + 32 + 33 + 34 + 35 + 36 + 37 + 38 + 39 diff --git a/test/output/shorthandDot.svg b/test/output/shorthandDot.svg index 540bd30a92..f9548f1faf 100644 --- a/test/output/shorthandDot.svg +++ b/test/output/shorthandDot.svg @@ -13,69 +13,53 @@ white-space: pre; } - - - 156 - - - 158 - - - 160 - - - 162 - - - 164 - - - 166 - - - 168 - - - 170 - - - 172 - - - 174 - - - 176 - - - 178 - + + + + + + + + + + + + + - - - Jan 07 - - - Jan 14 - - - Jan 21 - - - Jan 28 - - - Feb 04 - - - Feb 11 - - - Feb 18 - - - Feb 25 - + + 156 + 158 + 160 + 162 + 164 + 166 + 168 + 170 + 172 + 174 + 176 + 178 + + + + + + + + + + + + + Jan 07 + Jan 14 + Jan 21 + Jan 28 + Feb 04 + Feb 11 + Feb 18 + Feb 25 diff --git a/test/output/shorthandDotX.svg b/test/output/shorthandDotX.svg index c0c381f7c8..0c82a0b018 100644 --- a/test/output/shorthandDotX.svg +++ b/test/output/shorthandDotX.svg @@ -13,22 +13,19 @@ white-space: pre; } - - - 155 - - - 160 - - - 165 - - - 170 - - - 175 - + + + + + + + + + 155 + 160 + 165 + 170 + 175 diff --git a/test/output/shorthandGroupBarY.svg b/test/output/shorthandGroupBarY.svg index 6c0bc3775d..bb70558f4a 100644 --- a/test/output/shorthandGroupBarY.svg +++ b/test/output/shorthandGroupBarY.svg @@ -13,45 +13,40 @@ white-space: pre; } - - - 0 - - - 5 - - - 10 - - - 15 - - - 20 - - - 25 - - - 30 - - - 35 - ↑ Frequency + + + + + + + + + - - - A - - - C - - - G - - - T - + + 0 + 5 + 10 + 15 + 20 + 25 + 30 + 35 + + + ↑ Frequency + + + + + + + + + A + C + G + T diff --git a/test/output/shorthandLine.svg b/test/output/shorthandLine.svg index 5739a5d495..ccfa5c0ed0 100644 --- a/test/output/shorthandLine.svg +++ b/test/output/shorthandLine.svg @@ -13,69 +13,53 @@ white-space: pre; } - - - 156 - - - 158 - - - 160 - - - 162 - - - 164 - - - 166 - - - 168 - - - 170 - - - 172 - - - 174 - - - 176 - - - 178 - + + + + + + + + + + + + + - - - Jan 07 - - - Jan 14 - - - Jan 21 - - - Jan 28 - - - Feb 04 - - - Feb 11 - - - Feb 18 - - - Feb 25 - + + 156 + 158 + 160 + 162 + 164 + 166 + 168 + 170 + 172 + 174 + 176 + 178 + + + + + + + + + + + + + Jan 07 + Jan 14 + Jan 21 + Jan 28 + Feb 04 + Feb 11 + Feb 18 + Feb 25 diff --git a/test/output/shorthandLineY.svg b/test/output/shorthandLineY.svg index 7577ca9a83..7c4e85f2a9 100644 --- a/test/output/shorthandLineY.svg +++ b/test/output/shorthandLineY.svg @@ -13,69 +13,53 @@ white-space: pre; } - - - 156 - - - 158 - - - 160 - - - 162 - - - 164 - - - 166 - - - 168 - - - 170 - - - 172 - - - 174 - - - 176 - - - 178 - + + + + + + + + + + + + + - - - 0 - - - 5 - - - 10 - - - 15 - - - 20 - - - 25 - - - 30 - - - 35 - + + 156 + 158 + 160 + 162 + 164 + 166 + 168 + 170 + 172 + 174 + 176 + 178 + + + + + + + + + + + + + 0 + 5 + 10 + 15 + 20 + 25 + 30 + 35 diff --git a/test/output/shorthandRectY.svg b/test/output/shorthandRectY.svg index 0a9be353d5..1bef704fb1 100644 --- a/test/output/shorthandRectY.svg +++ b/test/output/shorthandRectY.svg @@ -13,63 +13,49 @@ white-space: pre; } - - - 0 - - - 20 - - - 40 - - - 60 - - - 80 - - - 100 - - - 120 - - - 140 - - - 160 - + + + + + + + + + + - - - 0 - - - 5 - - - 10 - - - 15 - - - 20 - - - 25 - - - 30 - - - 35 - - - 40 - + + 0 + 20 + 40 + 60 + 80 + 100 + 120 + 140 + 160 + + + + + + + + + + + + + + 0 + 5 + 10 + 15 + 20 + 25 + 30 + 35 + 40 diff --git a/test/output/shorthandRuleX.svg b/test/output/shorthandRuleX.svg index 5313fac52f..d56158ddab 100644 --- a/test/output/shorthandRuleX.svg +++ b/test/output/shorthandRuleX.svg @@ -13,22 +13,19 @@ white-space: pre; } - - - 155 - - - 160 - - - 165 - - - 170 - - - 175 - + + + + + + + + + 155 + 160 + 165 + 170 + 175 diff --git a/test/output/shorthandText.svg b/test/output/shorthandText.svg index 297548d1fc..7e8b1a4bbe 100644 --- a/test/output/shorthandText.svg +++ b/test/output/shorthandText.svg @@ -13,69 +13,94 @@ white-space: pre; } - - - 156 - - - 158 - - - 160 - - - 162 - - - 164 - - - 166 - - - 168 - - - 170 - - - 172 - - - 174 - - - 176 - - - 178 - + + + + + + + + + + + + + - - - Jan 07 - - - Jan 14 - - - Jan 21 - - - Jan 28 - - - Feb 04 - - - Feb 11 - - - Feb 18 - - - Feb 25 - + + 156 + 158 + 160 + 162 + 164 + 166 + 168 + 170 + 172 + 174 + 176 + 178 + + + + + + + + + + + + + Jan 07 + Jan 14 + Jan 21 + Jan 28 + Feb 04 + Feb 11 + Feb 18 + Feb 25 + + + 0 + 1 + 2 + 3 + 4 + 5 + 6 + 7 + 8 + 9 + 10 + 11 + 12 + 13 + 14 + 15 + 16 + 17 + 18 + 19 + 20 + 21 + 22 + 23 + 24 + 25 + 26 + 27 + 28 + 29 + 30 + 31 + 32 + 33 + 34 + 35 + 36 + 37 + 38 + 39 - 0123456789101112131415161718192021222324252627282930313233343536373839 \ No newline at end of file diff --git a/test/output/shorthandTextX.svg b/test/output/shorthandTextX.svg index 1b4a802332..a660a8a552 100644 --- a/test/output/shorthandTextX.svg +++ b/test/output/shorthandTextX.svg @@ -13,22 +13,60 @@ white-space: pre; } - - - 155 - - - 160 - - - 165 - - - 170 - - - 175 - + + + + + + + + + 155 + 160 + 165 + 170 + 175 + + + 170.16 + 172.53 + 172.54 + 173.44 + 174.35 + 174.55 + 173.16 + 174.59 + 176.18 + 177.9 + 176.15 + 179.37 + 178.61 + 177.3 + 177.3 + 177.25 + 174.51 + 172 + 170.16 + 165.53 + 166.87 + 167.17 + 166 + 159.1 + 154.83 + 163.09 + 160.29 + 157.07 + 158.5 + 161.95 + 163.04 + 169.79 + 172.36 + 172.05 + 172.83 + 171.8 + 173.67 + 176.35 + 179.1 + 179.26 - 170.16172.53172.54173.44174.35174.55173.16174.59176.18177.9176.15179.37178.61177.3177.3177.25174.51172170.16165.53166.87167.17166159.1154.83163.09160.29157.07158.5161.95163.04169.79172.36172.05172.83171.8173.67176.35179.1179.26 \ No newline at end of file diff --git a/test/output/shorthandTickX.svg b/test/output/shorthandTickX.svg index bad4c4b32a..836cc71ab8 100644 --- a/test/output/shorthandTickX.svg +++ b/test/output/shorthandTickX.svg @@ -13,22 +13,19 @@ white-space: pre; } - - - 155 - - - 160 - - - 165 - - - 170 - - - 175 - + + + + + + + + + 155 + 160 + 165 + 170 + 175 diff --git a/test/output/shorthandVector.svg b/test/output/shorthandVector.svg index 292bb30652..e96509c09e 100644 --- a/test/output/shorthandVector.svg +++ b/test/output/shorthandVector.svg @@ -13,69 +13,53 @@ white-space: pre; } - - - 156 - - - 158 - - - 160 - - - 162 - - - 164 - - - 166 - - - 168 - - - 170 - - - 172 - - - 174 - - - 176 - - - 178 - + + + + + + + + + + + + + - - - Jan 07 - - - Jan 14 - - - Jan 21 - - - Jan 28 - - - Feb 04 - - - Feb 11 - - - Feb 18 - - - Feb 25 - + + 156 + 158 + 160 + 162 + 164 + 166 + 168 + 170 + 172 + 174 + 176 + 178 + + + + + + + + + + + + + Jan 07 + Jan 14 + Jan 21 + Jan 28 + Feb 04 + Feb 11 + Feb 18 + Feb 25 diff --git a/test/output/shorthandVectorX.svg b/test/output/shorthandVectorX.svg index e50d9d2a4f..fc049ce01b 100644 --- a/test/output/shorthandVectorX.svg +++ b/test/output/shorthandVectorX.svg @@ -13,22 +13,19 @@ white-space: pre; } - - - 155 - - - 160 - - - 165 - - - 170 - - - 175 - + + + + + + + + + 155 + 160 + 165 + 170 + 175 diff --git a/test/output/simpsonsRatings.svg b/test/output/simpsonsRatings.svg index 0310c2974b..6c31142e2e 100644 --- a/test/output/simpsonsRatings.svg +++ b/test/output/simpsonsRatings.svg @@ -13,221 +13,182 @@ white-space: pre; } - - - - 1 - - - - 2 - - - - 3 - - - - 4 - - - - 5 - - - - 6 - - - - 7 - - - - 8 - - - - 9 - - - - 10 - - - - 11 - - - - 12 - - - - 13 - - - - 14 - - - - 15 - - - - 16 - - - - 17 - - - - 18 - - - - 19 - - - - 20 - - - - 21 - - - - 22 - - - - 23 - - - - 24 - - - - 25 - - - - 26 - - - - 27 - - - - 28 - Season + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - 1 - - - - 2 - - - - 3 - - - - 4 - - - - 5 - - - - 6 - - - - 7 - - - - 8 - - - - 9 - - - - 10 - - - - 11 - - - - 12 - - - - 13 - - - - 14 - - - - 15 - - - - 16 - - - - 17 - - - - 18 - - - - 19 - - - - 20 - - - - 21 - - - - 22 - - - - 23 - - - - 24 - - - - 25 - Episode + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 1 + 2 + 3 + 4 + 5 + 6 + 7 + 8 + 9 + 10 + 11 + 12 + 13 + 14 + 15 + 16 + 17 + 18 + 19 + 20 + 21 + 22 + 23 + 24 + 25 + 26 + 27 + 28 + + + Season + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 1 + 2 + 3 + 4 + 5 + 6 + 7 + 8 + 9 + 10 + 11 + 12 + 13 + 14 + 15 + 16 + 17 + 18 + 19 + 20 + 21 + 22 + 23 + 24 + 25 + + + Episode @@ -831,5 +792,606 @@ - 7.4Homer's Night Out8.3Krusty Gets Busted8.2Bart Gets an "F"8.1Two Cars in Every Garage and Three Eyes on Every Fish8.0Dead Putting Society8.4Bart the Daredevil7.8Bart Gets Hit by a Car8.0Homer vs. Lisa and the 8th Commandment8.2Oh Brother, Where Art Thou?7.6Old Money8.5Lisa's Substitute8.0Blood Feud7.7Mr. Lisa Goes to Washington8.7Bart the Murderer7.7Like Father, Like Clown7.9Saturdays of Thunder8.2Burns Verkaufen der Kraftwerk8.5Radio Bart8.3Bart the Lover8.2Separate Vocations7.9Colonel Homer7.8Bart's Friend Falls in Love8.4Kamp Krusty8.2Itchy & Scratchy: The Movie8.5Lisa's First Word8.0Selma's Choice7.9The Call of the Simpsons8.8One Fish, Two Fish, Blowfish, Blue Fish7.7Marge in Chains8.4Homer's Barbershop Quartet8.6Homer Goes to College8.0Marge on the Lam8.7Boy-Scoutz 'n the Hood8.2Homer the Vigilante8.1Bart Gets Famous8.2Lisa vs. Malibu Stacy7.9Bart Gets an Elephant7.5Lady Bouvier's Lover8.6Bart of Darkness8.5Itchy & Scratchy Land8.4Lisa on Ice7.8Fear of Flying8.5And Maggie Makes Three8.5Homie the Clown7.9Homer vs. Patty and Selma8.1Two Dozen and One Greyhounds8.3'Round Springfield8.6Lemon of Troy8.3Radioactive Man8.7Bart Sells His Soul8.5Treehouse of Horror VI8.3Marge Be Not Proud8.3Team Homer7.7Bart the Fink8.2New Kid on the Block8.822 Short Films About Springfield8.0Much Apu About Nothing8.3Summer of 4 Ft. 27.7Burns, Baby Burns7.8Lisa's Date with Density9.0The Springfield Files7.8The Twisted World of Marge Simpson7.9The Itchy & Scratchy & Poochie Show8.9Homer's Phobia8.7Homer vs. the Eighteenth Amendment7.7The Canine Mutiny8.0In Marge We Trust7.8The Secret War of Lisa Simpson7.4The Principal and the Pauper7.7Bart Star8.0Lisa the Skeptic5.1All Singing, All Dancing8.2The Joy of Sect7.8This Little Wiggy7.9The Trouble with Trillions8.5Trash of the Titans8.1Natural Born Kissers8.2The Wizard of Evergreen Terrace8.0Treehouse of Horror IX8.2Mayored to the Mob7.7Wild Barts Can't Be Broken7.5Make Room for Lisa7.6Mom and Pop Art7.2Monty Can't Buy Me Love7.9Thirty Minutes over Tokyo7.5Guess Who's Coming to Criticize Dinner?7.6E-I-E-I-(Annoyed Grunt)7.1Eight Misbehavin'7.3The Mansion Family7.9Alone Again, Natura-diddily7.3Pygmoelian6.6Kill the Alligator and Run7.3It's a Mad, Mad, Mad, Mad Marge7.6Treehouse of Horror XI7.1Insane Clown Poppy7.7The Computer Wore Menace Shoes7.3Pokey Mom7.2Day of the Jackanapes7.4Hungry, Hungry Homer6.9Simpson Safari7.3Children of a Lesser Clod7.5Treehouse of Horror XII7.2Homer the Moe7.7The Blunder Years7.5Half-Decent Proposal6.5The Lastest Gun in the West7.0Blame It on Lisa5.6Gump Roast8.7Homer's Triple Bypass7.0Bart vs. Lisa vs. the Third Grade7.3The Great Louse Detective7.3The Dad Who Knew Too Little6.8Pray Anything7.3C.E.D'oh7.2Three Gays of the Condo6.9Brake My Wife, Please7.7Moe Baby Blues7.3My Mother the Carjacker7.2The Fat and the Furriest7.2'Tis the Fifteenth Season7.3I, (Annoyed Grunt)-bot7.1Smart & Smarter6.9Co-Dependents' Day7.0Catch 'Em If You Can7.3The Way We Weren't7.2Fraudcast News7.1Sleeping with the Enemy7.1Fat Man and Little Boy7.0Mommie Beerest7.1There's Something About Marrying7.0Goo Goo Gai Pan6.9The Seven-Beer Snitch7.2The Heartbroke Kid7.3Thank God It's Doomsday6.3The Bonfire of the Manatees8.3Duffless6.7The Last of the Red Hat Mamas6.9Simpsons Christmas Stories6.4My Fair Laddy7.0Bart Has Two Mommies6.6Million-Dollar Abie6.7Regarding Margie7.5The Mook, the Chef, the Wife and Her Homer6.8Please Homer, Don't Hammer 'Em6.9G.I. (Annoyed Grunt)7.0Ice Cream of Margie (with the Light Blue Hair)6.4Kill Gil, Volumes I & II7.0Little Big Girl7.1Yokel Chords7.2Homerazzi7.1Crook and Ladder8.124 Minutes6.7The Homer of Seville6.7Little Orphan Millie7.1Funeral for a Fiend6.9E Pluribus Wiggum7.7The Debarted6.7Smoke on the Daughter6.9Apocalypse Cow7.1Mona Leaves-a6.9Lost Verizon7.1Treehouse of Horror XIX7.2So It's Come to This: A Simpsons Clip Show7.2Gone Maggie Gone7.0Father Knows Worst6.3Four Great Women and a Manicure7.1Homer the Whopper6.8Rednecks and Broomsticks6.8Thursdays with Abie7.1Million Dollar Maybe7.1Postcards from the Wedge5.7The Greatest Story Ever D'ohed6.9Moe Letter Blues6.6Judge Me Tender6.8Loan-a Lisa7.2Lisa Simpson, This Isn't Your Life6.9The Fight Before Christmas7.0Donnie Fatso7.0Homer the Father7.2Angry Dad: The Movie6.1A Midsummer's Nice Dream7.0The Great Simpsina7.3500 Keys7.2The Falcon and the D'ohman6.6Treehouse of Horror XXII7.2The Food Wife6.2The Ten-Per-Cent Solution6.1Politically Inept, with Homer Simpson5.7Moe Goes from Rags to Riches6.7Pranks and Greens8.5$pringfield (or, How I Learned to Stop Worrying and Love Legalized Gambling)7.1Beware My Cheating Bart6.9The Spy Who Learned Me4.5Lisa Goes Gaga6.3Penny-Wiseguys7.2To Cur with Love7.0A Test Before Trying6.5Love is a Many-Splintered Thing6.2Gorgeous Grampa6.5What Animated Women Want6.8Whiskey Business7.0Homerland6.7YOLO6.5The Kid Is All Right6.5White Christmas Blues7.2Specs and the City6.7The Man Who Grew Too Much7.0The War of Art6.5Luca$7.7Brick Like Me6.7The Yellow Badge of Cowardge6.9The Wreck of the Relationship6.3Opposites A-Frack6.9Blazed and Confused6.8The Man Who Came to Be Dinner5.8The Musk Who Fell to Earth6.7Peeping Mom7.5Life on the Fast Lane7.8The Crepes of Wrath7.9Some Enchanted Evening8.3Simpson and Delilah8.2Treehouse of Horror7.5Dancin' Homer7.7Bart vs. Thanksgiving8.1Itchy & Scratchy & Marge8.2The Way We Was7.5Principal Charming7.5Bart's Dog Gets an "F"7.9The War of the Simpsons6.8Bull-E6.7Cue Detective6.8Friend with Benefit8.4Barthood6.8Teenage Mutant Milk-Caused Hurdles-Friends and Family"[203]-The Town"[205]-Treehouse of Horror XXVII"[207]6.6Gal of Constant Sorrow7.3The Marge-ian Chronicles7.1Fland Canyon6.4Simprovised8.2Simpsons Roasting on an Open Fire7.8Bart the Genius7.8There's No Disgrace Like Home7.6Moaning Lisa7.7The Telltale Head8.4Three Men and a Comic Book8.6Stark Raving Dad8.2When Flanders Failed8.5Homer Defined8.1The Front8.1Brother from the Same Planet8.7Treehouse of Horror IV9.0Marge vs. the Monorail8.3I Love Lisa8.4The Last Temptation of Homer7.7Dog of Death8.2Treehouse of Horror II7.9Lisa's Pony7.8Marge Gets a Job8.2I Married Marge9.0Last Exit to Springfield8.0Lisa the Greek7.7The Otto Show8.9Rosebud8.0Homer Alone8.6Homer at the Bat8.1Whacking Day7.8Lisa the Beauty Queen8.2Krusty Gets Kancelled8.2Black Widower8.1A Streetcar Named Marge8.4Treehouse of Horror III8.8Mr. Plow8.3Homer and Apu8.5Homer Loves Flanders8.4Burns' Heir8.0Sideshow Bob's Last Gleaming8.0Grampa vs. Sexual Inadequacy8.2A Fish Called Selma8.6Bart's Comet8.3Home Sweet Homediddly-Dum-Doodily7.7Scenes from the Class Struggle in Springfield8.5Bart vs. Australia9.0King-Size Homer8.0Secrets of a Successful Marriage8.1Lisa's Rival8.5A Star Is Burns8.3Lisa's Wedding6.0Another Simpsons Clip Show8.5Lisa the Vegetarian8.1The PTA Disbands8.3Sideshow Bob Roberts8.0Bart's Girlfriend8.9Who Shot Mr. Burns? (Part Two)8.2The Springfield Connection8.9Homer the Smithers9.0Homer Badman8.9Homer the Great7.5The Simpsons 138th Episode Spectacular8.7Two Bad Neighbors8.1Lisa the Iconoclast8.5Mother Simpson8.3Raging Abe Simpson and His Grumbling Grandson in "The Curse of the Flying Hellfish"8.0Homerpalooza8.1Lisa's Sax7.7Simpsoncalifragilisticexpiala(Annoyed Grunt)cious8.3Treehouse of Horror VII8.2Brother from Another Series8.0The Homer They Fall8.2Bart After Dark7.7Lost Our Lisa7.9Girly Edition7.5Realty Bites7.9The Old Man and the Lisa8.0A Milhouse Divided8.1My Sister, My Sitter7.5The Last Temptation of Krust8.2The Cartridge Family8.2Grade School Confidential8.8Hurricane Neddy8.3Simpson Tide7.3The Simpsons Spin-Off Showcase9.1The City of New York vs. Homer Simpson7.6Miracle on Evergreen Terrace8.3King of the Hill8.1Das Bus7.6Lard of the Dance7.7Bart Carny8.0Lisa the Simpson8.0The Day the Violence Died7.3When You Dish Upon a Star8.0Lisa Gets an "A"7.3Homer Simpson in: "Kidney Trouble"7.2Lisa the Tree Hugger6.9Sunday, Cruddy Sunday7.6Maximum Homerdrive7.3Hello Gutter, Hello Fadder7.3Simpsons Bible Stories6.9Tennis the Menace7.8Viva Ned Flanders7.7Treehouse of Horror X7.2Last Tap Dance in Springfield7.5Brother's Little Helper7.3The Old Man and the "C" Student7.0Bart to the Future7.3Beyond Blunderdome7.3They Saved Lisa's Brain7.7Homer to the Max7.1Take My Wife, Sleaze7.3Little Big Mom6.9Faith Off7.5Worst Episode Ever6.6Saddlesore Galactica7.9Behind the Laughter7.3The Great Money Caper7.3Missionary: Impossible7.4Days of Wine and D'oh'ses8.6Bart on the Road6.5Bye, Bye, Nerdie7.3I'm Goin' to Praiseland7.0Simpsons Tall Tales7.7I Am Furious (Yellow)6.9The Sweetest Apu7.0The President Wore Pearls7.1The Parent Rap7.7Weekend at Burnsie's7.1Large Marge7.1The Bart Wants What It Wants6.9Mr. Spritz Goes to Washington7.2A Hunka Hunka Burns in Love7.3How I Spent My Strummer Vacation7.1She of Little Faith6.8Helter Shelter7.3Tales from the Public Domain6.9The Strong Arms of the Ma6.9Brawl in the Family7.3Jaws Wired Shut7.2Little Girl in the Big Ten6.8Old Yeller-Belly7.1Special Edna6.6Barting Over7.0Dude, Where's My Ranch?6.6The Bart of War7.4Treehouse of Horror XIV8.6Mountain of Madness6.6Today I Am a Clown6.7Marge vs. Singles, Seniors, Childless Couples and Teens and Gays7.3Diatribe of a Mad Housewife7.0All's Fair in Oven War6.2Bart-Mangled Banner6.8A Star Is Torn6.9See Homer Run7.3Milhouse Doesn't Live Here Anymore6.9The Ziff Who Came to Dinner6.4Homer and Ned's Hail Mary Pass6.9The Girl Who Slept Too Little6.9The Wandering Juvie7.0Milhouse of Sand and Fog7.3Treehouse of Horror XVI6.7Homer's Paternity Coot6.6She Used to Be My Girl6.7My Big Fat Geek Wedding7.3Future-Drama7.0The Italian Bob7.3Simple Simpson7.0We're on the Road to D'ohwhere6.9On a Clear Day I Can't See My Sister7.1Home Away from Homer7.4Treehouse of Horror XV7.3Midnight Rx6.8Pranksta Rap7.6Dumbbell Indemnity7.2Girls Just Want to Have Sums7.1The Monkey Suit6.3The Boys of Bummer7.1Treehouse of Horror XVIII6.3Rome-Old and Juli-Eh6.1Papa Don't Leech6.6Marge and Homer Turn a Couple Play6.6The Wife Aquatic7.0Double, Double, Boy in Trouble7.1Treehouse of Horror XVII6.3That '90s Show6.6The Burns and the Bees6.8Moe'N'a Lisa7.2The Haw-Hawed Couple7.1Husbands and Knives6.4All About Lisa7.3You Kent Always Say What You Want6.6Dangerous Curves7.3Springfield Up7.0Revenge Is a Dish Best Served Three Times7.3Marge Gamer7.0Stop! Or My Dog Will Shoot7.3Dial 'N' for Nerder6.6Love, Springfieldian Style7.1MyPods and Boomsticks7.2Sex, Pies and Idiot Scrapes7.0Any Given Sundance7.5Bart the Mother7.0Take My Life, Please7.0No Loan Again, Naturally6.3Elementary School Musical7.1Waverly Hills, 9-0-2-1-D'oh7.2The Bob Next Door7.2The Good, the Sad and the Drugly6.7Once Upon a Time in Springfield6.6Bart Gets a 'Z'7.2Eeny Teeny Maya Moe6.9Chief of Hearts6.3The Great Wife Hope7.2To Surveil with Love6.7The Scorpion's Tale6.9The Blue and the Gray6.6The Color Yellow6.5The Fool Monty7.2O Brother, Where Bart Thou?6.8Boy Meets Curl6.5Love Is a Many Strangled Thing6.7The Devil Wears Nada7.2Homer Scissorhands7.0Stealing First Base6.4How Munched is That Birdie in the Window?6.6The Real Housewives of Fat Tony6.3Moms I'd Like to Forget6.8MoneyBart6.9Flaming Moe7.3I'm with Cupid7.0Bart Stops to Smell the Roosevelts6.7Replaceable You7.0The D'oh-cial Network7.1Married to the Blob6.7Ned 'n Edna's Blend6.7Gone Abie Gone6.9Homer Goes to Prep School6.5Four Regrettings and a Funeral7.0Yellow Subterfuge7.4A Totally Fun Thing That Bart Will Never Do Again7.8The Book Job6.5The Daughter Also Rises7.6Steal This Episode6.9Exit Through the Kwik-E-Mart7.0Black Eyed, Please7.1Them, Robot7.1Treehouse of Horror XXIV6.5Pulpit Friction6.6The Changing of the Guardian6.4Moonshine River6.5A Tree Grows in Springfield7.3Treehouse of Horror XXIII7.2The Day the Earth Stood Cool7.0Hardly Kirk-ing6.3The Fabulous Faker Boy7.1Labor Pains7.0Dangers on a Train7.3Marge Simpson in: "Screaming Yellow Honkers"6.6The Winter of His Content5.8What to Expect When Bart's Expecting6.5Covercraft6.3Walking Big & Tall6.8Treehouse of Horror XXVI6.6The Girl Code6.7Pay Pal5.9Every Man's Dream6.2Let's Go Fly a Coot6.7Waiting for Duffman6.3Lisa with an 'S'7.3Bart's New Friend6.3Love Is in the N2-O2-Ar-CO2-Ne-He-CH46.9The Kids Are All Fight6.9Sky Police5.8Clown in the Dumps6.5Super Franchise Me6.7Much Apu About Something6.8I Won't Be Home for Christmas7.3Treehouse of Horror XXV6.7My Fare Lady6.5The Burns Cage6.9Mathlete's Feat6.3Lisa the Veterinarian7.1Paths of Glory7.2Puffless8.0Brush with Greatness8.8Flaming Moe's8.1Bart the General8.2Brother, Can You Spare Two Dimes?9.0Homer the Heretic9.0Cape Feare7.7Bart's Inner Child8.8Deep Space Homer8.4Sweet Seymour Skinner's Baadasssss Song8.2The Boy Who Knew Too Much9.0Treehouse of Horror V9.1Who Shot Mr. Burns? (Part One)9.2You Only Move Twice8.5El Viaje Misterioso de Nuestro Jomer (The Mysterious Voyage of Homer)9.2Homer's Enemy8.1Treehouse of Horror VIII7.7The Two Mrs. Nahasapeemapetilons7.6D'oh-in' in the Wind8.0Skinner's Sense of Snow8.0HOMR8.6Trilogy of Error8.0Poppa's Got a Brand New Badge7.6Treehouse of Horror XIII8.2Holidays of Future Passed7.9Simpsorama7.5Halloween of Horror6.7To Courier with Love7.5Homer's Odyssey7.3Grift of the Magi7.4A Tale of Two Springfields7.2Homer vs. Dignity6.5The Old Man and the Key7.1'Scuse Me While I Miss the Sky7.1Margical History Tour7.0Mobile Homer7.4Don't Fear the Roofer7.4The Seemingly Never-Ending Story6.5Homer Simpson, This Is Your Wife6.7The Wettest Stories Ever Told7.2Midnight Towboy7.1Homer and Lisa Exchange Cross Words7.2Coming to Homerica7.3Treehouse of Horror XX6.7American History X-cellent6.9The Squirt and the Whale7.1Treehouse of Horror XXI6.8The Man in the Blue Flannel Pants7.1Dark Knight Court7.2The Saga of Carl6.9You Don't Have to Live Like a Referee6.6The Princess Guide6.4How Lisa Got Her Marge Back6.9Orange Is the New Yellow6.6Monty Burns' Fleeing Circus7.2New Kids on the Blecch7.0Sweets and Sour Marge7.1The Frying Game7.3I'm Spelling As Fast As I Can7.1A Star Is Born-Again7.1The Regina Monologues7.2The Father, the Son, and the Holy Guest Star6.9Marge's Son Poisoning7.2Kiss Kiss, Bang Bangalore6.7Jazzy and the Pussycats6.7He Loves to Fly and He D'ohs6.9I Don't Wanna Know Why the Caged Bird Sings8.2Eternal Moonshine of the Simpson Mind5.9Lisa the Drama Queen7.0How the Test Was Won6.3In the Name of the Grandfather6.8Wedding for Disaster7.0The Ned-Liest Catch7.0At Long Last Leave7.3How I Wet Your Mother6.9Adventures in Baby-Getting6.4Diggs7.0Days of Future Future + + 7.4Homer's Night Out + 8.3Krusty Gets Busted + 8.2Bart Gets an "F" + 8.1Two Cars in Every Garage and Three Eyes on Every Fish + 8.0Dead Putting Society + 8.4Bart the Daredevil + 7.8Bart Gets Hit by a Car + 8.0Homer vs. Lisa and the 8th Commandment + 8.2Oh Brother, Where Art Thou? + 7.6Old Money + 8.5Lisa's Substitute + 8.0Blood Feud + 7.7Mr. Lisa Goes to Washington + 8.7Bart the Murderer + 7.7Like Father, Like Clown + 7.9Saturdays of Thunder + 8.2Burns Verkaufen der Kraftwerk + 8.5Radio Bart + 8.3Bart the Lover + 8.2Separate Vocations + 7.9Colonel Homer + 7.8Bart's Friend Falls in Love + 8.4Kamp Krusty + 8.2Itchy & Scratchy: The Movie + 8.5Lisa's First Word + 8.0Selma's Choice + 7.9The Call of the Simpsons + 8.8One Fish, Two Fish, Blowfish, Blue Fish + 7.7Marge in Chains + 8.4Homer's Barbershop Quartet + 8.6Homer Goes to College + 8.0Marge on the Lam + 8.7Boy-Scoutz 'n the Hood + 8.2Homer the Vigilante + 8.1Bart Gets Famous + 8.2Lisa vs. Malibu Stacy + 7.9Bart Gets an Elephant + 7.5Lady Bouvier's Lover + 8.6Bart of Darkness + 8.5Itchy & Scratchy Land + 8.4Lisa on Ice + 7.8Fear of Flying + 8.5And Maggie Makes Three + 8.5Homie the Clown + 7.9Homer vs. Patty and Selma + 8.1Two Dozen and One Greyhounds + 8.3'Round Springfield + 8.6Lemon of Troy + 8.3Radioactive Man + 8.7Bart Sells His Soul + 8.5Treehouse of Horror VI + 8.3Marge Be Not Proud + 8.3Team Homer + 7.7Bart the Fink + 8.2New Kid on the Block + 8.822 Short Films About Springfield + 8.0Much Apu About Nothing + 8.3Summer of 4 Ft. 2 + 7.7Burns, Baby Burns + 7.8Lisa's Date with Density + 9.0The Springfield Files + 7.8The Twisted World of Marge Simpson + 7.9The Itchy & Scratchy & Poochie Show + 8.9Homer's Phobia + 8.7Homer vs. the Eighteenth Amendment + 7.7The Canine Mutiny + 8.0In Marge We Trust + 7.8The Secret War of Lisa Simpson + 7.4The Principal and the Pauper + 7.7Bart Star + 8.0Lisa the Skeptic + 5.1All Singing, All Dancing + 8.2The Joy of Sect + 7.8This Little Wiggy + 7.9The Trouble with Trillions + 8.5Trash of the Titans + 8.1Natural Born Kissers + 8.2The Wizard of Evergreen Terrace + 8.0Treehouse of Horror IX + 8.2Mayored to the Mob + 7.7Wild Barts Can't Be Broken + 7.5Make Room for Lisa + 7.6Mom and Pop Art + 7.2Monty Can't Buy Me Love + 7.9Thirty Minutes over Tokyo + 7.5Guess Who's Coming to Criticize Dinner? + 7.6E-I-E-I-(Annoyed Grunt) + 7.1Eight Misbehavin' + 7.3The Mansion Family + 7.9Alone Again, Natura-diddily + 7.3Pygmoelian + 6.6Kill the Alligator and Run + 7.3It's a Mad, Mad, Mad, Mad Marge + 7.6Treehouse of Horror XI + 7.1Insane Clown Poppy + 7.7The Computer Wore Menace Shoes + 7.3Pokey Mom + 7.2Day of the Jackanapes + 7.4Hungry, Hungry Homer + 6.9Simpson Safari + 7.3Children of a Lesser Clod + 7.5Treehouse of Horror XII + 7.2Homer the Moe + 7.7The Blunder Years + 7.5Half-Decent Proposal + 6.5The Lastest Gun in the West + 7.0Blame It on Lisa + 5.6Gump Roast + 8.7Homer's Triple Bypass + 7.0Bart vs. Lisa vs. the Third Grade + 7.3The Great Louse Detective + 7.3The Dad Who Knew Too Little + 6.8Pray Anything + 7.3C.E.D'oh + 7.2Three Gays of the Condo + 6.9Brake My Wife, Please + 7.7Moe Baby Blues + 7.3My Mother the Carjacker + 7.2The Fat and the Furriest + 7.2'Tis the Fifteenth Season + 7.3I, (Annoyed Grunt)-bot + 7.1Smart & Smarter + 6.9Co-Dependents' Day + 7.0Catch 'Em If You Can + 7.3The Way We Weren't + 7.2Fraudcast News + 7.1Sleeping with the Enemy + 7.1Fat Man and Little Boy + 7.0Mommie Beerest + 7.1There's Something About Marrying + 7.0Goo Goo Gai Pan + 6.9The Seven-Beer Snitch + 7.2The Heartbroke Kid + 7.3Thank God It's Doomsday + 6.3The Bonfire of the Manatees + 8.3Duffless + 6.7The Last of the Red Hat Mamas + 6.9Simpsons Christmas Stories + 6.4My Fair Laddy + 7.0Bart Has Two Mommies + 6.6Million-Dollar Abie + 6.7Regarding Margie + 7.5The Mook, the Chef, the Wife and Her Homer + 6.8Please Homer, Don't Hammer 'Em + 6.9G.I. (Annoyed Grunt) + 7.0Ice Cream of Margie (with the Light Blue Hair) + 6.4Kill Gil, Volumes I & II + 7.0Little Big Girl + 7.1Yokel Chords + 7.2Homerazzi + 7.1Crook and Ladder + 8.124 Minutes + 6.7The Homer of Seville + 6.7Little Orphan Millie + 7.1Funeral for a Fiend + 6.9E Pluribus Wiggum + 7.7The Debarted + 6.7Smoke on the Daughter + 6.9Apocalypse Cow + 7.1Mona Leaves-a + 6.9Lost Verizon + 7.1Treehouse of Horror XIX + 7.2So It's Come to This: A Simpsons Clip Show + 7.2Gone Maggie Gone + 7.0Father Knows Worst + 6.3Four Great Women and a Manicure + 7.1Homer the Whopper + 6.8Rednecks and Broomsticks + 6.8Thursdays with Abie + 7.1Million Dollar Maybe + 7.1Postcards from the Wedge + 5.7The Greatest Story Ever D'ohed + 6.9Moe Letter Blues + 6.6Judge Me Tender + 6.8Loan-a Lisa + 7.2Lisa Simpson, This Isn't Your Life + 6.9The Fight Before Christmas + 7.0Donnie Fatso + 7.0Homer the Father + 7.2Angry Dad: The Movie + 6.1A Midsummer's Nice Dream + 7.0The Great Simpsina + 7.3500 Keys + 7.2The Falcon and the D'ohman + 6.6Treehouse of Horror XXII + 7.2The Food Wife + 6.2The Ten-Per-Cent Solution + 6.1Politically Inept, with Homer Simpson + 5.7Moe Goes from Rags to Riches + 6.7Pranks and Greens + 8.5$pringfield (or, How I Learned to Stop Worrying and Love Legalized Gambling) + 7.1Beware My Cheating Bart + 6.9The Spy Who Learned Me + 4.5Lisa Goes Gaga + 6.3Penny-Wiseguys + 7.2To Cur with Love + 7.0A Test Before Trying + 6.5Love is a Many-Splintered Thing + 6.2Gorgeous Grampa + 6.5What Animated Women Want + 6.8Whiskey Business + 7.0Homerland + 6.7YOLO + 6.5The Kid Is All Right + 6.5White Christmas Blues + 7.2Specs and the City + 6.7The Man Who Grew Too Much + 7.0The War of Art + 6.5Luca$ + 7.7Brick Like Me + 6.7The Yellow Badge of Cowardge + 6.9The Wreck of the Relationship + 6.3Opposites A-Frack + 6.9Blazed and Confused + 6.8The Man Who Came to Be Dinner + 5.8The Musk Who Fell to Earth + 6.7Peeping Mom + 7.5Life on the Fast Lane + 7.8The Crepes of Wrath + 7.9Some Enchanted Evening + 8.3Simpson and Delilah + 8.2Treehouse of Horror + 7.5Dancin' Homer + 7.7Bart vs. Thanksgiving + 8.1Itchy & Scratchy & Marge + 8.2The Way We Was + 7.5Principal Charming + 7.5Bart's Dog Gets an "F" + 7.9The War of the Simpsons + 6.8Bull-E + 6.7Cue Detective + 6.8Friend with Benefit + 8.4Barthood + 6.8Teenage Mutant Milk-Caused Hurdles + -Friends and Family"[203] + -The Town"[205] + -Treehouse of Horror XXVII"[207] + 6.6Gal of Constant Sorrow + 7.3The Marge-ian Chronicles + 7.1Fland Canyon + 6.4Simprovised + 8.2Simpsons Roasting on an Open Fire + 7.8Bart the Genius + 7.8There's No Disgrace Like Home + 7.6Moaning Lisa + 7.7The Telltale Head + 8.4Three Men and a Comic Book + 8.6Stark Raving Dad + 8.2When Flanders Failed + 8.5Homer Defined + 8.1The Front + 8.1Brother from the Same Planet + 8.7Treehouse of Horror IV + 9.0Marge vs. the Monorail + 8.3I Love Lisa + 8.4The Last Temptation of Homer + 7.7Dog of Death + 8.2Treehouse of Horror II + 7.9Lisa's Pony + 7.8Marge Gets a Job + 8.2I Married Marge + 9.0Last Exit to Springfield + 8.0Lisa the Greek + 7.7The Otto Show + 8.9Rosebud + 8.0Homer Alone + 8.6Homer at the Bat + 8.1Whacking Day + 7.8Lisa the Beauty Queen + 8.2Krusty Gets Kancelled + 8.2Black Widower + 8.1A Streetcar Named Marge + 8.4Treehouse of Horror III + 8.8Mr. Plow + 8.3Homer and Apu + 8.5Homer Loves Flanders + 8.4Burns' Heir + 8.0Sideshow Bob's Last Gleaming + 8.0Grampa vs. Sexual Inadequacy + 8.2A Fish Called Selma + 8.6Bart's Comet + 8.3Home Sweet Homediddly-Dum-Doodily + 7.7Scenes from the Class Struggle in Springfield + 8.5Bart vs. Australia + 9.0King-Size Homer + 8.0Secrets of a Successful Marriage + 8.1Lisa's Rival + 8.5A Star Is Burns + 8.3Lisa's Wedding + 6.0Another Simpsons Clip Show + 8.5Lisa the Vegetarian + 8.1The PTA Disbands + 8.3Sideshow Bob Roberts + 8.0Bart's Girlfriend + 8.9Who Shot Mr. Burns? (Part Two) + 8.2The Springfield Connection + 8.9Homer the Smithers + 9.0Homer Badman + 8.9Homer the Great + 7.5The Simpsons 138th Episode Spectacular + 8.7Two Bad Neighbors + 8.1Lisa the Iconoclast + 8.5Mother Simpson + 8.3Raging Abe Simpson and His Grumbling Grandson in "The Curse of the Flying Hellfish" + 8.0Homerpalooza + 8.1Lisa's Sax + 7.7Simpsoncalifragilisticexpiala(Annoyed Grunt)cious + 8.3Treehouse of Horror VII + 8.2Brother from Another Series + 8.0The Homer They Fall + 8.2Bart After Dark + 7.7Lost Our Lisa + 7.9Girly Edition + 7.5Realty Bites + 7.9The Old Man and the Lisa + 8.0A Milhouse Divided + 8.1My Sister, My Sitter + 7.5The Last Temptation of Krust + 8.2The Cartridge Family + 8.2Grade School Confidential + 8.8Hurricane Neddy + 8.3Simpson Tide + 7.3The Simpsons Spin-Off Showcase + 9.1The City of New York vs. Homer Simpson + 7.6Miracle on Evergreen Terrace + 8.3King of the Hill + 8.1Das Bus + 7.6Lard of the Dance + 7.7Bart Carny + 8.0Lisa the Simpson + 8.0The Day the Violence Died + 7.3When You Dish Upon a Star + 8.0Lisa Gets an "A" + 7.3Homer Simpson in: "Kidney Trouble" + 7.2Lisa the Tree Hugger + 6.9Sunday, Cruddy Sunday + 7.6Maximum Homerdrive + 7.3Hello Gutter, Hello Fadder + 7.3Simpsons Bible Stories + 6.9Tennis the Menace + 7.8Viva Ned Flanders + 7.7Treehouse of Horror X + 7.2Last Tap Dance in Springfield + 7.5Brother's Little Helper + 7.3The Old Man and the "C" Student + 7.0Bart to the Future + 7.3Beyond Blunderdome + 7.3They Saved Lisa's Brain + 7.7Homer to the Max + 7.1Take My Wife, Sleaze + 7.3Little Big Mom + 6.9Faith Off + 7.5Worst Episode Ever + 6.6Saddlesore Galactica + 7.9Behind the Laughter + 7.3The Great Money Caper + 7.3Missionary: Impossible + 7.4Days of Wine and D'oh'ses + 8.6Bart on the Road + 6.5Bye, Bye, Nerdie + 7.3I'm Goin' to Praiseland + 7.0Simpsons Tall Tales + 7.7I Am Furious (Yellow) + 6.9The Sweetest Apu + 7.0The President Wore Pearls + 7.1The Parent Rap + 7.7Weekend at Burnsie's + 7.1Large Marge + 7.1The Bart Wants What It Wants + 6.9Mr. Spritz Goes to Washington + 7.2A Hunka Hunka Burns in Love + 7.3How I Spent My Strummer Vacation + 7.1She of Little Faith + 6.8Helter Shelter + 7.3Tales from the Public Domain + 6.9The Strong Arms of the Ma + 6.9Brawl in the Family + 7.3Jaws Wired Shut + 7.2Little Girl in the Big Ten + 6.8Old Yeller-Belly + 7.1Special Edna + 6.6Barting Over + 7.0Dude, Where's My Ranch? + 6.6The Bart of War + 7.4Treehouse of Horror XIV + 8.6Mountain of Madness + 6.6Today I Am a Clown + 6.7Marge vs. Singles, Seniors, Childless Couples and Teens and Gays + 7.3Diatribe of a Mad Housewife + 7.0All's Fair in Oven War + 6.2Bart-Mangled Banner + 6.8A Star Is Torn + 6.9See Homer Run + 7.3Milhouse Doesn't Live Here Anymore + 6.9The Ziff Who Came to Dinner + 6.4Homer and Ned's Hail Mary Pass + 6.9The Girl Who Slept Too Little + 6.9The Wandering Juvie + 7.0Milhouse of Sand and Fog + 7.3Treehouse of Horror XVI + 6.7Homer's Paternity Coot + 6.6She Used to Be My Girl + 6.7My Big Fat Geek Wedding + 7.3Future-Drama + 7.0The Italian Bob + 7.3Simple Simpson + 7.0We're on the Road to D'ohwhere + 6.9On a Clear Day I Can't See My Sister + 7.1Home Away from Homer + 7.4Treehouse of Horror XV + 7.3Midnight Rx + 6.8Pranksta Rap + 7.6Dumbbell Indemnity + 7.2Girls Just Want to Have Sums + 7.1The Monkey Suit + 6.3The Boys of Bummer + 7.1Treehouse of Horror XVIII + 6.3Rome-Old and Juli-Eh + 6.1Papa Don't Leech + 6.6Marge and Homer Turn a Couple Play + 6.6The Wife Aquatic + 7.0Double, Double, Boy in Trouble + 7.1Treehouse of Horror XVII + 6.3That '90s Show + 6.6The Burns and the Bees + 6.8Moe'N'a Lisa + 7.2The Haw-Hawed Couple + 7.1Husbands and Knives + 6.4All About Lisa + 7.3You Kent Always Say What You Want + 6.6Dangerous Curves + 7.3Springfield Up + 7.0Revenge Is a Dish Best Served Three Times + 7.3Marge Gamer + 7.0Stop! Or My Dog Will Shoot + 7.3Dial 'N' for Nerder + 6.6Love, Springfieldian Style + 7.1MyPods and Boomsticks + 7.2Sex, Pies and Idiot Scrapes + 7.0Any Given Sundance + 7.5Bart the Mother + 7.0Take My Life, Please + 7.0No Loan Again, Naturally + 6.3Elementary School Musical + 7.1Waverly Hills, 9-0-2-1-D'oh + 7.2The Bob Next Door + 7.2The Good, the Sad and the Drugly + 6.7Once Upon a Time in Springfield + 6.6Bart Gets a 'Z' + 7.2Eeny Teeny Maya Moe + 6.9Chief of Hearts + 6.3The Great Wife Hope + 7.2To Surveil with Love + 6.7The Scorpion's Tale + 6.9The Blue and the Gray + 6.6The Color Yellow + 6.5The Fool Monty + 7.2O Brother, Where Bart Thou? + 6.8Boy Meets Curl + 6.5Love Is a Many Strangled Thing + 6.7The Devil Wears Nada + 7.2Homer Scissorhands + 7.0Stealing First Base + 6.4How Munched is That Birdie in the Window? + 6.6The Real Housewives of Fat Tony + 6.3Moms I'd Like to Forget + 6.8MoneyBart + 6.9Flaming Moe + 7.3I'm with Cupid + 7.0Bart Stops to Smell the Roosevelts + 6.7Replaceable You + 7.0The D'oh-cial Network + 7.1Married to the Blob + 6.7Ned 'n Edna's Blend + 6.7Gone Abie Gone + 6.9Homer Goes to Prep School + 6.5Four Regrettings and a Funeral + 7.0Yellow Subterfuge + 7.4A Totally Fun Thing That Bart Will Never Do Again + 7.8The Book Job + 6.5The Daughter Also Rises + 7.6Steal This Episode + 6.9Exit Through the Kwik-E-Mart + 7.0Black Eyed, Please + 7.1Them, Robot + 7.1Treehouse of Horror XXIV + 6.5Pulpit Friction + 6.6The Changing of the Guardian + 6.4Moonshine River + 6.5A Tree Grows in Springfield + 7.3Treehouse of Horror XXIII + 7.2The Day the Earth Stood Cool + 7.0Hardly Kirk-ing + 6.3The Fabulous Faker Boy + 7.1Labor Pains + 7.0Dangers on a Train + 7.3Marge Simpson in: "Screaming Yellow Honkers" + 6.6The Winter of His Content + 5.8What to Expect When Bart's Expecting + 6.5Covercraft + 6.3Walking Big & Tall + 6.8Treehouse of Horror XXVI + 6.6The Girl Code + 6.7Pay Pal + 5.9Every Man's Dream + 6.2Let's Go Fly a Coot + 6.7Waiting for Duffman + 6.3Lisa with an 'S' + 7.3Bart's New Friend + 6.3Love Is in the N2-O2-Ar-CO2-Ne-He-CH4 + 6.9The Kids Are All Fight + 6.9Sky Police + 5.8Clown in the Dumps + 6.5Super Franchise Me + 6.7Much Apu About Something + 6.8I Won't Be Home for Christmas + 7.3Treehouse of Horror XXV + 6.7My Fare Lady + 6.5The Burns Cage + 6.9Mathlete's Feat + 6.3Lisa the Veterinarian + 7.1Paths of Glory + 7.2Puffless + 8.0Brush with Greatness + 8.8Flaming Moe's + 8.1Bart the General + 8.2Brother, Can You Spare Two Dimes? + 9.0Homer the Heretic + 9.0Cape Feare + 7.7Bart's Inner Child + 8.8Deep Space Homer + 8.4Sweet Seymour Skinner's Baadasssss Song + 8.2The Boy Who Knew Too Much + 9.0Treehouse of Horror V + 9.1Who Shot Mr. Burns? (Part One) + 9.2You Only Move Twice + 8.5El Viaje Misterioso de Nuestro Jomer (The Mysterious Voyage of Homer) + 9.2Homer's Enemy + 8.1Treehouse of Horror VIII + 7.7The Two Mrs. Nahasapeemapetilons + 7.6D'oh-in' in the Wind + 8.0Skinner's Sense of Snow + 8.0HOMR + 8.6Trilogy of Error + 8.0Poppa's Got a Brand New Badge + 7.6Treehouse of Horror XIII + 8.2Holidays of Future Passed + 7.9Simpsorama + 7.5Halloween of Horror + 6.7To Courier with Love + 7.5Homer's Odyssey + 7.3Grift of the Magi + 7.4A Tale of Two Springfields + 7.2Homer vs. Dignity + 6.5The Old Man and the Key + 7.1'Scuse Me While I Miss the Sky + 7.1Margical History Tour + 7.0Mobile Homer + 7.4Don't Fear the Roofer + 7.4The Seemingly Never-Ending Story + 6.5Homer Simpson, This Is Your Wife + 6.7The Wettest Stories Ever Told + 7.2Midnight Towboy + 7.1Homer and Lisa Exchange Cross Words + 7.2Coming to Homerica + 7.3Treehouse of Horror XX + 6.7American History X-cellent + 6.9The Squirt and the Whale + 7.1Treehouse of Horror XXI + 6.8The Man in the Blue Flannel Pants + 7.1Dark Knight Court + 7.2The Saga of Carl + 6.9You Don't Have to Live Like a Referee + 6.6The Princess Guide + 6.4How Lisa Got Her Marge Back + 6.9Orange Is the New Yellow + 6.6Monty Burns' Fleeing Circus + 7.2New Kids on the Blecch + 7.0Sweets and Sour Marge + 7.1The Frying Game + 7.3I'm Spelling As Fast As I Can + 7.1A Star Is Born-Again + 7.1The Regina Monologues + 7.2The Father, the Son, and the Holy Guest Star + 6.9Marge's Son Poisoning + 7.2Kiss Kiss, Bang Bangalore + 6.7Jazzy and the Pussycats + 6.7He Loves to Fly and He D'ohs + 6.9I Don't Wanna Know Why the Caged Bird Sings + 8.2Eternal Moonshine of the Simpson Mind + 5.9Lisa the Drama Queen + 7.0How the Test Was Won + 6.3In the Name of the Grandfather + 6.8Wedding for Disaster + 7.0The Ned-Liest Catch + 7.0At Long Last Leave + 7.3How I Wet Your Mother + 6.9Adventures in Baby-Getting + 6.4Diggs + 7.0Days of Future Future + \ No newline at end of file diff --git a/test/output/simpsonsRatingsDots.svg b/test/output/simpsonsRatingsDots.svg index 67cced8b0e..ec99d1dc14 100644 --- a/test/output/simpsonsRatingsDots.svg +++ b/test/output/simpsonsRatingsDots.svg @@ -13,123 +13,95 @@ white-space: pre; } - - - 4.5 - - - 5.0 - - - 5.5 - - - 6.0 - - - 6.5 - - - 7.0 - - - 7.5 - - - 8.0 - - - 8.5 - - - 9.0 - ↑ IMDb rating + + + + + + + + + + + - - - 1 - - - 2 - - - 3 - - - 4 - - - 5 - - - 6 - - - 7 - - - 8 - - - 9 - - - 10 - - - 11 - - - 12 - - - 13 - - - 14 - - - 15 - - - 16 - - - 17 - - - 18 - - - 19 - - - 20 - - - 21 - - - 22 - - - 23 - - - 24 - - - 25 - - - 26 - - - 27 - - - 28 - Season → + + 4.5 + 5.0 + 5.5 + 6.0 + 6.5 + 7.0 + 7.5 + 8.0 + 8.5 + 9.0 + + + ↑ IMDb rating + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 1 + 2 + 3 + 4 + 5 + 6 + 7 + 8 + 9 + 10 + 11 + 12 + 13 + 14 + 15 + 16 + 17 + 18 + 19 + 20 + 21 + 22 + 23 + 24 + 25 + 26 + 27 + 28 + + + Season → diff --git a/test/output/simpsonsViews.html b/test/output/simpsonsViews.html index 6bac9d16f3..1b41e683f0 100644 --- a/test/output/simpsonsViews.html +++ b/test/output/simpsonsViews.html @@ -23,21 +23,27 @@ - 5 + + 5 - 10 + + 10 - 15 + + 15 - 20 + + 20 - 25 + + 25 - season + + season - - - - 0 - - - - 2 - - - - 4 - - - - 6 - - - - 8 - - - - 10 - - - - 12 - - - - 14 - - - - 16 - - - - 18 - - - - 20 - - - - 22 - - - - 24 - - - - 26 - - - - 28 - - - - 30 - - - - 32 - ↑ Viewers (U.S., millions) + + + + + + + + + + + + + + + + + + - - - - 4.5 - - - - 5.0 - - - - 5.5 - - - - 6.0 - - - - 6.5 - - - - 7.0 - - - - 7.5 - - - - 8.0 - - - - 8.5 - - - - 9.0 - IMDB rating → + + + + + + + + + + + + + + + + + + + + + 0 + 2 + 4 + 6 + 8 + 10 + 12 + 14 + 16 + 18 + 20 + 22 + 24 + 26 + 28 + 30 + 32 + + + ↑ Viewers (U.S., millions) + + + + + + + + + + + + + + + + + + + + + + + + + + + 4.5 + 5.0 + 5.5 + 6.0 + 6.5 + 7.0 + 7.5 + 8.0 + 8.5 + 9.0 + + + IMDB rating → - - Homer's Night Out S1E10 - - - Krusty Gets Busted S1E12 - - - Bart Gets an "F" S2E1 - - - Two Cars in Every Garage and Three Eyes on Every Fish S2E4 - - - Dead Putting Society S2E6 - - - Bart the Daredevil S2E8 - - - Bart Gets Hit by a Car S2E10 - - - Homer vs. Lisa and the 8th Commandment S2E13 - - - Oh Brother, Where Art Thou? S2E15 - - - Old Money S2E17 - - - Lisa's Substitute S2E19 - - - Blood Feud S2E22 - - - Mr. Lisa Goes to Washington S3E2 - - - Bart the Murderer S3E4 - - - Like Father, Like Clown S3E6 - - - Saturdays of Thunder S3E9 - - - Burns Verkaufen der Kraftwerk S3E11 - - - Radio Bart S3E13 - - - Bart the Lover S3E16 - - - Separate Vocations S3E18 - - - Colonel Homer S3E20 - - - Bart's Friend Falls in Love S3E23 - - - Kamp Krusty S4E1 - - - Itchy & Scratchy: The Movie S4E6 - - - Lisa's First Word S4E10 - - - Selma's Choice S4E13 - - - The Call of the Simpsons S1E7 - - - One Fish, Two Fish, Blowfish, Blue Fish S2E11 - - - Marge in Chains S4E21 - - - Homer's Barbershop Quartet S5E1 - - - Homer Goes to College S5E3 - - - Marge on the Lam S5E6 - - - Boy-Scoutz 'n the Hood S5E8 - - - Homer the Vigilante S5E11 - - - Bart Gets Famous S5E12 - - - Lisa vs. Malibu Stacy S5E14 - - - Bart Gets an Elephant S5E17 - - - Lady Bouvier's Lover S5E21 - - - Bart of Darkness S6E1 - - - Itchy & Scratchy Land S6E4 - - - Lisa on Ice S6E8 - - - Fear of Flying S6E11 - - - And Maggie Makes Three S6E13 - - - Homie the Clown S6E15 - - - Homer vs. Patty and Selma S6E17 - - - Two Dozen and One Greyhounds S6E20 - - - 'Round Springfield S6E22 - - - Lemon of Troy S6E24 - - - Radioactive Man S7E2 - - - Bart Sells His Soul S7E4 - - - Treehouse of Horror VI S7E6 - - - Marge Be Not Proud S7E11 - - - Team Homer S7E12 - - - Bart the Fink S7E15 - - - New Kid on the Block S4E8 - - - 22 Short Films About Springfield S7E21 - - - Much Apu About Nothing S7E23 - - - Summer of 4 Ft. 2 S7E25 - - - Burns, Baby Burns S8E4 - - - The Springfield Files S8E10 - - - The Twisted World of Marge Simpson S8E11 - - - The Itchy & Scratchy & Poochie Show S8E14 - - - Homer's Phobia S8E15 - - - Homer vs. the Eighteenth Amendment S8E18 - - - In Marge We Trust S8E22 - - - The Secret War of Lisa Simpson S8E25 - - - The Principal and the Pauper S9E2 - - - Bart Star S9E6 - - - Lisa the Skeptic S9E8 - - - All Singing, All Dancing S9E11 - - - The Joy of Sect S9E13 - - - This Little Wiggy S9E18 - - - The Trouble with Trillions S9E20 - - - Trash of the Titans S9E22 - - - Natural Born Kissers S9E25 - - - The Wizard of Evergreen Terrace S10E2 - - - Treehouse of Horror IX S10E4 - - - Mayored to the Mob S10E9 - - - Wild Barts Can't Be Broken S10E11 - - - Make Room for Lisa S10E16 - - - Mom and Pop Art S10E19 - - - Monty Can't Buy Me Love S10E21 - - - Thirty Minutes over Tokyo S10E23 - - - Guess Who's Coming to Criticize Dinner? S11E3 - - - E-I-E-I-(Annoyed Grunt) S11E5 - - - Eight Misbehavin' S11E7 - - - The Mansion Family S11E12 - - - Alone Again, Natura-diddily S11E14 - - - Pygmoelian S11E16 - - - Kill the Alligator and Run S11E19 - - - It's a Mad, Mad, Mad, Mad Marge S11E21 - - - Treehouse of Horror XI S12E1 - - - Insane Clown Poppy S12E3 - - - The Computer Wore Menace Shoes S12E6 - - - Pokey Mom S12E10 - - - Day of the Jackanapes S12E13 - - - Hungry, Hungry Homer S12E15 - - - Simpson Safari S12E17 - - - Children of a Lesser Clod S12E20 - - - Treehouse of Horror XII S13E1 - - - Homer the Moe S13E3 - - - The Blunder Years S13E5 - - - Half-Decent Proposal S13E10 - - - The Lastest Gun in the West S13E12 - - - Blame It on Lisa S13E15 - - - Gump Roast S13E17 - - - Homer's Triple Bypass S4E11 - - - Bart vs. Lisa vs. the Third Grade S14E3 - - - The Great Louse Detective S14E6 - - - The Dad Who Knew Too Little S14E8 - - - Pray Anything S14E10 - - - C.E.D'oh S14E15 - - - Three Gays of the Condo S14E17 - - - Brake My Wife, Please S14E20 - - - Moe Baby Blues S14E22 - - - My Mother the Carjacker S15E2 - - - The Fat and the Furriest S15E5 - - - 'Tis the Fifteenth Season S15E7 - - - I, (Annoyed Grunt)-bot S15E9 - - - Smart & Smarter S15E13 - - - Co-Dependents' Day S15E15 - - - Catch 'Em If You Can S15E18 - - - The Way We Weren't S15E20 - - - Fraudcast News S15E22 - - - Sleeping with the Enemy S16E3 - - - Fat Man and Little Boy S16E5 - - - Mommie Beerest S16E7 - - - There's Something About Marrying S16E10 - - - Goo Goo Gai Pan S16E12 - - - The Seven-Beer Snitch S16E14 - - - The Heartbroke Kid S16E17 - - - Thank God It's Doomsday S16E19 - - - The Bonfire of the Manatees S17E1 - - - Duffless S4E16 - - - The Last of the Red Hat Mamas S17E7 - - - Simpsons Christmas Stories S17E9 - - - My Fair Laddy S17E12 - - - Bart Has Two Mommies S17E14 - - - Million-Dollar Abie S17E16 - - - Regarding Margie S17E20 - - - The Mook, the Chef, the Wife and Her Homer S18E1 - - - Please Homer, Don't Hammer 'Em S18E3 - - - G.I. (Annoyed Grunt) S18E5 - - - Ice Cream of Margie (with the Light Blue Hair) S18E7 - - - Kill Gil, Volumes I & II S18E9 - - - Little Big Girl S18E12 - - - Yokel Chords S18E14 - - - Homerazzi S18E16 - - - Crook and Ladder S18E19 - - - 24 Minutes S18E21 - - - The Homer of Seville S19E2 - - - Little Orphan Millie S19E6 - - - Funeral for a Fiend S19E8 - - - E Pluribus Wiggum S19E10 - - - The Debarted S19E13 - - - Smoke on the Daughter S19E15 - - - Apocalypse Cow S19E17 - - - Mona Leaves-a S19E19 - - - Lost Verizon S20E2 - - - Treehouse of Horror XIX S20E4 - - - So It's Come to This: A Simpsons Clip Show S4E18 - - - Gone Maggie Gone S20E13 - - - Father Knows Worst S20E18 - - - Four Great Women and a Manicure S20E20 - - - Homer the Whopper S21E1 - - - Rednecks and Broomsticks S21E7 - - - Thursdays with Abie S21E9 - - - Million Dollar Maybe S21E11 - - - Postcards from the Wedge S21E14 - - - The Greatest Story Ever D'ohed S21E16 - - - Moe Letter Blues S21E21 - - - Judge Me Tender S21E23 - - - Loan-a Lisa S22E2 - - - Lisa Simpson, This Isn't Your Life S22E5 - - - The Fight Before Christmas S22E8 - - - Donnie Fatso S22E9 - - - Homer the Father S22E12 - - - Angry Dad: The Movie S22E14 - - - A Midsummer's Nice Dream S22E16 - - - The Great Simpsina S22E18 - - - 500 Keys S22E21 - - - The Falcon and the D'ohman S23E1 - - - Treehouse of Horror XXII S23E3 - - - The Food Wife S23E5 - - - The Ten-Per-Cent Solution S23E8 - - - Politically Inept, with Homer Simpson S23E10 - - - Moe Goes from Rags to Riches S23E12 - - - Pranks and Greens S21E6 - - - $pringfield (or, How I Learned to Stop Worrying and Love Legalized Gambling) S5E10 - - - Beware My Cheating Bart S23E18 - - - The Spy Who Learned Me S23E20 - - - Lisa Goes Gaga S23E22 - - - Penny-Wiseguys S24E5 - - - To Cur with Love S24E8 - - - A Test Before Trying S24E10 - - - Love is a Many-Splintered Thing S24E12 - - - Gorgeous Grampa S24E14 - - - What Animated Women Want S24E17 - - - Whiskey Business S24E19 - - - Homerland S25E1 - - - YOLO S25E4 - - - The Kid Is All Right S25E6 - - - White Christmas Blues S25E8 - - - Specs and the City S25E11 - - - The Man Who Grew Too Much S25E13 - - - The War of Art S25E15 - - - Luca$ S25E17 - - - Brick Like Me S25E20 - - - The Yellow Badge of Cowardge S25E22 - - - The Wreck of the Relationship S26E2 - - - Opposites A-Frack S26E5 - - - Blazed and Confused S26E7 - - - The Man Who Came to Be Dinner S26E10 - - - The Musk Who Fell to Earth S26E12 - - - Peeping Mom S26E18 - - - Life on the Fast Lane S1E9 - - - The Crepes of Wrath S1E11 - - - Some Enchanted Evening S1E13 - - - Simpson and Delilah S2E2 - - - Treehouse of Horror S2E3 - - - Dancin' Homer S2E5 - - - Bart vs. Thanksgiving S2E7 - - - Itchy & Scratchy & Marge S2E9 - - - The Way We Was S2E12 - - - Principal Charming S2E14 - - - Bart's Dog Gets an "F" S2E16 - - - The War of the Simpsons S2E20 - - - Bull-E S26E21 - - - Cue Detective S27E2 - - - Friend with Benefit S27E6 - - - Barthood S27E9 - - - Teenage Mutant Milk-Caused Hurdles S27E11 - - - Gal of Constant Sorrow S27E14 - - - The Marge-ian Chronicles S27E16 - - - Fland Canyon S27E19 - - - Simprovised S27E21 - - - Simpsons Roasting on an Open Fire S1E1 - - - Bart the Genius S1E2 - - - There's No Disgrace Like Home S1E4 - - - Moaning Lisa S1E6 - - - The Telltale Head S1E8 - - - Three Men and a Comic Book S2E21 - - - Stark Raving Dad S3E1 - - - When Flanders Failed S3E3 - - - Homer Defined S3E5 - - - The Front S4E19 - - - Brother from the Same Planet S4E14 - - - Treehouse of Horror IV S5E5 - - - Marge vs. the Monorail S4E12 - - - I Love Lisa S4E15 - - - The Last Temptation of Homer S5E9 - - - Dog of Death S3E19 - - - Treehouse of Horror II S3E7 - - - Lisa's Pony S3E8 - - - Marge Gets a Job S4E7 - - - I Married Marge S3E12 - - - Last Exit to Springfield S4E17 - - - Lisa the Greek S3E14 - - - The Otto Show S3E22 - - - Rosebud S5E4 - - - Homer Alone S3E15 - - - Homer at the Bat S3E17 - - - Whacking Day S4E20 - - - Lisa the Beauty Queen S4E4 - - - Krusty Gets Kancelled S4E22 - - - Black Widower S3E21 - - - A Streetcar Named Marge S4E2 - - - Treehouse of Horror III S4E5 - - - Mr. Plow S4E9 - - - Homer and Apu S5E13 - - - Homer Loves Flanders S5E16 - - - Burns' Heir S5E18 - - - Sideshow Bob's Last Gleaming S7E9 - - - Grampa vs. Sexual Inadequacy S6E10 - - - A Fish Called Selma S7E19 - - - Bart's Comet S6E14 - - - Home Sweet Homediddly-Dum-Doodily S7E3 - - - Scenes from the Class Struggle in Springfield S7E14 - - - Bart vs. Australia S6E16 - - - King-Size Homer S7E7 - - - Secrets of a Successful Marriage S5E22 - - - Lisa's Rival S6E2 - - - A Star Is Burns S6E18 - - - Lisa's Wedding S6E19 - - - Another Simpsons Clip Show S6E3 - - - Lisa the Vegetarian S7E5 - - - The PTA Disbands S6E21 - - - Sideshow Bob Roberts S6E5 - - - Bart's Girlfriend S6E7 - - - Who Shot Mr. Burns? (Part Two) S7E1 - - - The Springfield Connection S6E23 - - - Homer the Smithers S7E17 - - - Homer Badman S6E9 - - - Homer the Great S6E12 - - - The Simpsons 138th Episode Spectacular S7E10 - - - Two Bad Neighbors S7E13 - - - Lisa the Iconoclast S7E16 - - - Mother Simpson S7E8 - - - Raging Abe Simpson and His Grumbling Grandson in "The Curse of the Flying Hellfish" S7E22 - - - Homerpalooza S7E24 - - - Lisa's Sax S9E3 - - - Simpsoncalifragilisticexpiala(Annoyed Grunt)cious S8E13 - - - Treehouse of Horror VII S8E1 - - - Brother from Another Series S8E16 - - - The Homer They Fall S8E3 - - - Bart After Dark S8E5 - - - Lost Our Lisa S9E24 - - - Girly Edition S9E21 - - - Realty Bites S9E9 - - - The Old Man and the Lisa S8E21 - - - A Milhouse Divided S8E6 - - - My Sister, My Sitter S8E17 - - - The Last Temptation of Krust S9E15 - - - The Cartridge Family S9E5 - - - Grade School Confidential S8E19 - - - Simpson Tide S9E19 - - - The Simpsons Spin-Off Showcase S8E24 - - - The City of New York vs. Homer Simpson S9E1 - - - Miracle on Evergreen Terrace S9E10 - - - King of the Hill S9E23 - - - Das Bus S9E14 - - - Lard of the Dance S10E1 - - - Bart Carny S9E12 - - - Lisa the Simpson S9E17 - - - The Day the Violence Died S7E18 - - - When You Dish Upon a Star S10E5 - - - Lisa Gets an "A" S10E7 - - - Homer Simpson in: "Kidney Trouble" S10E8 - - - Lisa the Tree Hugger S12E4 - - - Sunday, Cruddy Sunday S10E12 - - - Maximum Homerdrive S10E17 - - - Hello Gutter, Hello Fadder S11E6 - - - Simpsons Bible Stories S10E18 - - - Tennis the Menace S12E12 - - - Viva Ned Flanders S10E10 - - - Treehouse of Horror X S11E4 - - - Last Tap Dance in Springfield S11E20 - - - Brother's Little Helper S11E2 - - - The Old Man and the "C" Student S10E20 - - - Bart to the Future S11E17 - - - Beyond Blunderdome S11E1 - - - They Saved Lisa's Brain S10E22 - - - Homer to the Max S10E13 - - - Take My Wife, Sleaze S11E8 - - - Little Big Mom S11E10 - - - Faith Off S11E11 - - - Worst Episode Ever S12E11 - - - Saddlesore Galactica S11E13 - - - Behind the Laughter S11E22 - - - The Great Money Caper S12E7 - - - Missionary: Impossible S11E15 - - - Days of Wine and D'oh'ses S11E18 - - - Bart on the Road S7E20 - - - Bye, Bye, Nerdie S12E16 - - - I'm Goin' to Praiseland S12E19 - - - Simpsons Tall Tales S12E21 - - - I Am Furious (Yellow) S13E18 - - - The Sweetest Apu S13E19 - - - The President Wore Pearls S15E3 - - - The Parent Rap S13E2 - - - Weekend at Burnsie's S13E16 - - - Large Marge S14E4 - - - The Bart Wants What It Wants S13E11 - - - Mr. Spritz Goes to Washington S14E14 - - - A Hunka Hunka Burns in Love S13E4 - - - How I Spent My Strummer Vacation S14E2 - - - She of Little Faith S13E6 - - - Helter Shelter S14E5 - - - Tales from the Public Domain S13E14 - - - The Strong Arms of the Ma S14E9 - - - Brawl in the Family S13E7 - - - Jaws Wired Shut S13E9 - - - Little Girl in the Big Ten S13E20 - - - Old Yeller-Belly S14E19 - - - Special Edna S14E7 - - - Barting Over S14E11 - - - Dude, Where's My Ranch? S14E18 - - - The Bart of War S14E21 - - - Treehouse of Horror XIV S15E1 - - - Mountain of Madness S8E12 - - - Today I Am a Clown S15E6 - - - Marge vs. Singles, Seniors, Childless Couples and Teens and Gays S15E8 - - - Diatribe of a Mad Housewife S15E10 - - - All's Fair in Oven War S16E2 - - - Bart-Mangled Banner S15E21 - - - A Star Is Torn S16E18 - - - See Homer Run S17E6 - - - Milhouse Doesn't Live Here Anymore S15E12 - - - The Ziff Who Came to Dinner S15E14 - - - Homer and Ned's Hail Mary Pass S16E8 - - - The Girl Who Slept Too Little S17E2 - - - The Wandering Juvie S15E16 - - - Milhouse of Sand and Fog S17E3 - - - Treehouse of Horror XVI S17E4 - - - Homer's Paternity Coot S17E10 - - - She Used to Be My Girl S16E4 - - - My Big Fat Geek Wedding S15E17 - - - Future-Drama S16E15 - - - The Italian Bob S17E8 - - - Simple Simpson S15E19 - - - We're on the Road to D'ohwhere S17E11 - - - On a Clear Day I Can't See My Sister S16E11 - - - Home Away from Homer S16E20 - - - Treehouse of Horror XV S16E1 - - - Midnight Rx S16E6 - - - Pranksta Rap S16E9 - - - Dumbbell Indemnity S9E16 - - - Girls Just Want to Have Sums S17E19 - - - The Monkey Suit S17E21 - - - The Boys of Bummer S18E18 - - - Treehouse of Horror XVIII S19E5 - - - Rome-Old and Juli-Eh S18E15 - - - Papa Don't Leech S19E16 - - - Marge and Homer Turn a Couple Play S17E22 - - - The Wife Aquatic S18E10 - - - Double, Double, Boy in Trouble S20E3 - - - Treehouse of Horror XVII S18E4 - - - That '90s Show S19E11 - - - The Burns and the Bees S20E8 - - - Moe'N'a Lisa S18E6 - - - The Haw-Hawed Couple S18E8 - - - Husbands and Knives S19E7 - - - All About Lisa S19E20 - - - You Kent Always Say What You Want S18E22 - - - Dangerous Curves S20E5 - - - Springfield Up S18E13 - - - Revenge Is a Dish Best Served Three Times S18E11 - - - Marge Gamer S18E17 - - - Stop! Or My Dog Will Shoot S18E20 - - - Dial 'N' for Nerder S19E14 - - - Love, Springfieldian Style S19E12 - - - MyPods and Boomsticks S20E7 - - - Sex, Pies and Idiot Scrapes S20E1 - - - Any Given Sundance S19E18 - - - Bart the Mother S10E3 - - - Take My Life, Please S20E10 - - - No Loan Again, Naturally S20E12 - - - Elementary School Musical S22E1 - - - Waverly Hills, 9-0-2-1-D'oh S20E19 - - - The Bob Next Door S21E22 - - - The Good, the Sad and the Drugly S20E17 - - - Once Upon a Time in Springfield S21E10 - - - Bart Gets a 'Z' S21E2 - - - Eeny Teeny Maya Moe S20E16 - - - Chief of Hearts S21E18 - - - The Great Wife Hope S21E3 - - - To Surveil with Love S21E20 - - - The Scorpion's Tale S22E15 - - - The Blue and the Gray S22E13 - - - The Color Yellow S21E13 - - - The Fool Monty S22E6 - - - O Brother, Where Bart Thou? S21E8 - - - Boy Meets Curl S21E12 - - - Love Is a Many Strangled Thing S22E17 - - - The Devil Wears Nada S21E5 - - - Homer Scissorhands S22E20 - - - Stealing First Base S21E15 - - - How Munched is That Birdie in the Window? S22E7 - - - The Real Housewives of Fat Tony S22E19 - - - Moms I'd Like to Forget S22E10 - - - MoneyBart S22E3 - - - Flaming Moe S22E11 - - - I'm with Cupid S10E14 - - - Bart Stops to Smell the Roosevelts S23E2 - - - Replaceable You S23E4 - - - The D'oh-cial Network S23E11 - - - Married to the Blob S25E10 - - - Ned 'n Edna's Blend S23E21 - - - Gone Abie Gone S24E4 - - - Homer Goes to Prep School S24E9 - - - Four Regrettings and a Funeral S25E3 - - - Yellow Subterfuge S25E7 - - - A Totally Fun Thing That Bart Will Never Do Again S23E19 - - - The Book Job S23E6 - - - The Daughter Also Rises S23E13 - - - Steal This Episode S25E9 - - - Exit Through the Kwik-E-Mart S23E15 - - - Black Eyed, Please S24E15 - - - Them, Robot S23E17 - - - Treehouse of Horror XXIV S25E2 - - - Pulpit Friction S24E18 - - - The Changing of the Guardian S24E11 - - - Moonshine River S24E1 - - - A Tree Grows in Springfield S24E6 - - - Treehouse of Horror XXIII S24E2 - - - The Day the Earth Stood Cool S24E7 - - - Hardly Kirk-ing S24E13 - - - The Fabulous Faker Boy S24E20 - - - Labor Pains S25E5 - - - Dangers on a Train S24E22 - - - Marge Simpson in: "Screaming Yellow Honkers" S10E15 - - - The Winter of His Content S25E14 - - - What to Expect When Bart's Expecting S25E19 - - - Covercraft S26E8 - - - Walking Big & Tall S26E13 - - - Treehouse of Horror XXVI S27E5 - - - The Girl Code S27E10 - - - Pay Pal S25E21 - - - Every Man's Dream S27E1 - - - Let's Go Fly a Coot S26E20 - - - Waiting for Duffman S26E17 - - - Lisa with an 'S' S27E7 - - - Bart's New Friend S26E11 - - - Love Is in the N2-O2-Ar-CO2-Ne-He-CH4 S27E13 - - - The Kids Are All Fight S26E19 - - - Sky Police S26E16 - - - Clown in the Dumps S26E1 - - - Super Franchise Me S26E3 - - - Much Apu About Something S27E12 - - - I Won't Be Home for Christmas S26E9 - - - Treehouse of Horror XXV S26E4 - - - My Fare Lady S26E14 - - - The Burns Cage S27E17 - - - Mathlete's Feat S26E22 - - - Lisa the Veterinarian S27E15 - - - Paths of Glory S27E8 - - - Puffless S27E3 - - - Brush with Greatness S2E18 - - - Flaming Moe's S3E10 - - - Bart the General S1E5 - - - Brother, Can You Spare Two Dimes? S3E24 - - - Homer the Heretic S4E3 - - - Cape Feare S5E2 - - - Bart's Inner Child S5E7 - - - Deep Space Homer S5E15 - - - Sweet Seymour Skinner's Baadasssss Song S5E19 - - - The Boy Who Knew Too Much S5E20 - - - Treehouse of Horror V S6E6 - - - Who Shot Mr. Burns? (Part One) S6E25 - - - You Only Move Twice S8E2 - - - El Viaje Misterioso de Nuestro Jomer (The Mysterious Voyage of Homer) S8E9 - - - Homer's Enemy S8E23 - - - Treehouse of Horror VIII S9E4 - - - The Two Mrs. Nahasapeemapetilons S9E7 - - - D'oh-in' in the Wind S10E6 - - - Skinner's Sense of Snow S12E8 - - - HOMR S12E9 - - - Trilogy of Error S12E18 - - - Poppa's Got a Brand New Badge S13E22 - - - Treehouse of Horror XIII S14E1 - - - Holidays of Future Passed S23E9 - - - Simpsorama S26E6 - - - Halloween of Horror S27E4 - - - To Courier with Love S27E20 - - - Homer's Odyssey S1E3 - - - Grift of the Magi S11E9 - - - A Tale of Two Springfields S12E2 - - - Homer vs. Dignity S12E5 - - - The Old Man and the Key S13E13 - - - 'Scuse Me While I Miss the Sky S14E16 - - - Margical History Tour S15E11 - - - Mobile Homer S16E13 - - - Don't Fear the Roofer S16E16 - - - The Seemingly Never-Ending Story S17E13 - - - Homer Simpson, This Is Your Wife S17E15 - - - The Wettest Stories Ever Told S17E18 - - - Midnight Towboy S19E3 - - - Homer and Lisa Exchange Cross Words S20E6 - - - Coming to Homerica S20E21 - - - Treehouse of Horror XX S21E4 - - - American History X-cellent S21E17 - - - The Squirt and the Whale S21E19 - - - Treehouse of Horror XXI S22E4 - - - The Man in the Blue Flannel Pants S23E7 - - - Dark Knight Court S24E16 - - - The Saga of Carl S24E21 - - - You Don't Have to Live Like a Referee S25E16 - - - The Princess Guide S26E15 - - - How Lisa Got Her Marge Back S27E18 - - - Orange Is the New Yellow S27E22 - - - Monty Burns' Fleeing Circus S28E1 - - - New Kids on the Blecch S12E14 - - - Sweets and Sour Marge S13E8 - - - The Frying Game S13E21 - - - I'm Spelling As Fast As I Can S14E12 - - - A Star Is Born-Again S14E13 - - - The Regina Monologues S15E4 - - - The Father, the Son, and the Holy Guest Star S16E21 - - - Marge's Son Poisoning S17E5 - - - Kiss Kiss, Bang Bangalore S17E17 - - - Jazzy and the Pussycats S18E2 - - - He Loves to Fly and He D'ohs S19E1 - - - I Don't Wanna Know Why the Caged Bird Sings S19E4 - - - Eternal Moonshine of the Simpson Mind S19E9 - - - Lisa the Drama Queen S20E9 - - - How the Test Was Won S20E11 - - - In the Name of the Grandfather S20E14 - - - Wedding for Disaster S20E15 - - - The Ned-Liest Catch S22E22 - - - At Long Last Leave S23E14 - - - How I Wet Your Mother S23E16 - - - Adventures in Baby-Getting S24E3 - - - Diggs S25E12 - - - Days of Future Future S25E18 - + Homer's Night Out S1E10 + Krusty Gets Busted S1E12 + Bart Gets an "F" S2E1 + Two Cars in Every Garage and Three Eyes on Every Fish S2E4 + Dead Putting Society S2E6 + Bart the Daredevil S2E8 + Bart Gets Hit by a Car S2E10 + Homer vs. Lisa and the 8th Commandment S2E13 + Oh Brother, Where Art Thou? S2E15 + Old Money S2E17 + Lisa's Substitute S2E19 + Blood Feud S2E22 + Mr. Lisa Goes to Washington S3E2 + Bart the Murderer S3E4 + Like Father, Like Clown S3E6 + Saturdays of Thunder S3E9 + Burns Verkaufen der Kraftwerk S3E11 + Radio Bart S3E13 + Bart the Lover S3E16 + Separate Vocations S3E18 + Colonel Homer S3E20 + Bart's Friend Falls in Love S3E23 + Kamp Krusty S4E1 + Itchy & Scratchy: The Movie S4E6 + Lisa's First Word S4E10 + Selma's Choice S4E13 + The Call of the Simpsons S1E7 + One Fish, Two Fish, Blowfish, Blue Fish S2E11 + Marge in Chains S4E21 + Homer's Barbershop Quartet S5E1 + Homer Goes to College S5E3 + Marge on the Lam S5E6 + Boy-Scoutz 'n the Hood S5E8 + Homer the Vigilante S5E11 + Bart Gets Famous S5E12 + Lisa vs. Malibu Stacy S5E14 + Bart Gets an Elephant S5E17 + Lady Bouvier's Lover S5E21 + Bart of Darkness S6E1 + Itchy & Scratchy Land S6E4 + Lisa on Ice S6E8 + Fear of Flying S6E11 + And Maggie Makes Three S6E13 + Homie the Clown S6E15 + Homer vs. Patty and Selma S6E17 + Two Dozen and One Greyhounds S6E20 + 'Round Springfield S6E22 + Lemon of Troy S6E24 + Radioactive Man S7E2 + Bart Sells His Soul S7E4 + Treehouse of Horror VI S7E6 + Marge Be Not Proud S7E11 + Team Homer S7E12 + Bart the Fink S7E15 + New Kid on the Block S4E8 + 22 Short Films About Springfield S7E21 + Much Apu About Nothing S7E23 + Summer of 4 Ft. 2 S7E25 + Burns, Baby Burns S8E4 + The Springfield Files S8E10 + The Twisted World of Marge Simpson S8E11 + The Itchy & Scratchy & Poochie Show S8E14 + Homer's Phobia S8E15 + Homer vs. the Eighteenth Amendment S8E18 + In Marge We Trust S8E22 + The Secret War of Lisa Simpson S8E25 + The Principal and the Pauper S9E2 + Bart Star S9E6 + Lisa the Skeptic S9E8 + All Singing, All Dancing S9E11 + The Joy of Sect S9E13 + This Little Wiggy S9E18 + The Trouble with Trillions S9E20 + Trash of the Titans S9E22 + Natural Born Kissers S9E25 + The Wizard of Evergreen Terrace S10E2 + Treehouse of Horror IX S10E4 + Mayored to the Mob S10E9 + Wild Barts Can't Be Broken S10E11 + Make Room for Lisa S10E16 + Mom and Pop Art S10E19 + Monty Can't Buy Me Love S10E21 + Thirty Minutes over Tokyo S10E23 + Guess Who's Coming to Criticize Dinner? S11E3 + E-I-E-I-(Annoyed Grunt) S11E5 + Eight Misbehavin' S11E7 + The Mansion Family S11E12 + Alone Again, Natura-diddily S11E14 + Pygmoelian S11E16 + Kill the Alligator and Run S11E19 + It's a Mad, Mad, Mad, Mad Marge S11E21 + Treehouse of Horror XI S12E1 + Insane Clown Poppy S12E3 + The Computer Wore Menace Shoes S12E6 + Pokey Mom S12E10 + Day of the Jackanapes S12E13 + Hungry, Hungry Homer S12E15 + Simpson Safari S12E17 + Children of a Lesser Clod S12E20 + Treehouse of Horror XII S13E1 + Homer the Moe S13E3 + The Blunder Years S13E5 + Half-Decent Proposal S13E10 + The Lastest Gun in the West S13E12 + Blame It on Lisa S13E15 + Gump Roast S13E17 + Homer's Triple Bypass S4E11 + Bart vs. Lisa vs. the Third Grade S14E3 + The Great Louse Detective S14E6 + The Dad Who Knew Too Little S14E8 + Pray Anything S14E10 + C.E.D'oh S14E15 + Three Gays of the Condo S14E17 + Brake My Wife, Please S14E20 + Moe Baby Blues S14E22 + My Mother the Carjacker S15E2 + The Fat and the Furriest S15E5 + 'Tis the Fifteenth Season S15E7 + I, (Annoyed Grunt)-bot S15E9 + Smart & Smarter S15E13 + Co-Dependents' Day S15E15 + Catch 'Em If You Can S15E18 + The Way We Weren't S15E20 + Fraudcast News S15E22 + Sleeping with the Enemy S16E3 + Fat Man and Little Boy S16E5 + Mommie Beerest S16E7 + There's Something About Marrying S16E10 + Goo Goo Gai Pan S16E12 + The Seven-Beer Snitch S16E14 + The Heartbroke Kid S16E17 + Thank God It's Doomsday S16E19 + The Bonfire of the Manatees S17E1 + Duffless S4E16 + The Last of the Red Hat Mamas S17E7 + Simpsons Christmas Stories S17E9 + My Fair Laddy S17E12 + Bart Has Two Mommies S17E14 + Million-Dollar Abie S17E16 + Regarding Margie S17E20 + The Mook, the Chef, the Wife and Her Homer S18E1 + Please Homer, Don't Hammer 'Em S18E3 + G.I. (Annoyed Grunt) S18E5 + Ice Cream of Margie (with the Light Blue Hair) S18E7 + Kill Gil, Volumes I & II S18E9 + Little Big Girl S18E12 + Yokel Chords S18E14 + Homerazzi S18E16 + Crook and Ladder S18E19 + 24 Minutes S18E21 + The Homer of Seville S19E2 + Little Orphan Millie S19E6 + Funeral for a Fiend S19E8 + E Pluribus Wiggum S19E10 + The Debarted S19E13 + Smoke on the Daughter S19E15 + Apocalypse Cow S19E17 + Mona Leaves-a S19E19 + Lost Verizon S20E2 + Treehouse of Horror XIX S20E4 + So It's Come to This: A Simpsons Clip Show S4E18 + Gone Maggie Gone S20E13 + Father Knows Worst S20E18 + Four Great Women and a Manicure S20E20 + Homer the Whopper S21E1 + Rednecks and Broomsticks S21E7 + Thursdays with Abie S21E9 + Million Dollar Maybe S21E11 + Postcards from the Wedge S21E14 + The Greatest Story Ever D'ohed S21E16 + Moe Letter Blues S21E21 + Judge Me Tender S21E23 + Loan-a Lisa S22E2 + Lisa Simpson, This Isn't Your Life S22E5 + The Fight Before Christmas S22E8 + Donnie Fatso S22E9 + Homer the Father S22E12 + Angry Dad: The Movie S22E14 + A Midsummer's Nice Dream S22E16 + The Great Simpsina S22E18 + 500 Keys S22E21 + The Falcon and the D'ohman S23E1 + Treehouse of Horror XXII S23E3 + The Food Wife S23E5 + The Ten-Per-Cent Solution S23E8 + Politically Inept, with Homer Simpson S23E10 + Moe Goes from Rags to Riches S23E12 + Pranks and Greens S21E6 + $pringfield (or, How I Learned to Stop Worrying and Love Legalized Gambling) S5E10 + Beware My Cheating Bart S23E18 + The Spy Who Learned Me S23E20 + Lisa Goes Gaga S23E22 + Penny-Wiseguys S24E5 + To Cur with Love S24E8 + A Test Before Trying S24E10 + Love is a Many-Splintered Thing S24E12 + Gorgeous Grampa S24E14 + What Animated Women Want S24E17 + Whiskey Business S24E19 + Homerland S25E1 + YOLO S25E4 + The Kid Is All Right S25E6 + White Christmas Blues S25E8 + Specs and the City S25E11 + The Man Who Grew Too Much S25E13 + The War of Art S25E15 + Luca$ S25E17 + Brick Like Me S25E20 + The Yellow Badge of Cowardge S25E22 + The Wreck of the Relationship S26E2 + Opposites A-Frack S26E5 + Blazed and Confused S26E7 + The Man Who Came to Be Dinner S26E10 + The Musk Who Fell to Earth S26E12 + Peeping Mom S26E18 + Life on the Fast Lane S1E9 + The Crepes of Wrath S1E11 + Some Enchanted Evening S1E13 + Simpson and Delilah S2E2 + Treehouse of Horror S2E3 + Dancin' Homer S2E5 + Bart vs. Thanksgiving S2E7 + Itchy & Scratchy & Marge S2E9 + The Way We Was S2E12 + Principal Charming S2E14 + Bart's Dog Gets an "F" S2E16 + The War of the Simpsons S2E20 + Bull-E S26E21 + Cue Detective S27E2 + Friend with Benefit S27E6 + Barthood S27E9 + Teenage Mutant Milk-Caused Hurdles S27E11 + Gal of Constant Sorrow S27E14 + The Marge-ian Chronicles S27E16 + Fland Canyon S27E19 + Simprovised S27E21 + Simpsons Roasting on an Open Fire S1E1 + Bart the Genius S1E2 + There's No Disgrace Like Home S1E4 + Moaning Lisa S1E6 + The Telltale Head S1E8 + Three Men and a Comic Book S2E21 + Stark Raving Dad S3E1 + When Flanders Failed S3E3 + Homer Defined S3E5 + The Front S4E19 + Brother from the Same Planet S4E14 + Treehouse of Horror IV S5E5 + Marge vs. the Monorail S4E12 + I Love Lisa S4E15 + The Last Temptation of Homer S5E9 + Dog of Death S3E19 + Treehouse of Horror II S3E7 + Lisa's Pony S3E8 + Marge Gets a Job S4E7 + I Married Marge S3E12 + Last Exit to Springfield S4E17 + Lisa the Greek S3E14 + The Otto Show S3E22 + Rosebud S5E4 + Homer Alone S3E15 + Homer at the Bat S3E17 + Whacking Day S4E20 + Lisa the Beauty Queen S4E4 + Krusty Gets Kancelled S4E22 + Black Widower S3E21 + A Streetcar Named Marge S4E2 + Treehouse of Horror III S4E5 + Mr. Plow S4E9 + Homer and Apu S5E13 + Homer Loves Flanders S5E16 + Burns' Heir S5E18 + Sideshow Bob's Last Gleaming S7E9 + Grampa vs. Sexual Inadequacy S6E10 + A Fish Called Selma S7E19 + Bart's Comet S6E14 + Home Sweet Homediddly-Dum-Doodily S7E3 + Scenes from the Class Struggle in Springfield S7E14 + Bart vs. Australia S6E16 + King-Size Homer S7E7 + Secrets of a Successful Marriage S5E22 + Lisa's Rival S6E2 + A Star Is Burns S6E18 + Lisa's Wedding S6E19 + Another Simpsons Clip Show S6E3 + Lisa the Vegetarian S7E5 + The PTA Disbands S6E21 + Sideshow Bob Roberts S6E5 + Bart's Girlfriend S6E7 + Who Shot Mr. Burns? (Part Two) S7E1 + The Springfield Connection S6E23 + Homer the Smithers S7E17 + Homer Badman S6E9 + Homer the Great S6E12 + The Simpsons 138th Episode Spectacular S7E10 + Two Bad Neighbors S7E13 + Lisa the Iconoclast S7E16 + Mother Simpson S7E8 + Raging Abe Simpson and His Grumbling Grandson in "The Curse of the Flying Hellfish" S7E22 + Homerpalooza S7E24 + Lisa's Sax S9E3 + Simpsoncalifragilisticexpiala(Annoyed Grunt)cious S8E13 + Treehouse of Horror VII S8E1 + Brother from Another Series S8E16 + The Homer They Fall S8E3 + Bart After Dark S8E5 + Lost Our Lisa S9E24 + Girly Edition S9E21 + Realty Bites S9E9 + The Old Man and the Lisa S8E21 + A Milhouse Divided S8E6 + My Sister, My Sitter S8E17 + The Last Temptation of Krust S9E15 + The Cartridge Family S9E5 + Grade School Confidential S8E19 + Simpson Tide S9E19 + The Simpsons Spin-Off Showcase S8E24 + The City of New York vs. Homer Simpson S9E1 + Miracle on Evergreen Terrace S9E10 + King of the Hill S9E23 + Das Bus S9E14 + Lard of the Dance S10E1 + Bart Carny S9E12 + Lisa the Simpson S9E17 + The Day the Violence Died S7E18 + When You Dish Upon a Star S10E5 + Lisa Gets an "A" S10E7 + Homer Simpson in: "Kidney Trouble" S10E8 + Lisa the Tree Hugger S12E4 + Sunday, Cruddy Sunday S10E12 + Maximum Homerdrive S10E17 + Hello Gutter, Hello Fadder S11E6 + Simpsons Bible Stories S10E18 + Tennis the Menace S12E12 + Viva Ned Flanders S10E10 + Treehouse of Horror X S11E4 + Last Tap Dance in Springfield S11E20 + Brother's Little Helper S11E2 + The Old Man and the "C" Student S10E20 + Bart to the Future S11E17 + Beyond Blunderdome S11E1 + They Saved Lisa's Brain S10E22 + Homer to the Max S10E13 + Take My Wife, Sleaze S11E8 + Little Big Mom S11E10 + Faith Off S11E11 + Worst Episode Ever S12E11 + Saddlesore Galactica S11E13 + Behind the Laughter S11E22 + The Great Money Caper S12E7 + Missionary: Impossible S11E15 + Days of Wine and D'oh'ses S11E18 + Bart on the Road S7E20 + Bye, Bye, Nerdie S12E16 + I'm Goin' to Praiseland S12E19 + Simpsons Tall Tales S12E21 + I Am Furious (Yellow) S13E18 + The Sweetest Apu S13E19 + The President Wore Pearls S15E3 + The Parent Rap S13E2 + Weekend at Burnsie's S13E16 + Large Marge S14E4 + The Bart Wants What It Wants S13E11 + Mr. Spritz Goes to Washington S14E14 + A Hunka Hunka Burns in Love S13E4 + How I Spent My Strummer Vacation S14E2 + She of Little Faith S13E6 + Helter Shelter S14E5 + Tales from the Public Domain S13E14 + The Strong Arms of the Ma S14E9 + Brawl in the Family S13E7 + Jaws Wired Shut S13E9 + Little Girl in the Big Ten S13E20 + Old Yeller-Belly S14E19 + Special Edna S14E7 + Barting Over S14E11 + Dude, Where's My Ranch? S14E18 + The Bart of War S14E21 + Treehouse of Horror XIV S15E1 + Mountain of Madness S8E12 + Today I Am a Clown S15E6 + Marge vs. Singles, Seniors, Childless Couples and Teens and Gays S15E8 + Diatribe of a Mad Housewife S15E10 + All's Fair in Oven War S16E2 + Bart-Mangled Banner S15E21 + A Star Is Torn S16E18 + See Homer Run S17E6 + Milhouse Doesn't Live Here Anymore S15E12 + The Ziff Who Came to Dinner S15E14 + Homer and Ned's Hail Mary Pass S16E8 + The Girl Who Slept Too Little S17E2 + The Wandering Juvie S15E16 + Milhouse of Sand and Fog S17E3 + Treehouse of Horror XVI S17E4 + Homer's Paternity Coot S17E10 + She Used to Be My Girl S16E4 + My Big Fat Geek Wedding S15E17 + Future-Drama S16E15 + The Italian Bob S17E8 + Simple Simpson S15E19 + We're on the Road to D'ohwhere S17E11 + On a Clear Day I Can't See My Sister S16E11 + Home Away from Homer S16E20 + Treehouse of Horror XV S16E1 + Midnight Rx S16E6 + Pranksta Rap S16E9 + Dumbbell Indemnity S9E16 + Girls Just Want to Have Sums S17E19 + The Monkey Suit S17E21 + The Boys of Bummer S18E18 + Treehouse of Horror XVIII S19E5 + Rome-Old and Juli-Eh S18E15 + Papa Don't Leech S19E16 + Marge and Homer Turn a Couple Play S17E22 + The Wife Aquatic S18E10 + Double, Double, Boy in Trouble S20E3 + Treehouse of Horror XVII S18E4 + That '90s Show S19E11 + The Burns and the Bees S20E8 + Moe'N'a Lisa S18E6 + The Haw-Hawed Couple S18E8 + Husbands and Knives S19E7 + All About Lisa S19E20 + You Kent Always Say What You Want S18E22 + Dangerous Curves S20E5 + Springfield Up S18E13 + Revenge Is a Dish Best Served Three Times S18E11 + Marge Gamer S18E17 + Stop! Or My Dog Will Shoot S18E20 + Dial 'N' for Nerder S19E14 + Love, Springfieldian Style S19E12 + MyPods and Boomsticks S20E7 + Sex, Pies and Idiot Scrapes S20E1 + Any Given Sundance S19E18 + Bart the Mother S10E3 + Take My Life, Please S20E10 + No Loan Again, Naturally S20E12 + Elementary School Musical S22E1 + Waverly Hills, 9-0-2-1-D'oh S20E19 + The Bob Next Door S21E22 + The Good, the Sad and the Drugly S20E17 + Once Upon a Time in Springfield S21E10 + Bart Gets a 'Z' S21E2 + Eeny Teeny Maya Moe S20E16 + Chief of Hearts S21E18 + The Great Wife Hope S21E3 + To Surveil with Love S21E20 + The Scorpion's Tale S22E15 + The Blue and the Gray S22E13 + The Color Yellow S21E13 + The Fool Monty S22E6 + O Brother, Where Bart Thou? S21E8 + Boy Meets Curl S21E12 + Love Is a Many Strangled Thing S22E17 + The Devil Wears Nada S21E5 + Homer Scissorhands S22E20 + Stealing First Base S21E15 + How Munched is That Birdie in the Window? S22E7 + The Real Housewives of Fat Tony S22E19 + Moms I'd Like to Forget S22E10 + MoneyBart S22E3 + Flaming Moe S22E11 + I'm with Cupid S10E14 + Bart Stops to Smell the Roosevelts S23E2 + Replaceable You S23E4 + The D'oh-cial Network S23E11 + Married to the Blob S25E10 + Ned 'n Edna's Blend S23E21 + Gone Abie Gone S24E4 + Homer Goes to Prep School S24E9 + Four Regrettings and a Funeral S25E3 + Yellow Subterfuge S25E7 + A Totally Fun Thing That Bart Will Never Do Again S23E19 + The Book Job S23E6 + The Daughter Also Rises S23E13 + Steal This Episode S25E9 + Exit Through the Kwik-E-Mart S23E15 + Black Eyed, Please S24E15 + Them, Robot S23E17 + Treehouse of Horror XXIV S25E2 + Pulpit Friction S24E18 + The Changing of the Guardian S24E11 + Moonshine River S24E1 + A Tree Grows in Springfield S24E6 + Treehouse of Horror XXIII S24E2 + The Day the Earth Stood Cool S24E7 + Hardly Kirk-ing S24E13 + The Fabulous Faker Boy S24E20 + Labor Pains S25E5 + Dangers on a Train S24E22 + Marge Simpson in: "Screaming Yellow Honkers" S10E15 + The Winter of His Content S25E14 + What to Expect When Bart's Expecting S25E19 + Covercraft S26E8 + Walking Big & Tall S26E13 + Treehouse of Horror XXVI S27E5 + The Girl Code S27E10 + Pay Pal S25E21 + Every Man's Dream S27E1 + Let's Go Fly a Coot S26E20 + Waiting for Duffman S26E17 + Lisa with an 'S' S27E7 + Bart's New Friend S26E11 + Love Is in the N2-O2-Ar-CO2-Ne-He-CH4 S27E13 + The Kids Are All Fight S26E19 + Sky Police S26E16 + Clown in the Dumps S26E1 + Super Franchise Me S26E3 + Much Apu About Something S27E12 + I Won't Be Home for Christmas S26E9 + Treehouse of Horror XXV S26E4 + My Fare Lady S26E14 + The Burns Cage S27E17 + Mathlete's Feat S26E22 + Lisa the Veterinarian S27E15 + Paths of Glory S27E8 + Puffless S27E3 + Brush with Greatness S2E18 + Flaming Moe's S3E10 + Bart the General S1E5 + Brother, Can You Spare Two Dimes? S3E24 + Homer the Heretic S4E3 + Cape Feare S5E2 + Bart's Inner Child S5E7 + Deep Space Homer S5E15 + Sweet Seymour Skinner's Baadasssss Song S5E19 + The Boy Who Knew Too Much S5E20 + Treehouse of Horror V S6E6 + Who Shot Mr. Burns? (Part One) S6E25 + You Only Move Twice S8E2 + El Viaje Misterioso de Nuestro Jomer (The Mysterious Voyage of Homer) S8E9 + Homer's Enemy S8E23 + Treehouse of Horror VIII S9E4 + The Two Mrs. Nahasapeemapetilons S9E7 + D'oh-in' in the Wind S10E6 + Skinner's Sense of Snow S12E8 + HOMR S12E9 + Trilogy of Error S12E18 + Poppa's Got a Brand New Badge S13E22 + Treehouse of Horror XIII S14E1 + Holidays of Future Passed S23E9 + Simpsorama S26E6 + Halloween of Horror S27E4 + To Courier with Love S27E20 + Homer's Odyssey S1E3 + Grift of the Magi S11E9 + A Tale of Two Springfields S12E2 + Homer vs. Dignity S12E5 + The Old Man and the Key S13E13 + 'Scuse Me While I Miss the Sky S14E16 + Margical History Tour S15E11 + Mobile Homer S16E13 + Don't Fear the Roofer S16E16 + The Seemingly Never-Ending Story S17E13 + Homer Simpson, This Is Your Wife S17E15 + The Wettest Stories Ever Told S17E18 + Midnight Towboy S19E3 + Homer and Lisa Exchange Cross Words S20E6 + Coming to Homerica S20E21 + Treehouse of Horror XX S21E4 + American History X-cellent S21E17 + The Squirt and the Whale S21E19 + Treehouse of Horror XXI S22E4 + The Man in the Blue Flannel Pants S23E7 + Dark Knight Court S24E16 + The Saga of Carl S24E21 + You Don't Have to Live Like a Referee S25E16 + The Princess Guide S26E15 + How Lisa Got Her Marge Back S27E18 + Orange Is the New Yellow S27E22 + Monty Burns' Fleeing Circus S28E1 + New Kids on the Blecch S12E14 + Sweets and Sour Marge S13E8 + The Frying Game S13E21 + I'm Spelling As Fast As I Can S14E12 + A Star Is Born-Again S14E13 + The Regina Monologues S15E4 + The Father, the Son, and the Holy Guest Star S16E21 + Marge's Son Poisoning S17E5 + Kiss Kiss, Bang Bangalore S17E17 + Jazzy and the Pussycats S18E2 + He Loves to Fly and He D'ohs S19E1 + I Don't Wanna Know Why the Caged Bird Sings S19E4 + Eternal Moonshine of the Simpson Mind S19E9 + Lisa the Drama Queen S20E9 + How the Test Was Won S20E11 + In the Name of the Grandfather S20E14 + Wedding for Disaster S20E15 + The Ned-Liest Catch S22E22 + At Long Last Leave S23E14 + How I Wet Your Mother S23E16 + Adventures in Baby-Getting S24E3 + Diggs S25E12 + Days of Future Future S25E18 \ No newline at end of file diff --git a/test/output/singleValueBar.svg b/test/output/singleValueBar.svg index c7fbede9c3..83f51c40c2 100644 --- a/test/output/singleValueBar.svg +++ b/test/output/singleValueBar.svg @@ -13,15 +13,17 @@ white-space: pre; } - - - 0 - + + - - - foo - + + 0 + + + + + + foo diff --git a/test/output/singleValueBin.svg b/test/output/singleValueBin.svg index 04e46114fc..e17717ef90 100644 --- a/test/output/singleValueBin.svg +++ b/test/output/singleValueBin.svg @@ -13,45 +13,40 @@ white-space: pre; } - - - 0.0 - - - 0.1 - - - 0.2 - - - 0.3 - - - 0.4 - - - 0.5 - - - 0.6 - - - 0.7 - - - 0.8 - - - 0.9 - - - 1.0 - ↑ Frequency + + + + + + + + + + + + - - - 3 - + + 0.0 + 0.1 + 0.2 + 0.3 + 0.4 + 0.5 + 0.6 + 0.7 + 0.8 + 0.9 + 1.0 + + + ↑ Frequency + + + + + + 3 diff --git a/test/output/softwareVersions.svg b/test/output/softwareVersions.svg index 20e98bdd8a..adf56250b6 100644 --- a/test/output/softwareVersions.svg +++ b/test/output/softwareVersions.svg @@ -13,40 +13,34 @@ white-space: pre; } - - - 0 - - - 10 - - - 20 - - - 30 - - - 40 - - - 50 - - - 60 - - - 70 - - - 80 - - - 90 - - - 100 - Frequency (%) → + + + + + + + + + + + + + + + 0 + 10 + 20 + 30 + 40 + 50 + 60 + 70 + 80 + 90 + 100 + + + Frequency (%) → @@ -57,7 +51,15 @@ - 348368429359369381324 + + 348 + 368 + 429 + 359 + 369 + 381 + 324 + diff --git a/test/output/sparseCell.svg b/test/output/sparseCell.svg index 4abf1b7022..0248419c8e 100644 --- a/test/output/sparseCell.svg +++ b/test/output/sparseCell.svg @@ -13,209 +13,173 @@ white-space: pre; } - - - - 1 - - - - 2 - - - - 3 - - - - 4 - - - - 5 - - - - 6 - - - - 7 - - - - 8 - - - - 9 - - - - 10 - - - - 11 - - - - 12 - - - - 13 - - - - 14 - - - - 15 - - - - 16 - - - - 17 - - - - 18 - - - - 19 - - - - 20 - - - - 21 - - - - 22 - - - - 23 - - - - 24 - - - - 25 - - - - 26 - - - - 27 - - - - 28 - Season + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - 1 - - - - 2 - - - - 3 - - - - 4 - - - - 5 - - - - 6 - - - - 7 - - - - 8 - - - - 9 - - - - 10 - - - - 11 - - - - 12 - - - - 13 - - - - 14 - - - - 15 - - - - 16 - - - - 17 - - - - 18 - - - - 19 - - - - 20 - - - - 21 - - - - 22 - Episode + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 1 + 2 + 3 + 4 + 5 + 6 + 7 + 8 + 9 + 10 + 11 + 12 + 13 + 14 + 15 + 16 + 17 + 18 + 19 + 20 + 21 + 22 + 23 + 24 + 25 + 26 + 27 + 28 + + + Season + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 1 + 2 + 3 + 4 + 5 + 6 + 7 + 8 + 9 + 10 + 11 + 12 + 13 + 14 + 15 + 16 + 17 + 18 + 19 + 20 + 21 + 22 + + + Episode @@ -255,5 +219,42 @@ - 8.2Simpsons Roasting on an Open Fire7.8Bart the Genius7.5Homer's Odyssey7.8There's No Disgrace Like Home8.1Bart the General7.6Moaning Lisa7.9The Call of the Simpsons7.7The Telltale Head7.5Life on the Fast Lane7.4Homer's Night Out7.8The Crepes of Wrath8.3Krusty Gets Busted7.9Some Enchanted Evening8.2Bart Gets an "F"8.3Simpson and Delilah8.2Treehouse of Horror8.1Two Cars in Every Garage and Three Eyes on Every Fish7.5Dancin' Homer8.0Dead Putting Society7.7Bart vs. Thanksgiving8.4Bart the Daredevil8.1Itchy & Scratchy & Marge7.8Bart Gets Hit by a Car8.8One Fish, Two Fish, Blowfish, Blue Fish8.2The Way We Was8.0Homer vs. Lisa and the 8th Commandment6.5The Burns Cage6.4How Lisa Got Her Marge Back7.1Fland Canyon6.7To Courier with Love6.4Simprovised6.9Orange Is the New Yellow6.6Monty Burns' Fleeing Circus-Friends and Family"[203]-The Town"[205]-Treehouse of Horror XXVII"[207] + + 8.2Simpsons Roasting on an Open Fire + 7.8Bart the Genius + 7.5Homer's Odyssey + 7.8There's No Disgrace Like Home + 8.1Bart the General + 7.6Moaning Lisa + 7.9The Call of the Simpsons + 7.7The Telltale Head + 7.5Life on the Fast Lane + 7.4Homer's Night Out + 7.8The Crepes of Wrath + 8.3Krusty Gets Busted + 7.9Some Enchanted Evening + 8.2Bart Gets an "F" + 8.3Simpson and Delilah + 8.2Treehouse of Horror + 8.1Two Cars in Every Garage and Three Eyes on Every Fish + 7.5Dancin' Homer + 8.0Dead Putting Society + 7.7Bart vs. Thanksgiving + 8.4Bart the Daredevil + 8.1Itchy & Scratchy & Marge + 7.8Bart Gets Hit by a Car + 8.8One Fish, Two Fish, Blowfish, Blue Fish + 8.2The Way We Was + 8.0Homer vs. Lisa and the 8th Commandment + 6.5The Burns Cage + 6.4How Lisa Got Her Marge Back + 7.1Fland Canyon + 6.7To Courier with Love + 6.4Simprovised + 6.9Orange Is the New Yellow + 6.6Monty Burns' Fleeing Circus + -Friends and Family"[203] + -The Town"[205] + -Treehouse of Horror XXVII"[207] + \ No newline at end of file diff --git a/test/output/stackedBar.svg b/test/output/stackedBar.svg index fce016e64a..ed6af12c55 100644 --- a/test/output/stackedBar.svg +++ b/test/output/stackedBar.svg @@ -13,40 +13,31 @@ white-space: pre; } - - - 0% - - - 10% - - - 20% - - - 30% - - - 40% - - - 50% - - - 60% - - - 70% - - - 80% - - - 90% - - - 100% - + + + + + + + + + + + + + + + 0% + 10% + 20% + 30% + 40% + 50% + 60% + 70% + 80% + 90% + 100% diff --git a/test/output/stackedRect.svg b/test/output/stackedRect.svg index f9ff0be912..724ea2930a 100644 --- a/test/output/stackedRect.svg +++ b/test/output/stackedRect.svg @@ -13,40 +13,31 @@ white-space: pre; } - - - 0% - - - 10% - - - 20% - - - 30% - - - 40% - - - 50% - - - 60% - - - 70% - - - 80% - - - 90% - - - 100% - + + + + + + + + + + + + + + + 0% + 10% + 20% + 30% + 40% + 50% + 60% + 70% + 80% + 90% + 100% diff --git a/test/output/stargazers.svg b/test/output/stargazers.svg index 23f79d06d1..d649ab397c 100644 --- a/test/output/stargazers.svg +++ b/test/output/stargazers.svg @@ -13,74 +13,65 @@ white-space: pre; } - - - - 0 - - - - 100 - - - - 200 - - - - 300 - - - - 400 - - - - 500 - - - - 600 - - - - 700 - - - - 800 - - - - 900 - - - - 1,000 - ↑ Stargazers + + + + + + + + + + + + + + + + + + + + + + + + + + + + 0 + 100 + 200 + 300 + 400 + 500 + 600 + 700 + 800 + 900 + 1,000 - - - December - - - 2021 - - - February - - - March - - - April - - - May - - - June - + + ↑ Stargazers + + + + + + + + + + + + December + 2021 + February + March + April + May + June @@ -88,5 +79,7 @@ - 1,096 + + 1,096 + \ No newline at end of file diff --git a/test/output/stargazersBinned.svg b/test/output/stargazersBinned.svg index 95a82ba045..b85fbac89e 100644 --- a/test/output/stargazersBinned.svg +++ b/test/output/stargazersBinned.svg @@ -13,123 +13,93 @@ white-space: pre; } - - - - 0 - - - - 50 - - - - 100 - - - - 150 - - - - 200 - - - - 250 - - - - 300 - - - - 350 - - - - 400 - - - - 450 - - - - 500 - - - - 550 - - - - 600 - ↑ Stargazers added per week + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 0 + 50 + 100 + 150 + 200 + 250 + 300 + 350 + 400 + 450 + 500 + 550 + 600 + + + ↑ Stargazers added per week + + + + + + + + + + - - - November - - - December - - - 2021 - - - February - - - March - - - April - - - May - - - June - + + November + December + 2021 + February + March + April + May + June - - 2020-11-01 to 2020-11-08 - 2 - - - 2020-11-15 to 2020-11-22 - 1 - - - 2021-05-02 to 2021-05-09 - 624 - - - 2021-05-09 to 2021-05-16 - 138 - - - 2021-05-16 to 2021-05-23 - 69 - - - 2021-05-23 to 2021-05-30 - 40 - - - 2021-05-30 to 2021-06-06 - 49 - - - 2021-06-06 to 2021-06-13 - 124 - - - 2021-06-13 to 2021-06-20 - 50 - + 2020-11-01 to 2020-11-08 + 2 + 2020-11-15 to 2020-11-22 + 1 + 2021-05-02 to 2021-05-09 + 624 + 2021-05-09 to 2021-05-16 + 138 + 2021-05-16 to 2021-05-23 + 69 + 2021-05-23 to 2021-05-30 + 40 + 2021-05-30 to 2021-06-06 + 49 + 2021-06-06 to 2021-06-13 + 124 + 2021-06-13 to 2021-06-20 + 50 diff --git a/test/output/stargazersHourly.svg b/test/output/stargazersHourly.svg index a660b09907..fcf3e6e5c4 100644 --- a/test/output/stargazersHourly.svg +++ b/test/output/stargazersHourly.svg @@ -13,98 +13,84 @@ white-space: pre; } - - - - 0 - - - - 20 - - - - 40 - - - - 60 - - - - 80 - - - - 100 - - - - 120 - - - - 140 - - - - 160 - - - - 180 - - - - 200 - - - - 220 - - - - 240 - - - - 260 - ↑ Frequency + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 0 + 20 + 40 + 60 + 80 + 100 + 120 + 140 + 160 + 180 + 200 + 220 + 240 + 260 + + + ↑ Frequency + + + + + + + + + + + + + + + + 1 + 2 + 3 + 4 + 5 + 6 + 7 + 8 + 9 + 10+ - - - 1 - - - 2 - - - 3 - - - 4 - - - 5 - - - 6 - - - 7 - - - 8 - - - 9 - - - 10+ - - - - New stargazers per hour → + + New stargazers per hour → diff --git a/test/output/stargazersHourlyGroup.svg b/test/output/stargazersHourlyGroup.svg index e62fd4c350..04891e747f 100644 --- a/test/output/stargazersHourlyGroup.svg +++ b/test/output/stargazersHourlyGroup.svg @@ -13,223 +13,127 @@ white-space: pre; } - - - - 0 - - - - 20 - - - - 40 - - - - 60 - - - - 80 - - - - 100 - - - - 120 - - - - 140 - - - - 160 - - - - 180 - - - - 200 - - - - 220 - - - - 240 - - - - 260 - ↑ Frequency + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 0 + 20 + 40 + 60 + 80 + 100 + 120 + 140 + 160 + 180 + 200 + 220 + 240 + 260 + + + ↑ Frequency + + + + + + + + + + + + + + + + 1 + 2 + 3 + 4 + 5 + 6 + 7 + 8 + 9 + 10+ - - - 1 - - - 2 - - - 3 - - - 4 - - - 5 - - - 6 - - - 7 - - - 8 - - - 9 - - - 10+ - - - - New stargazers per hour → + + New stargazers per hour → - - S (38) - - - S (12) - - - S (4) - - - M (52) - - - M (15) - - - M (1) - - - M (1) - - - T (43) - - - T (7) - - - T (6) - - - T (1) - - - T (1) - - - T (1) - - - T (9) - - - W (36) - - - W (8) - - - W (3) - - - W (2) - - - W (2) - - - W (2) - - - W (3) - - - W (2) - - - W (11) - - - T (29) - - - T (15) - - - T (6) - - - T (5) - - - T (2) - - - T (1) - - - T (1) - - - F (29) - - - F (17) - - - F (8) - - - F (5) - - - F (2) - - - F (1) - - - F (1) - - - F (1) - - - S (46) - - - S (8) - - - S (2) - + S (38) + S (12) + S (4) + M (52) + M (15) + M (1) + M (1) + T (43) + T (7) + T (6) + T (1) + T (1) + T (1) + T (9) + W (36) + W (8) + W (3) + W (2) + W (2) + W (2) + W (3) + W (2) + W (11) + T (29) + T (15) + T (6) + T (5) + T (2) + T (1) + T (1) + F (29) + F (17) + F (8) + F (5) + F (2) + F (1) + F (1) + F (1) + S (46) + S (8) + S (2) diff --git a/test/output/stocksIndex.svg b/test/output/stocksIndex.svg index ef80d3f348..2d335d9f8d 100644 --- a/test/output/stocksIndex.svg +++ b/test/output/stocksIndex.svg @@ -13,64 +13,58 @@ white-space: pre; } - - - - −40 - - - - −30 - - - - −20 - - - - −10 - - - - +0 - - - - +100 - - - - +200 - - - - +300 - - - - +400 - - - - +500 - ↑ Change in price (%) + + + + + + + + + + + + + + + + + + + + + + + + + + −40 + −30 + −20 + −10 + +0 + +100 + +200 + +300 + +400 + +500 - - - 2014 - - - 2015 - - - 2016 - - - 2017 - - - 2018 - + + ↑ Change in price (%) + + + + + + + + + + 2014 + 2015 + 2016 + 2017 + 2018 @@ -81,5 +75,10 @@ - AAPLAMZNGOOGIBM + + AAPL + AMZN + GOOG + IBM + \ No newline at end of file diff --git a/test/output/thisIsJustToSay.svg b/test/output/thisIsJustToSay.svg index 1880b1f9ad..5de26ce175 100644 --- a/test/output/thisIsJustToSay.svg +++ b/test/output/thisIsJustToSay.svg @@ -14,5 +14,7 @@ } - This Is Just To SayWilliam Carlos Williams, 1934I have eatenthe plumsthat were inthe iceboxand whichyou were probablysavingfor breakfastForgive methey were deliciousso sweetand so cold + + This Is Just To SayWilliam Carlos Williams, 1934I have eatenthe plumsthat were inthe iceboxand whichyou were probablysavingfor breakfastForgive methey were deliciousso sweetand so cold + \ No newline at end of file diff --git a/test/output/trafficHorizon.html b/test/output/trafficHorizon.html index 774a722588..d4f3b1eb65 100644 --- a/test/output/trafficHorizon.html +++ b/test/output/trafficHorizon.html @@ -55,1677 +55,1743 @@ white-space: pre; } - - - Mon 04 + + + + + + + + + + + + + + + + + Mon 04 + 12 PM + Tue 05 + 12 PM + Wed 06 + 12 PM + Thu 07 + 12 PM + Fri 08 + 12 PM + Sat 09 + 12 PM - - 12 PM - - - Tue 05 - - - 12 PM - - - Wed 06 - - - 12 PM - - - Thu 07 - - - 12 PM - - - Fri 08 - - - 12 PM - - - Sat 09 - - - 12 PM - - - - + - + - + - + - + - + - + - + - + - + - Von der Heydt + + Von der Heydt + - + - + - + - + - + - + - + - + - + - + - + - Kirschheck + + Kirschheck + - + - + - + - + - + - + - + - + - + - + - + - Saarbrücken-Neuhaus + + Saarbrücken-Neuhaus + - + - + - + - + - + - + - + - + - + - + - + - Riegelsberg + + Riegelsberg + - + - + - + - + - + - + - + - + - + - + - + - Holz + + Holz + - + - + - + - + - + - + - + - + - + - + - + - Göttelborn + + Göttelborn + - + - + - + - + - + - + - + - + - + - + - + - Illingen + + Illingen + - + - + - + - + - + - + - + - + - + - + - + - AS Eppelborn + + AS Eppelborn + - + - + - + - + - + - + - + - + - + - + - + - Hasborn + + Hasborn + - + - + - + - + - + - + - + - + - + - + - + - Kastel + + Kastel + - + - + - + - + - + - + - + - + - + - + - + - Otzenhausen + + Otzenhausen + - + - + - + - + - + - + - + - + - + - + - + - Bierfeld + + Bierfeld + - + - + - + - + - + - + - + - + - + - + - + - Nonnweiler + + Nonnweiler + - + - + - + - + - + - + - + - + - + - + - + - Hetzerath + + Hetzerath + - + - + - + - + - + - + - + - + - + - + - + - Laufeld + + Laufeld + - + - + - + - + - + - + - + - + - + - + - + - Nettersheim + + Nettersheim + - + - + - + - + - + - + - + - + - + - + - + - Euskirchen/Bliesheim + + Euskirchen/Bliesheim + - + - + - + - + - + - + - + - + - + - + - + - Hürth + + Hürth + - + - + - + - + - + - + - + - + - + - + - + - Köln-Nord + + Köln-Nord + - + - + - + - + - + - + - + - + - + - + - + - Schloss Burg + + Schloss Burg + - + - + - + - + - + - + - + - + - + - + - + - Hagen-Vorhalle + + Hagen-Vorhalle + - + - + - + - + - + - + - + - + - + - + - + - Hengsen + + Hengsen + - + - + - + - + - + - + - + - + - + - + - + - Unna + + Unna + - + - + - + - + - + - + - + - + - + - + - + - Ascheberg + + Ascheberg + - + - + - + - + - + - + - + - + - + - + - + - Ladbergen + + Ladbergen + - + - + - + - + - + - + - + - + - + - + - + - Lotte + + Lotte + - + - + - + - + - + - + - + - + - + - + - + - HB-Silbersee + + HB-Silbersee + - + - + - + - + - + - + - + - + - + - + - + - HB-Weserbrücke + + HB-Weserbrücke + - + - + - + - + - + - + - + - + - + - + - + - HB-Mahndorfer See + + HB-Mahndorfer See + - + - + - + - + - + - + - + - + - + - + - + - Groß Ippener + + Groß Ippener + - + - + - + - + - + - + - + - + - + - + - + - Uphusen + + Uphusen + - + - + - + - + - + - + - + - + - + - + - + - Bockel + + Bockel + - + - + - + - + - + - + - + - + - + - + - + - Dibbersen + + Dibbersen + - + - + - + - + - + - + - + - + - + - + - + - Glüsingen + + Glüsingen + - + - + - + - + - + - + - + - + - + - + - + - Barsbüttel + + Barsbüttel + - + - + - + - + - + - + - + - + - + - + - + - Bad Schwartau + + Bad Schwartau + - + - + - + - + - + - + - + - + - + - + - + - Oldenburg (Holstein) + + Oldenburg (Holstein) + - + - + - + - + - + - + - + - + - + - + - + - Neustadt i. H.-Süd + + Neustadt i. H.-Süd + \ No newline at end of file diff --git a/test/output/travelersCovidDrop.svg b/test/output/travelersCovidDrop.svg index ecba6a8a4e..bb821a9386 100644 --- a/test/output/travelersCovidDrop.svg +++ b/test/output/travelersCovidDrop.svg @@ -13,79 +13,68 @@ white-space: pre; } - - - - −90% - - - - −80% - - - - −70% - - - - −60% - - - - −50% - - - - −40% - - - - −30% - - - - −20% - - - - −10% - - - - 0% - ↓ Drop in passenger throughput (2020 vs. 2019) + + + + + + + + + + + - - - March - - - April - - - May - - - June - - - July - - - August - - - September - - - October - - - November - - - December - + + + + + + + + + + + + + + −90% + −80% + −70% + −60% + −50% + −40% + −30% + −20% + −10% + 0% + + + ↓ Drop in passenger throughput (2020 vs. 2019) + + + + + + + + + + + + + + + March + April + May + June + July + August + September + October + November + December diff --git a/test/output/travelersYearOverYear.svg b/test/output/travelersYearOverYear.svg index 1b9bc5d6d7..df259a5e29 100644 --- a/test/output/travelersYearOverYear.svg +++ b/test/output/travelersYearOverYear.svg @@ -13,103 +13,86 @@ white-space: pre; } - - - - 0.0 - - - - 0.2 - - - - 0.4 - - - - 0.6 - - - - 0.8 - - - - 1.0 - - - - 1.2 - - - - 1.4 - - - - 1.6 - - - - 1.8 - - - - 2.0 - - - - 2.2 - - - - 2.4 - - - - 2.6 - - - - 2.8 - - - - 3.0 - ↑ Travelers per day (millions) + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 0.0 + 0.2 + 0.4 + 0.6 + 0.8 + 1.0 + 1.2 + 1.4 + 1.6 + 1.8 + 2.0 + 2.2 + 2.4 + 2.6 + 2.8 + 3.0 + + + ↑ Travelers per day (millions) - - - March - - - April - - - May - - - June - - - July - - - August - - - September - - - October - - - November - - - December - + + + + + + + + + + + + + + March + April + May + June + July + August + September + October + November + December @@ -120,6 +103,10 @@ - 2019 - 2020 + + 2019 + + + 2020 + \ No newline at end of file diff --git a/test/output/uniformRandomDifference.svg b/test/output/uniformRandomDifference.svg index 4a9183ccdb..9f9b5d4f53 100644 --- a/test/output/uniformRandomDifference.svg +++ b/test/output/uniformRandomDifference.svg @@ -13,86 +13,76 @@ white-space: pre; } - - - - 0.0 - - - - 0.5 - - - - 1.0 - - - - 1.5 - - - - 2.0 - - - - 2.5 - - - - 3.0 - - - - 3.5 - - - - 4.0 - - - - 4.5 - - - - 5.0 - ↑ Frequency (%) + + + + + + + + + + + + + + + + + + + + + + + + + + + + 0.0 + 0.5 + 1.0 + 1.5 + 2.0 + 2.5 + 3.0 + 3.5 + 4.0 + 4.5 + 5.0 + + + ↑ Frequency (%) + + + + + + + + + + + + + + + + −1.0 + −0.8 + −0.6 + −0.4 + −0.2 + 0.0 + 0.2 + 0.4 + 0.6 + 0.8 + 1.0 - - - −1.0 - - - −0.8 - - - −0.6 - - - −0.4 - - - −0.2 - - - 0.0 - - - 0.2 - - - 0.4 - - - 0.6 - - - 0.8 - - - 1.0 - Difference of two uniform random variables + + Difference of two uniform random variables diff --git a/test/output/untypedDateBin.svg b/test/output/untypedDateBin.svg index 195f107b1f..5faafc89cc 100644 --- a/test/output/untypedDateBin.svg +++ b/test/output/untypedDateBin.svg @@ -13,57 +13,48 @@ white-space: pre; } - - - 0 - - - 200 - - - 400 - - - 600 - - - 800 - - - 1,000 - - - 1,200 - - - 1,400 - - - 1,600 - - - 1,800 - - - 2,000 - ↑ Volume + + + + + + + + + + + + - - - 2014 - - - 2015 - - - 2016 - - - 2017 - - - 2018 - + + 0 + 200 + 400 + 600 + 800 + 1,000 + 1,200 + 1,400 + 1,600 + 1,800 + 2,000 + + + ↑ Volume + + + + + + + + + + 2014 + 2015 + 2016 + 2017 + 2018 diff --git a/test/output/usCongressAge.svg b/test/output/usCongressAge.svg index 93b6fb25e0..a2371776ea 100644 --- a/test/output/usCongressAge.svg +++ b/test/output/usCongressAge.svg @@ -13,2724 +13,947 @@ white-space: pre; } - - - - 0 - - - - 5 - - - - 10 - - - - 15 - - - - 20 - - - - 25 - - - - 30 - ↑ Frequency + + + + + + + + + + + + + + + + + + + + 0 + 5 + 10 + 15 + 20 + 25 + 30 + + + ↑ Frequency + + + + + + + + + + + + + 30 + 40 + 50 + 60 + 70 + 80 + 90 + 100 - - - 30 - - - 40 - - - 50 - - - 60 - - - 70 - - - 80 - - - 90 - - - 100 - Age → + + Age → - - Alexandria Ocasio-Cortez - - - Abby Finkenauer - - - Katie Hill - - - Josh Harder - - - Lauren Underwood - - - Max Rose - - - Elise M. Stefanik - - - Mike Gallagher - - - Conor Lamb - - - Joe Neguse - - - Xochitl Torres Small - - - Anthony Gonzalez - - - William R. Timmons IV - - - Dan Crenshaw - - - Patrick Murphy - - - Trey Hollingsworth - - - Haley M. Stevens - - - Guy Reschenthaler - - - Colin Z. Allred - - - Matt Gaetz - - - Andy Kim - - - Joe Cunningham - - - Lance Gooden - - - Jared F. Golden - - - Aaron Schock - - - Tulsi Gabbard - - - Michael F. Q. San Nicolas - - - Ilhan Omar - - - Bryan Steil - - - Carlos Curbelo - - - Ruben J. Kihuen - - - Justin Amash - - - Eric Swalwell - - - Joseph P. Kennedy III - - - Jason Smith - - - Lee M. Zeldin - - - Brian J. Mast - - - Sharice Davids - - - Chris Pappas - - - Scott Taylor - - - Ruben Gallego - - - Pete Aguilar - - - Jim Banks - - - Jason Crow - - - Abigail Davis Spanberger - - - Josh Hawley - - - Ron DeSantis - - - Jaime Herrera Beutler - - - Adam Kinzinger - - - Seth Moulton - - - Stephanie N. Murphy - - - Darren Soto - - - Mike Levin - - - W. Gregory Steube - - - Anthony Brindisi - - - David G. Valadao - - - Tom Cotton - - - Markwayne Mullin - - - Brendan F. Boyle - - - Will Hurd - - - Antonio Delgado - - - Benjamin Quayle - - - Trey Radel - - - Marlin A. Stutzman - - - Kevin Yoder - - - Ryan A. Costello - - - Duncan Hunter - - - Martha Roby - - - Kyrsten Sinema - - - Ro Khanna - - - Nanette Diaz Barragán - - - Jenniffer González-Colón - - - Steve Watkins - - - Elissa Slotkin - - - Rashida Tlaib - - - Kelly Armstrong - - - Kendra S. Horn - - - Dusty Johnson - - - Mike Garcia - - - Jim Bridenstine - - - Jared Polis - - - Mia B. Love - - - Patrick T. McHenry - - - Grace Meng - - - Josh Gottheimer - - - Michael Cloud - - - Lizzie Fletcher - - - Elaine G. Luria - - - Vance M. McAllister - - - André Carson - - - Cory Gardner - - - Joaquin Castro - - - Derek Kilmer - - - Jimmy Gomez - - - Katie Porter - - - Michael Waltz - - - Ayanna Pressley - - - Ben McAdams - - - Dan Boren - - - Jon Runyan - - - Stephen Lee Fincher - - - Christopher Murphy - - - Devin Nunes - - - Cedric L. Richmond - - - Tim Ryan - - - Andy Barr - - - Raja Krishnamoorthi - - - Brian K. Fitzpatrick - - - Steven Horsford - - - Jahana Hayes - - - Russ Fulcher - - - Lori Trahan - - - David W. Jolly - - - Beto O’Rourke - - - Thomas A. Garrett, Jr. - - - Ben Ray Luján - - - Todd Young - - - Brian Schatz - - - Raul Ruiz - - - Garret Graves - - - David Rouzer - - - Ben Sasse - - - James Comer - - - Mike Johnson - - - Jodey C. Arrington - - - Angie Craig - - - Mikie Sherrill - - - Van Taylor - - - Chip Roy - - - Ben Cline - - - Heath Shuler - - - Kristi L. Noem - - - Sean P. Duffy - - - Martin Heinrich - - - Mike Lee - - - Tom Reed - - - Marco Rubio - - - Thomas Massie - - - Richard Hudson - - - Marc A. Veasey - - - Alexander X. Mooney - - - Ted Budd - - - Gilbert Ray Cisneros, Jr. - - - Debbie Mucarsel-Powell - - - Sean Casten - - - Jeffrey M. Landry - - - Michael G. Grimm - - - Frank C. Guinta - - - Todd Rokita - - - Thomas J. Rooney - - - Paul D. Ryan - - - Tom Graves - - - Steven M. Palazzo - - - Adrian Smith - - - Rob Woodall - - - Rodney Davis - - - Hakeem S. Jeffries - - - Ted Cruz - - - Joni Ernst - - - Warren Davidson - - - Greg Stanton - - - Michael Guest - - - Denver Riggleman - - - Kelly Loeffler - - - William M. Cowan - - - Robert Hurt - - - Robert J. Dold - - - Luke Messer - - - Bill Huizenga - - - Cathy McMorris Rodgers - - - Austin Scott - - - Linda T. Sánchez - - - Cory A. Booker - - - Ted Lieu - - - Mark Walker - - - Jimmy Panetta - - - Dean Phillips - - - Veronica Escobar - - - Jason Altmire - - - Tim Griffin - - - Daniel B. Maffei - - - Kelly Ayotte - - - Tim Huelskamp - - - David Young - - - James Lankford - - - Tammy Duckworth - - - George Holding - - - Darin LaHood - - - Jennifer Wexton - - - Kim Schrier - - - Connie Mack - - - Mark Takai - - - Mick Mulvaney - - - Jason Chaffetz - - - Jeff Denham - - - Raúl R. Labrador - - - Mike Bishop - - - Bruce Westerman - - - Vicente Gonzalez - - - Chrissy Houlahan - - - Randy Hultgren - - - Stephen Knight - - - Kirsten E. Gillibrand - - - Kathy Castor - - - Eric A. "Rick" Crawford - - - Theodore E. Deutch - - - Jeff Duncan - - - James A. Himes - - - Daniel Lipinski - - - Debbie Wasserman Schultz - - - Doug Collins - - - Sean Patrick Maloney - - - Stacey E. Plaskett - - - Trent Kelly - - - A. Drew Ferguson IV - - - David Kustoff - - - Liz Cheney - - - Ross Spano - - - Pete Stauber - - - Susie Lee - - - Martha McSally - - - Chris Jacobs - - - Jesse L. Jackson Jr. - - - David Rivera - - - John Sullivan - - - Jeff Chiesa - - - Steve Southerland II - - - Erik Paulsen - - - John Ratcliffe - - - Robert B. Aderholt - - - Rick Larsen - - - Kevin McCarthy - - - Steve Scalise - - - Tim Scott - - - Terri A. Sewell - - - Adam Smith - - - Steve Stivers - - - Ami Bera - - - Norma J. Torres - - - Kathleen M. Rice - - - Pramila Jayapal - - - Cynthia Axne - - - Tom Malinowski - - - John W. Rose - - - Fred Keller - - - Robert T. Schilling - - - Renee L. Ellmers - - - Christopher P. Gibson - - - Trey Gowdy - - - Timothy J. Walz - - - Dave Brat - - - Michael F. Bennet - - - Yvette D. Clarke - - - Scott DesJarlais - - - Brett Guthrie - - - Jim Jordan - - - James R. Langevin - - - Jared Huffman - - - Mark Pocan - - - Dan Sullivan - - - Kamala D. Harris - - - Catherine Cortez Masto - - - Salud O. Carbajal - - - Lloyd Smucker - - - Daniel Meuser - - - Tim Burchett - - - Mark E. Green - - - Dan Bishop - - - Betty Sutton - - - Eric Cantor - - - Mark L. Pryor - - - Mike Rogers - - - Joe Garcia - - - Michael G. Fitzpatrick - - - Gwen Graham - - - Mike Pompeo - - - Keith Ellison - - - Lynn Jenkins - - - John K. Delaney - - - Steve Russell - - - Christopher A. Coons - - - Gus M. Bilirakis - - - Sam Graves - - - Ron Kind - - - Rand Paul - - - Tony Cárdenas - - - Jackie Walorski - - - Filemon Vela - - - Katherine M. Clark - - - Barry Loudermilk - - - Don Bacon - - - TJ Cox - - - Gregory F. Murphy - - - Mark S. Critz - - - Todd Russell Platts - - - Laura Richardson - - - Mark Begich - - - Lee Terry - - - Patrick J. Tiberi - - - Joseph Crowley - - - Jeff Flake - - - Keith J. Rothfus - - - Mimi Walters - - - Karen C. Handel - - - Tammy Baldwin - - - Larry Bucshon - - - Charles J. "Chuck" Fleischmann - - - Michael T. McCaul - - - Pete Olson - - - John P. Sarbanes - - - David Schweikert - - - Suzan K. DelBene - - - Ann Wagner - - - Steve Daines - - - Scott Perry - - - John Katko - - - Lisa Blunt Rochester - - - Jamie Raskin - - - Thomas R. Suozzi - - - Troy Balderson - - - Jim Hagedorn - - - Mary Bono Mack - - - Mike Ross - - - Joe Walsh - - - Allen B. West - - - Pete P. Gallego - - - David Vitter - - - Joseph J. Heck - - - Ryan K. Zinke - - - Blake Farenthold - - - Peter J. Roskam - - - Bill Shuster - - - Claudia Tenney - - - David N. Cicilline - - - Mario Diaz-Balart - - - John Thune - - - Patrick J. Toomey - - - Juan Vargas - - - Cheri Bustos - - - Kevin Cramer - - - Matt Cartwright - - - John R. Moolenaar - - - Tom Emmer - - - Bradley Scott Schneider - - - Clay Higgins - - - Anthony G. Brown - - - Paul Mitchell - - - A. Donald McEachin - - - Greg Gianforte - - - Kevin Hern - - - Harley Rouda - - - Jim Matheson - - - John E. Walsh - - - E. Scott Rigell - - - Loretta Sanchez - - - Charles W. Dent - - - Evan H. Jenkins - - - Dean Heller - - - Mark Sanford - - - David A. Trott - - - Thomas MacArthur - - - Robert P. Casey, Jr. - - - Amy Klobuchar - - - Jeff Fortenberry - - - Vicky Hartzler - - - Frank D. Lucas - - - Adam B. Schiff - - - Michael R. Turner - - - Doug LaMalfa - - - Mark Takano - - - Susan W. Brooks - - - Chris Stewart - - - Jody B. Hice - - - Mike Bost - - - Thom Tillis - - - Roger W. Marshall - - - John R. Curtis - - - Lucy McBath - - - Andy Levin - - - Debra A. Haaland - - - Scott P. Brown - - - Rick Berg - - - Ben Chandler - - - Chip Cravaack - - - Nan A. S. Hayworth - - - Mike Pence - - - Jo Bonner - - - Mark Kirk - - - Scott Garrett - - - Jeff Miller - - - Pedro R. Pierluisi - - - Curt Clawson - - - Michelle Lujan Grisham - - - Dennis A. Ross - - - Elizabeth H. Esty - - - Barbara Comstock - - - Brenda Jones - - - Mark Meadows - - - Brian Higgins - - - James P. McGovern - - - Glenn Thompson - - - Chris Van Hollen - - - Robert J. Wittman - - - Ken Buck - - - Cindy Hyde-Smith - - - Mary Gay Scanlon - - - Madeleine Dean - - - Enid Greene Waldholtz - - - Steve Austria - - - Russ Carnahan - - - Kathleen C. Hochul - - - Alan Nunnelee - - - Donna F. Edwards - - - Steve Israel - - - Matt Salmon - - - Alan Grayson - - - Xavier Becerra - - - James B. Renacci - - - Maria Cantwell - - - Paul A. Gosar - - - H. Morgan Griffith - - - Gary C. Peters - - - Mike Quigley - - - Mike Rogers - - - John Shimkus - - - Mac Thornberry - - - Mark E. Amodei - - - Donald M. Payne, Jr. - - - Scott H. Peters - - - Daniel T. Kildee - - - Brad R. Wenstrup - - - Tim Kaine - - - Donald Norcross - - - Margaret Wood Hassan - - - Andy Biggs - - - J. Luis Correa - - - Tina Smith - - - Debbie Lesko - - - Hansen Clarke - - - Tim Holden - - - Robert E. Andrews - - - Bruce L. Braley - - - Cresent Hardy - - - Trent Franks - - - Jeb Hensarling - - - Bill Cassidy - - - Diana DeGette - - - Andy Harris - - - John Hoeven - - - Lisa Murkowski - - - Greg Walden - - - Steve Womack - - - David P. Joyce - - - Tom Rice - - - Earl L. "Buddy" Carter - - - Val Butler Demings - - - Jacky Rosen - - - Joseph D. Morelle - - - Susan Wild - - - John Joyce - - - Thomas P. Tiffany - - - Sandy Adams - - - Michele Bachmann - - - Mike McIntyre - - - Steve Stockman - - - Chaka Fattah - - - Charles W. Boustany Jr. - - - John C. Carney Jr. - - - Reid J. Ribble - - - Lou Barletta - - - John Abney Culberson - - - Gregg Harper - - - Daniel M. Donovan, Jr. - - - Jon Tester - - - Jeff Merkley - - - Wm. Lacy Clay - - - Robert E. Latta - - - Tom McClintock - - - Scott R. Tipton - - - Ann M. Kuster - - - Robin L. Kelly - - - J. French Hill - - - Charlie Crist - - - Ron Estes - - - Jesús G. "Chuy" García - - - Greg Pence - - - Denny Rehberg - - - Mary L. Landrieu - - - John Barrow - - - John Campbell - - - Jim Gerlach - - - Jack Kingston - - - Michael H. Michaud - - - Patrick Meehan - - - Mike Coffman - - - Joe Donnelly - - - Pete Sessions - - - Heidi Heitkamp - - - Rod Blum - - - Jason Lewis - - - Sheldon Whitehouse - - - Lindsey Graham - - - Kevin Brady - - - Richard Burr - - - Henry Cuellar - - - Ron Johnson - - - Billy Long - - - Stephen F. Lynch - - - Chellie Pingree - - - Rob Portman - - - Gregorio Kilili Camacho Sablan - - - Bill Foster - - - Ted S. Yoho - - - Bradley Byrne - - - Dan Newhouse - - - Glenn Grothman - - - David J. Trone - - - Steven C. LaTourette - - - Candice S. Miller - - - Cynthia M. Lummis - - - Tom Price - - - Robert Menendez - - - Mark R. Warner - - - Mo Brooks - - - Jim Cooper - - - Bill Flores - - - Bob Gibbs - - - Bill Johnson - - - Henry C. "Hank" Johnson, Jr. - - - Doug Lamborn - - - Betty McCollum - - - Jerry Moran - - - Brad Sherman - - - Suzanne Bonamici - - - Gary J. Palmer - - - Ralph Lee Abraham - - - Brenda L. Lawrence - - - Mike Rounds - - - Dwight Evans - - - Adriano Espaillat - - - Doug Jones - - - Mike Braun - - - Brad Miller - - - Kay R. Hagan - - - Dave Camp - - - Luther Strange - - - Claire McCaskill - - - Luis V. Gutiérrez - - - Darrell E. Issa - - - Bruce Poliquin - - - Karen Bass - - - Ken Calvert - - - Shelley Moore Capito - - - Steve Chabot - - - Judy Chu - - - Joe Courtney - - - Michael F. Doyle - - - Louie Gohmert - - - Gregory W. Meeks - - - Ed Perlmutter - - - Christopher H. Smith - - - Fred Upton - - - Nydia M. Velázquez - - - Randy K. Weber, Sr. - - - Debbie Dingell - - - Neal P. Dunn - - - Francis Rooney - - - Ralph Norman - - - Jefferson Van Drew - - - Ron Wright - - - Charles F. Bass - - - David Dreier - - - Steven R. Rothman - - - Janice Hahn - - - Dan Benishek - - - J. Randy Forbes - - - Tim Murphy - - - Bob Corker - - - Michael E. Capuano - - - Bob Goodlatte - - - Leonard Lance - - - Ileana Ros-Lehtinen - - - Carol Shea-Porter - - - John J. Faso - - - Tom Marino - - - Sherrod Brown - - - John Barrasso - - - Susan M. Collins - - - John Cornyn - - - Marsha Blackburn - - - Jim Costa - - - Marcia L. Fudge - - - William R. Keating - - - David Loebsack - - - Blaine Luetkemeyer - - - Julia Brownley - - - Denny Heck - - - Mark DeSaulnier - - - John H. Rutherford - - - Ed Case - - - Rick Scott - - - Shelley Berkley - - - Brian P. Bilbray - - - Ann Marie Buerkle - - - Larry Kissell - - - Jean Schmidt - - - Jim DeMint - - - John F. Tierney - - - Kerry L. Bentivolio - - - John Fleming - - - Richard L. Hanna - - - Richard B. Nugent - - - Al Franken - - - Diane Black - - - Edward R. Royce - - - Colleen Hanabusa - - - Elijah E. Cummings - - - Roger F. Wicker - - - Rob Bishop - - - Vern Buchanan - - - Mike Crapo - - - Kenny Marchant - - - Jerry McNerney - - - Gwen Moore - - - Frank Pallone, Jr. - - - Kurt Schrader - - - Albio Sires - - - Mike Thompson - - - Tim Walberg - - - Deb Fischer - - - Rick W. Allen - - - John Kennedy - - - Jo Ann Emerson - - - Mark Udall - - - Timothy H. Bishop - - - Mike Johanns - - - Lynn A. Westmoreland - - - David G. Reichert - - - Chris Collins - - - Debbie Stabenow - - - Roy Blunt - - - John Boozman - - - Michael C. Burgess - - - Gerald E. Connolly - - - Sheila Jackson Lee - - - Patty Murray - - - Charles E. Schumer - - - Michael K. Simpson - - - Jackie Speier - - - Dina Titus - - - Joyce Beatty - - - Donald S. Beyer, Jr. - - - Ann Kirkpatrick - - - Sylvia R. Garcia - - - Carol D. Miller - - - Francisco "Quico" Canseco - - - Jerry F. Costello - - - William L. Owens - - - Nick J. Rahall II - - - William L. Enyart - - - John A. Boehner - - - Randy Neugebauer - - - Brad Ashford - - - Joe Barton - - - Jack Reed - - - Steve Cohen - - - Tom Cole - - - Steve King - - - Richard E. Neal - - - Paul Tonko - - - Peter J. Visclosky - - - Daniel Webster - - - Ron Wyden - - - Elizabeth Warren - - - Roger Williams - - - David Perdue - - - Kent Conrad - - - David Alan Curson - - - Tom Coburn - - - Rush Holt - - - Tom Latham - - - Gary G. Miller - - - Allyson Y. Schwartz - - - Ted Poe - - - Robert Pittenger - - - Tom Udall - - - Earl Blumenauer - - - K. Michael Conaway - - - Raúl M. Grijalva - - - Mike Kelly - - - John B. Larson - - - Bennie G. Thompson - - - Lois Frankel - - - Brian Babin - - - Al Lawson, Jr. - - - Kweisi Mfume - - - Olympia J. Snowe - - - W. Todd Akin - - - Joe Baca - - - Spencer Bachus - - - John Kline - - - John J. Duncan, Jr. - - - Gene Green - - - Stevan Pearce - - - Dana Rohrabacher - - - Lamar Smith - - - Thomas R. Carper - - - Jeanne Shaheen - - - Joe Manchin, III - - - Sanford D. Bishop, Jr. - - - G. K. Butterfield - - - Peter A. DeFazio - - - Eliot L. Engel - - - Al Green - - - Mazie K. Hirono - - - Zoe Lofgren - - - David B. McKinley - - - Jerrold Nadler - - - Bill Posey - - - Robert C. "Bobby" Scott - - - Peter Welch - - - Joe Wilson - - - John A. Yarmuth - - - Aumua Amata Coleman Radewagen - - - Jack Bergman - - - Mitt Romney - - - Jim Webb - - - Timothy V. Johnson - - - Dennis J. Kucinich - - - Daniel E. Lungren - - - Rodney Alexander - - - Tim Johnson - - - Paul C. Broun - - - Corrine Brown - - - Jeff Sessions - - - Rodney P. Frelinghuysen - - - Frank A. LoBiondo - - - Niki Tsongas - - - Richard Blumenthal - - - Lloyd Doggett - - - Marcy Kaptur - - - Barbara Lee - - - Carolyn B. Maloney - - - Edward J. Markey - - - C. A. Dutch Ruppersberger - - - Bobby L. Rush - - - Alma S. Adams - - - Tom O’Halleran - - - Charles A. Gonzalez - - - Wally Herger - - - Melvin L. Watt - - - Donna M. Christensen - - - George Miller - - - James P. Moran - - - Ron Barber - - - Robert A. Brady - - - John Garamendi - - - David P. Roe - - - David Scott - - - Bonnie Watson Coleman - - - James R. Baird - - - Elton Gallegly - - - Donald A. Manzullo - - - Silvestre Reyes - - - Carolyn McCarthy - - - Ander Crenshaw - - - Johnny Isakson - - - Richard J. Durbin - - - Michael B. Enzi - - - Emanuel Cleaver - - - Susan A. Davis - - - Peter T. King - - - Doris O. Matsui - - - Collin C. Peterson - - - Janice D. Schakowsky - - - Angus S. King, Jr. - - - Jeff Bingaman - - - Kay Bailey Hutchison - - - John F. Kerry - - - Saxby Chambliss - - - Eni F. H. Faleomavaega - - - Ed Pastor - - - Ed Whitfield - - - Daniel Coats - - - John L. Mica - - - Richard M. Nolan - - - Walter B. Jones - - - Benjamin L. Cardin - - - James E. Risch - - - Rosa L. DeLauro - - - Virginia Foxx - - - Kay Granger - - - F. James Sensenbrenner, Jr. - - - José E. Serrano - - - Paul Cook - - - Bob Filner - - - Joseph I. Lieberman - - - Gary L. Ackerman - - - Phil Gingrey - - - Jon Kyl - - - Bill Nelson - - - Mitch McConnell - - - Anna G. Eshoo - - - Frederica S. Wilson - - - Ben Nelson - - - Howard L. Berman - - - Sue Wilkins Myrick - - - Cliff Stearns - - - Robert L. Turner - - - Max Baucus - - - Doc Hastings - - - Gloria Negrete McLeod - - - Sam Farr - - - Michael M. Honda - - - Bernard Sanders - - - John R. Carter - - - Danny K. Davis - - - Lucille Roybal-Allard - - - Alan S. Lowenthal - - - Donna E. Shalala - - - Norman D. Dicks - - - Barney Frank - - - Thomas E. Petri - - - Barbara Boxer - - - Rubén Hinojosa - - - John Lewis - - - Lamar Alexander - - - James E. Clyburn - - - Patrick J. Leahy - - - Nancy Pelosi - - - David E. Price - - - Tom Harkin - - - Henry A. Waxman - - - Frank R. Wolf - - - Harry Reid - - - Joseph R. Pitts - - - Steny H. Hoyer - - - Dan Burton - - - Maurice D. Hinchey - - - Howard P. "Buck" McKeon - - - Lois Capps - - - Maxine Waters - - - Judy Biggert - - - Lynn C. Woolsey - - - John D. Rockefeller, IV - - - Thad Cochran - - - Nita M. Lowey - - - Eleanor Holmes Norton - - - Bill Pascrell, Jr. - - - Harold Rogers - - - John W. Olver - - - Barbara A. Mikulski - - - Jim McDermott - - - John McCain - - - Pat Roberts - - - Alcee L. Hastings - - - Grace F. Napolitano - - - Herb Kohl - - - Ron Paul - - - Eddie Bernice Johnson - - - Leonard L. Boswell - - - Jerry Lewis - - - Edolphus Towns - - - Carl Levin - - - Orrin G. Hatch - - - James M. Inhofe - - - Richard C. Shelby - - - Madeleine Z. Bordallo - - - Dianne Feinstein - - - Chuck Grassley - - - Don Young - - - Richard G. Lugar - - - Fortney Pete Stark - - - Howard Coble - - - Sander M. Levin - - - C. W. Bill Young - - - Charles B. Rangel - - - Sam Johnson - - - Dale E. Kildee - - - John Conyers, Jr. - - - Louise McIntosh Slaughter - - - Roscoe G. Bartlett - - - John D. Dingell - - - Daniel K. Inouye - - - Daniel K. Akaka - - - Frank R. Lautenberg - - - Ralph M. Hall - + Alexandria Ocasio-Cortez + Abby Finkenauer + Katie Hill + Josh Harder + Lauren Underwood + Max Rose + Elise M. Stefanik + Mike Gallagher + Conor Lamb + Joe Neguse + Xochitl Torres Small + Anthony Gonzalez + William R. Timmons IV + Dan Crenshaw + Patrick Murphy + Trey Hollingsworth + Haley M. Stevens + Guy Reschenthaler + Colin Z. Allred + Matt Gaetz + Andy Kim + Joe Cunningham + Lance Gooden + Jared F. Golden + Aaron Schock + Tulsi Gabbard + Michael F. Q. San Nicolas + Ilhan Omar + Bryan Steil + Carlos Curbelo + Ruben J. Kihuen + Justin Amash + Eric Swalwell + Joseph P. Kennedy III + Jason Smith + Lee M. Zeldin + Brian J. Mast + Sharice Davids + Chris Pappas + Scott Taylor + Ruben Gallego + Pete Aguilar + Jim Banks + Jason Crow + Abigail Davis Spanberger + Josh Hawley + Ron DeSantis + Jaime Herrera Beutler + Adam Kinzinger + Seth Moulton + Stephanie N. Murphy + Darren Soto + Mike Levin + W. Gregory Steube + Anthony Brindisi + David G. Valadao + Tom Cotton + Markwayne Mullin + Brendan F. Boyle + Will Hurd + Antonio Delgado + Benjamin Quayle + Trey Radel + Marlin A. Stutzman + Kevin Yoder + Ryan A. Costello + Duncan Hunter + Martha Roby + Kyrsten Sinema + Ro Khanna + Nanette Diaz Barragán + Jenniffer González-Colón + Steve Watkins + Elissa Slotkin + Rashida Tlaib + Kelly Armstrong + Kendra S. Horn + Dusty Johnson + Mike Garcia + Jim Bridenstine + Jared Polis + Mia B. Love + Patrick T. McHenry + Grace Meng + Josh Gottheimer + Michael Cloud + Lizzie Fletcher + Elaine G. Luria + Vance M. McAllister + André Carson + Cory Gardner + Joaquin Castro + Derek Kilmer + Jimmy Gomez + Katie Porter + Michael Waltz + Ayanna Pressley + Ben McAdams + Dan Boren + Jon Runyan + Stephen Lee Fincher + Christopher Murphy + Devin Nunes + Cedric L. Richmond + Tim Ryan + Andy Barr + Raja Krishnamoorthi + Brian K. Fitzpatrick + Steven Horsford + Jahana Hayes + Russ Fulcher + Lori Trahan + David W. Jolly + Beto O’Rourke + Thomas A. Garrett, Jr. + Ben Ray Luján + Todd Young + Brian Schatz + Raul Ruiz + Garret Graves + David Rouzer + Ben Sasse + James Comer + Mike Johnson + Jodey C. Arrington + Angie Craig + Mikie Sherrill + Van Taylor + Chip Roy + Ben Cline + Heath Shuler + Kristi L. Noem + Sean P. Duffy + Martin Heinrich + Mike Lee + Tom Reed + Marco Rubio + Thomas Massie + Richard Hudson + Marc A. Veasey + Alexander X. Mooney + Ted Budd + Gilbert Ray Cisneros, Jr. + Debbie Mucarsel-Powell + Sean Casten + Jeffrey M. Landry + Michael G. Grimm + Frank C. Guinta + Todd Rokita + Thomas J. Rooney + Paul D. Ryan + Tom Graves + Steven M. Palazzo + Adrian Smith + Rob Woodall + Rodney Davis + Hakeem S. Jeffries + Ted Cruz + Joni Ernst + Warren Davidson + Greg Stanton + Michael Guest + Denver Riggleman + Kelly Loeffler + William M. Cowan + Robert Hurt + Robert J. Dold + Luke Messer + Bill Huizenga + Cathy McMorris Rodgers + Austin Scott + Linda T. Sánchez + Cory A. Booker + Ted Lieu + Mark Walker + Jimmy Panetta + Dean Phillips + Veronica Escobar + Jason Altmire + Tim Griffin + Daniel B. Maffei + Kelly Ayotte + Tim Huelskamp + David Young + James Lankford + Tammy Duckworth + George Holding + Darin LaHood + Jennifer Wexton + Kim Schrier + Connie Mack + Mark Takai + Mick Mulvaney + Jason Chaffetz + Jeff Denham + Raúl R. Labrador + Mike Bishop + Bruce Westerman + Vicente Gonzalez + Chrissy Houlahan + Randy Hultgren + Stephen Knight + Kirsten E. Gillibrand + Kathy Castor + Eric A. "Rick" Crawford + Theodore E. Deutch + Jeff Duncan + James A. Himes + Daniel Lipinski + Debbie Wasserman Schultz + Doug Collins + Sean Patrick Maloney + Stacey E. Plaskett + Trent Kelly + A. Drew Ferguson IV + David Kustoff + Liz Cheney + Ross Spano + Pete Stauber + Susie Lee + Martha McSally + Chris Jacobs + Jesse L. Jackson Jr. + David Rivera + John Sullivan + Jeff Chiesa + Steve Southerland II + Erik Paulsen + John Ratcliffe + Robert B. Aderholt + Rick Larsen + Kevin McCarthy + Steve Scalise + Tim Scott + Terri A. Sewell + Adam Smith + Steve Stivers + Ami Bera + Norma J. Torres + Kathleen M. Rice + Pramila Jayapal + Cynthia Axne + Tom Malinowski + John W. Rose + Fred Keller + Robert T. Schilling + Renee L. Ellmers + Christopher P. Gibson + Trey Gowdy + Timothy J. Walz + Dave Brat + Michael F. Bennet + Yvette D. Clarke + Scott DesJarlais + Brett Guthrie + Jim Jordan + James R. Langevin + Jared Huffman + Mark Pocan + Dan Sullivan + Kamala D. Harris + Catherine Cortez Masto + Salud O. Carbajal + Lloyd Smucker + Daniel Meuser + Tim Burchett + Mark E. Green + Dan Bishop + Betty Sutton + Eric Cantor + Mark L. Pryor + Mike Rogers + Joe Garcia + Michael G. Fitzpatrick + Gwen Graham + Mike Pompeo + Keith Ellison + Lynn Jenkins + John K. Delaney + Steve Russell + Christopher A. Coons + Gus M. Bilirakis + Sam Graves + Ron Kind + Rand Paul + Tony Cárdenas + Jackie Walorski + Filemon Vela + Katherine M. Clark + Barry Loudermilk + Don Bacon + TJ Cox + Gregory F. Murphy + Mark S. Critz + Todd Russell Platts + Laura Richardson + Mark Begich + Lee Terry + Patrick J. Tiberi + Joseph Crowley + Jeff Flake + Keith J. Rothfus + Mimi Walters + Karen C. Handel + Tammy Baldwin + Larry Bucshon + Charles J. "Chuck" Fleischmann + Michael T. McCaul + Pete Olson + John P. Sarbanes + David Schweikert + Suzan K. DelBene + Ann Wagner + Steve Daines + Scott Perry + John Katko + Lisa Blunt Rochester + Jamie Raskin + Thomas R. Suozzi + Troy Balderson + Jim Hagedorn + Mary Bono Mack + Mike Ross + Joe Walsh + Allen B. West + Pete P. Gallego + David Vitter + Joseph J. Heck + Ryan K. Zinke + Blake Farenthold + Peter J. Roskam + Bill Shuster + Claudia Tenney + David N. Cicilline + Mario Diaz-Balart + John Thune + Patrick J. Toomey + Juan Vargas + Cheri Bustos + Kevin Cramer + Matt Cartwright + John R. Moolenaar + Tom Emmer + Bradley Scott Schneider + Clay Higgins + Anthony G. Brown + Paul Mitchell + A. Donald McEachin + Greg Gianforte + Kevin Hern + Harley Rouda + Jim Matheson + John E. Walsh + E. Scott Rigell + Loretta Sanchez + Charles W. Dent + Evan H. Jenkins + Dean Heller + Mark Sanford + David A. Trott + Thomas MacArthur + Robert P. Casey, Jr. + Amy Klobuchar + Jeff Fortenberry + Vicky Hartzler + Frank D. Lucas + Adam B. Schiff + Michael R. Turner + Doug LaMalfa + Mark Takano + Susan W. Brooks + Chris Stewart + Jody B. Hice + Mike Bost + Thom Tillis + Roger W. Marshall + John R. Curtis + Lucy McBath + Andy Levin + Debra A. Haaland + Scott P. Brown + Rick Berg + Ben Chandler + Chip Cravaack + Nan A. S. Hayworth + Mike Pence + Jo Bonner + Mark Kirk + Scott Garrett + Jeff Miller + Pedro R. Pierluisi + Curt Clawson + Michelle Lujan Grisham + Dennis A. Ross + Elizabeth H. Esty + Barbara Comstock + Brenda Jones + Mark Meadows + Brian Higgins + James P. McGovern + Glenn Thompson + Chris Van Hollen + Robert J. Wittman + Ken Buck + Cindy Hyde-Smith + Mary Gay Scanlon + Madeleine Dean + Enid Greene Waldholtz + Steve Austria + Russ Carnahan + Kathleen C. Hochul + Alan Nunnelee + Donna F. Edwards + Steve Israel + Matt Salmon + Alan Grayson + Xavier Becerra + James B. Renacci + Maria Cantwell + Paul A. Gosar + H. Morgan Griffith + Gary C. Peters + Mike Quigley + Mike Rogers + John Shimkus + Mac Thornberry + Mark E. Amodei + Donald M. Payne, Jr. + Scott H. Peters + Daniel T. Kildee + Brad R. Wenstrup + Tim Kaine + Donald Norcross + Margaret Wood Hassan + Andy Biggs + J. Luis Correa + Tina Smith + Debbie Lesko + Hansen Clarke + Tim Holden + Robert E. Andrews + Bruce L. Braley + Cresent Hardy + Trent Franks + Jeb Hensarling + Bill Cassidy + Diana DeGette + Andy Harris + John Hoeven + Lisa Murkowski + Greg Walden + Steve Womack + David P. Joyce + Tom Rice + Earl L. "Buddy" Carter + Val Butler Demings + Jacky Rosen + Joseph D. Morelle + Susan Wild + John Joyce + Thomas P. Tiffany + Sandy Adams + Michele Bachmann + Mike McIntyre + Steve Stockman + Chaka Fattah + Charles W. Boustany Jr. + John C. Carney Jr. + Reid J. Ribble + Lou Barletta + John Abney Culberson + Gregg Harper + Daniel M. Donovan, Jr. + Jon Tester + Jeff Merkley + Wm. Lacy Clay + Robert E. Latta + Tom McClintock + Scott R. Tipton + Ann M. Kuster + Robin L. Kelly + J. French Hill + Charlie Crist + Ron Estes + Jesús G. "Chuy" García + Greg Pence + Denny Rehberg + Mary L. Landrieu + John Barrow + John Campbell + Jim Gerlach + Jack Kingston + Michael H. Michaud + Patrick Meehan + Mike Coffman + Joe Donnelly + Pete Sessions + Heidi Heitkamp + Rod Blum + Jason Lewis + Sheldon Whitehouse + Lindsey Graham + Kevin Brady + Richard Burr + Henry Cuellar + Ron Johnson + Billy Long + Stephen F. Lynch + Chellie Pingree + Rob Portman + Gregorio Kilili Camacho Sablan + Bill Foster + Ted S. Yoho + Bradley Byrne + Dan Newhouse + Glenn Grothman + David J. Trone + Steven C. LaTourette + Candice S. Miller + Cynthia M. Lummis + Tom Price + Robert Menendez + Mark R. Warner + Mo Brooks + Jim Cooper + Bill Flores + Bob Gibbs + Bill Johnson + Henry C. "Hank" Johnson, Jr. + Doug Lamborn + Betty McCollum + Jerry Moran + Brad Sherman + Suzanne Bonamici + Gary J. Palmer + Ralph Lee Abraham + Brenda L. Lawrence + Mike Rounds + Dwight Evans + Adriano Espaillat + Doug Jones + Mike Braun + Brad Miller + Kay R. Hagan + Dave Camp + Luther Strange + Claire McCaskill + Luis V. Gutiérrez + Darrell E. Issa + Bruce Poliquin + Karen Bass + Ken Calvert + Shelley Moore Capito + Steve Chabot + Judy Chu + Joe Courtney + Michael F. Doyle + Louie Gohmert + Gregory W. Meeks + Ed Perlmutter + Christopher H. Smith + Fred Upton + Nydia M. Velázquez + Randy K. Weber, Sr. + Debbie Dingell + Neal P. Dunn + Francis Rooney + Ralph Norman + Jefferson Van Drew + Ron Wright + Charles F. Bass + David Dreier + Steven R. Rothman + Janice Hahn + Dan Benishek + J. Randy Forbes + Tim Murphy + Bob Corker + Michael E. Capuano + Bob Goodlatte + Leonard Lance + Ileana Ros-Lehtinen + Carol Shea-Porter + John J. Faso + Tom Marino + Sherrod Brown + John Barrasso + Susan M. Collins + John Cornyn + Marsha Blackburn + Jim Costa + Marcia L. Fudge + William R. Keating + David Loebsack + Blaine Luetkemeyer + Julia Brownley + Denny Heck + Mark DeSaulnier + John H. Rutherford + Ed Case + Rick Scott + Shelley Berkley + Brian P. Bilbray + Ann Marie Buerkle + Larry Kissell + Jean Schmidt + Jim DeMint + John F. Tierney + Kerry L. Bentivolio + John Fleming + Richard L. Hanna + Richard B. Nugent + Al Franken + Diane Black + Edward R. Royce + Colleen Hanabusa + Elijah E. Cummings + Roger F. Wicker + Rob Bishop + Vern Buchanan + Mike Crapo + Kenny Marchant + Jerry McNerney + Gwen Moore + Frank Pallone, Jr. + Kurt Schrader + Albio Sires + Mike Thompson + Tim Walberg + Deb Fischer + Rick W. Allen + John Kennedy + Jo Ann Emerson + Mark Udall + Timothy H. Bishop + Mike Johanns + Lynn A. Westmoreland + David G. Reichert + Chris Collins + Debbie Stabenow + Roy Blunt + John Boozman + Michael C. Burgess + Gerald E. Connolly + Sheila Jackson Lee + Patty Murray + Charles E. Schumer + Michael K. Simpson + Jackie Speier + Dina Titus + Joyce Beatty + Donald S. Beyer, Jr. + Ann Kirkpatrick + Sylvia R. Garcia + Carol D. Miller + Francisco "Quico" Canseco + Jerry F. Costello + William L. Owens + Nick J. Rahall II + William L. Enyart + John A. Boehner + Randy Neugebauer + Brad Ashford + Joe Barton + Jack Reed + Steve Cohen + Tom Cole + Steve King + Richard E. Neal + Paul Tonko + Peter J. Visclosky + Daniel Webster + Ron Wyden + Elizabeth Warren + Roger Williams + David Perdue + Kent Conrad + David Alan Curson + Tom Coburn + Rush Holt + Tom Latham + Gary G. Miller + Allyson Y. Schwartz + Ted Poe + Robert Pittenger + Tom Udall + Earl Blumenauer + K. Michael Conaway + Raúl M. Grijalva + Mike Kelly + John B. Larson + Bennie G. Thompson + Lois Frankel + Brian Babin + Al Lawson, Jr. + Kweisi Mfume + Olympia J. Snowe + W. Todd Akin + Joe Baca + Spencer Bachus + John Kline + John J. Duncan, Jr. + Gene Green + Stevan Pearce + Dana Rohrabacher + Lamar Smith + Thomas R. Carper + Jeanne Shaheen + Joe Manchin, III + Sanford D. Bishop, Jr. + G. K. Butterfield + Peter A. DeFazio + Eliot L. Engel + Al Green + Mazie K. Hirono + Zoe Lofgren + David B. McKinley + Jerrold Nadler + Bill Posey + Robert C. "Bobby" Scott + Peter Welch + Joe Wilson + John A. Yarmuth + Aumua Amata Coleman Radewagen + Jack Bergman + Mitt Romney + Jim Webb + Timothy V. Johnson + Dennis J. Kucinich + Daniel E. Lungren + Rodney Alexander + Tim Johnson + Paul C. Broun + Corrine Brown + Jeff Sessions + Rodney P. Frelinghuysen + Frank A. LoBiondo + Niki Tsongas + Richard Blumenthal + Lloyd Doggett + Marcy Kaptur + Barbara Lee + Carolyn B. Maloney + Edward J. Markey + C. A. Dutch Ruppersberger + Bobby L. Rush + Alma S. Adams + Tom O’Halleran + Charles A. Gonzalez + Wally Herger + Melvin L. Watt + Donna M. Christensen + George Miller + James P. Moran + Ron Barber + Robert A. Brady + John Garamendi + David P. Roe + David Scott + Bonnie Watson Coleman + James R. Baird + Elton Gallegly + Donald A. Manzullo + Silvestre Reyes + Carolyn McCarthy + Ander Crenshaw + Johnny Isakson + Richard J. Durbin + Michael B. Enzi + Emanuel Cleaver + Susan A. Davis + Peter T. King + Doris O. Matsui + Collin C. Peterson + Janice D. Schakowsky + Angus S. King, Jr. + Jeff Bingaman + Kay Bailey Hutchison + John F. Kerry + Saxby Chambliss + Eni F. H. Faleomavaega + Ed Pastor + Ed Whitfield + Daniel Coats + John L. Mica + Richard M. Nolan + Walter B. Jones + Benjamin L. Cardin + James E. Risch + Rosa L. DeLauro + Virginia Foxx + Kay Granger + F. James Sensenbrenner, Jr. + José E. Serrano + Paul Cook + Bob Filner + Joseph I. Lieberman + Gary L. Ackerman + Phil Gingrey + Jon Kyl + Bill Nelson + Mitch McConnell + Anna G. Eshoo + Frederica S. Wilson + Ben Nelson + Howard L. Berman + Sue Wilkins Myrick + Cliff Stearns + Robert L. Turner + Max Baucus + Doc Hastings + Gloria Negrete McLeod + Sam Farr + Michael M. Honda + Bernard Sanders + John R. Carter + Danny K. Davis + Lucille Roybal-Allard + Alan S. Lowenthal + Donna E. Shalala + Norman D. Dicks + Barney Frank + Thomas E. Petri + Barbara Boxer + Rubén Hinojosa + John Lewis + Lamar Alexander + James E. Clyburn + Patrick J. Leahy + Nancy Pelosi + David E. Price + Tom Harkin + Henry A. Waxman + Frank R. Wolf + Harry Reid + Joseph R. Pitts + Steny H. Hoyer + Dan Burton + Maurice D. Hinchey + Howard P. "Buck" McKeon + Lois Capps + Maxine Waters + Judy Biggert + Lynn C. Woolsey + John D. Rockefeller, IV + Thad Cochran + Nita M. Lowey + Eleanor Holmes Norton + Bill Pascrell, Jr. + Harold Rogers + John W. Olver + Barbara A. Mikulski + Jim McDermott + John McCain + Pat Roberts + Alcee L. Hastings + Grace F. Napolitano + Herb Kohl + Ron Paul + Eddie Bernice Johnson + Leonard L. Boswell + Jerry Lewis + Edolphus Towns + Carl Levin + Orrin G. Hatch + James M. Inhofe + Richard C. Shelby + Madeleine Z. Bordallo + Dianne Feinstein + Chuck Grassley + Don Young + Richard G. Lugar + Fortney Pete Stark + Howard Coble + Sander M. Levin + C. W. Bill Young + Charles B. Rangel + Sam Johnson + Dale E. Kildee + John Conyers, Jr. + Louise McIntosh Slaughter + Roscoe G. Bartlett + John D. Dingell + Daniel K. Inouye + Daniel K. Akaka + Frank R. Lautenberg + Ralph M. Hall diff --git a/test/output/usCongressAgeColorExplicit.svg b/test/output/usCongressAgeColorExplicit.svg index 05af75bab5..67653cf19a 100644 --- a/test/output/usCongressAgeColorExplicit.svg +++ b/test/output/usCongressAgeColorExplicit.svg @@ -13,2724 +13,947 @@ white-space: pre; } - - - - 0 - - - - 5 - - - - 10 - - - - 15 - - - - 20 - - - - 25 - - - - 30 - ↑ Frequency + + + + + + + + + + + + + + + + + + + + 0 + 5 + 10 + 15 + 20 + 25 + 30 + + + ↑ Frequency + + + + + + + + + + + + + 30 + 40 + 50 + 60 + 70 + 80 + 90 + 100 - - - 30 - - - 40 - - - 50 - - - 60 - - - 70 - - - 80 - - - 90 - - - 100 - Age → + + Age → - - Alexandria Ocasio-Cortez - - - Abby Finkenauer - - - Katie Hill - - - Josh Harder - - - Lauren Underwood - - - Max Rose - - - Elise M. Stefanik - - - Mike Gallagher - - - Conor Lamb - - - Joe Neguse - - - Xochitl Torres Small - - - Anthony Gonzalez - - - William R. Timmons IV - - - Dan Crenshaw - - - Patrick Murphy - - - Trey Hollingsworth - - - Haley M. Stevens - - - Guy Reschenthaler - - - Colin Z. Allred - - - Matt Gaetz - - - Andy Kim - - - Joe Cunningham - - - Lance Gooden - - - Jared F. Golden - - - Aaron Schock - - - Tulsi Gabbard - - - Michael F. Q. San Nicolas - - - Ilhan Omar - - - Bryan Steil - - - Carlos Curbelo - - - Ruben J. Kihuen - - - Justin Amash - - - Eric Swalwell - - - Joseph P. Kennedy III - - - Jason Smith - - - Lee M. Zeldin - - - Brian J. Mast - - - Sharice Davids - - - Chris Pappas - - - Scott Taylor - - - Ruben Gallego - - - Pete Aguilar - - - Jim Banks - - - Jason Crow - - - Abigail Davis Spanberger - - - Josh Hawley - - - Ron DeSantis - - - Jaime Herrera Beutler - - - Adam Kinzinger - - - Seth Moulton - - - Stephanie N. Murphy - - - Darren Soto - - - Mike Levin - - - W. Gregory Steube - - - Anthony Brindisi - - - David G. Valadao - - - Tom Cotton - - - Markwayne Mullin - - - Brendan F. Boyle - - - Will Hurd - - - Antonio Delgado - - - Benjamin Quayle - - - Trey Radel - - - Marlin A. Stutzman - - - Kevin Yoder - - - Ryan A. Costello - - - Duncan Hunter - - - Martha Roby - - - Kyrsten Sinema - - - Ro Khanna - - - Nanette Diaz Barragán - - - Jenniffer González-Colón - - - Steve Watkins - - - Elissa Slotkin - - - Rashida Tlaib - - - Kelly Armstrong - - - Kendra S. Horn - - - Dusty Johnson - - - Mike Garcia - - - Jim Bridenstine - - - Jared Polis - - - Mia B. Love - - - Patrick T. McHenry - - - Grace Meng - - - Josh Gottheimer - - - Michael Cloud - - - Lizzie Fletcher - - - Elaine G. Luria - - - Vance M. McAllister - - - André Carson - - - Cory Gardner - - - Joaquin Castro - - - Derek Kilmer - - - Jimmy Gomez - - - Katie Porter - - - Michael Waltz - - - Ayanna Pressley - - - Ben McAdams - - - Dan Boren - - - Jon Runyan - - - Stephen Lee Fincher - - - Christopher Murphy - - - Devin Nunes - - - Cedric L. Richmond - - - Tim Ryan - - - Andy Barr - - - Raja Krishnamoorthi - - - Brian K. Fitzpatrick - - - Steven Horsford - - - Jahana Hayes - - - Russ Fulcher - - - Lori Trahan - - - David W. Jolly - - - Beto O’Rourke - - - Thomas A. Garrett, Jr. - - - Ben Ray Luján - - - Todd Young - - - Brian Schatz - - - Raul Ruiz - - - Garret Graves - - - David Rouzer - - - Ben Sasse - - - James Comer - - - Mike Johnson - - - Jodey C. Arrington - - - Angie Craig - - - Mikie Sherrill - - - Van Taylor - - - Chip Roy - - - Ben Cline - - - Heath Shuler - - - Kristi L. Noem - - - Sean P. Duffy - - - Martin Heinrich - - - Mike Lee - - - Tom Reed - - - Marco Rubio - - - Thomas Massie - - - Richard Hudson - - - Marc A. Veasey - - - Alexander X. Mooney - - - Ted Budd - - - Gilbert Ray Cisneros, Jr. - - - Debbie Mucarsel-Powell - - - Sean Casten - - - Jeffrey M. Landry - - - Michael G. Grimm - - - Frank C. Guinta - - - Todd Rokita - - - Thomas J. Rooney - - - Paul D. Ryan - - - Tom Graves - - - Steven M. Palazzo - - - Adrian Smith - - - Rob Woodall - - - Rodney Davis - - - Hakeem S. Jeffries - - - Ted Cruz - - - Joni Ernst - - - Warren Davidson - - - Greg Stanton - - - Michael Guest - - - Denver Riggleman - - - Kelly Loeffler - - - William M. Cowan - - - Robert Hurt - - - Robert J. Dold - - - Luke Messer - - - Bill Huizenga - - - Cathy McMorris Rodgers - - - Austin Scott - - - Linda T. Sánchez - - - Cory A. Booker - - - Ted Lieu - - - Mark Walker - - - Jimmy Panetta - - - Dean Phillips - - - Veronica Escobar - - - Jason Altmire - - - Tim Griffin - - - Daniel B. Maffei - - - Kelly Ayotte - - - Tim Huelskamp - - - David Young - - - James Lankford - - - Tammy Duckworth - - - George Holding - - - Darin LaHood - - - Jennifer Wexton - - - Kim Schrier - - - Connie Mack - - - Mark Takai - - - Mick Mulvaney - - - Jason Chaffetz - - - Jeff Denham - - - Raúl R. Labrador - - - Mike Bishop - - - Bruce Westerman - - - Vicente Gonzalez - - - Chrissy Houlahan - - - Randy Hultgren - - - Stephen Knight - - - Kirsten E. Gillibrand - - - Kathy Castor - - - Eric A. "Rick" Crawford - - - Theodore E. Deutch - - - Jeff Duncan - - - James A. Himes - - - Daniel Lipinski - - - Debbie Wasserman Schultz - - - Doug Collins - - - Sean Patrick Maloney - - - Stacey E. Plaskett - - - Trent Kelly - - - A. Drew Ferguson IV - - - David Kustoff - - - Liz Cheney - - - Ross Spano - - - Pete Stauber - - - Susie Lee - - - Martha McSally - - - Chris Jacobs - - - Jesse L. Jackson Jr. - - - David Rivera - - - John Sullivan - - - Jeff Chiesa - - - Steve Southerland II - - - Erik Paulsen - - - John Ratcliffe - - - Robert B. Aderholt - - - Rick Larsen - - - Kevin McCarthy - - - Steve Scalise - - - Tim Scott - - - Terri A. Sewell - - - Adam Smith - - - Steve Stivers - - - Ami Bera - - - Norma J. Torres - - - Kathleen M. Rice - - - Pramila Jayapal - - - Cynthia Axne - - - Tom Malinowski - - - John W. Rose - - - Fred Keller - - - Robert T. Schilling - - - Renee L. Ellmers - - - Christopher P. Gibson - - - Trey Gowdy - - - Timothy J. Walz - - - Dave Brat - - - Michael F. Bennet - - - Yvette D. Clarke - - - Scott DesJarlais - - - Brett Guthrie - - - Jim Jordan - - - James R. Langevin - - - Jared Huffman - - - Mark Pocan - - - Dan Sullivan - - - Kamala D. Harris - - - Catherine Cortez Masto - - - Salud O. Carbajal - - - Lloyd Smucker - - - Daniel Meuser - - - Tim Burchett - - - Mark E. Green - - - Dan Bishop - - - Betty Sutton - - - Eric Cantor - - - Mark L. Pryor - - - Mike Rogers - - - Joe Garcia - - - Michael G. Fitzpatrick - - - Gwen Graham - - - Mike Pompeo - - - Keith Ellison - - - Lynn Jenkins - - - John K. Delaney - - - Steve Russell - - - Christopher A. Coons - - - Gus M. Bilirakis - - - Sam Graves - - - Ron Kind - - - Rand Paul - - - Tony Cárdenas - - - Jackie Walorski - - - Filemon Vela - - - Katherine M. Clark - - - Barry Loudermilk - - - Don Bacon - - - TJ Cox - - - Gregory F. Murphy - - - Mark S. Critz - - - Todd Russell Platts - - - Laura Richardson - - - Mark Begich - - - Lee Terry - - - Patrick J. Tiberi - - - Joseph Crowley - - - Jeff Flake - - - Keith J. Rothfus - - - Mimi Walters - - - Karen C. Handel - - - Tammy Baldwin - - - Larry Bucshon - - - Charles J. "Chuck" Fleischmann - - - Michael T. McCaul - - - Pete Olson - - - John P. Sarbanes - - - David Schweikert - - - Suzan K. DelBene - - - Ann Wagner - - - Steve Daines - - - Scott Perry - - - John Katko - - - Lisa Blunt Rochester - - - Jamie Raskin - - - Thomas R. Suozzi - - - Troy Balderson - - - Jim Hagedorn - - - Mary Bono Mack - - - Mike Ross - - - Joe Walsh - - - Allen B. West - - - Pete P. Gallego - - - David Vitter - - - Joseph J. Heck - - - Ryan K. Zinke - - - Blake Farenthold - - - Peter J. Roskam - - - Bill Shuster - - - Claudia Tenney - - - David N. Cicilline - - - Mario Diaz-Balart - - - John Thune - - - Patrick J. Toomey - - - Juan Vargas - - - Cheri Bustos - - - Kevin Cramer - - - Matt Cartwright - - - John R. Moolenaar - - - Tom Emmer - - - Bradley Scott Schneider - - - Clay Higgins - - - Anthony G. Brown - - - Paul Mitchell - - - A. Donald McEachin - - - Greg Gianforte - - - Kevin Hern - - - Harley Rouda - - - Jim Matheson - - - John E. Walsh - - - E. Scott Rigell - - - Loretta Sanchez - - - Charles W. Dent - - - Evan H. Jenkins - - - Dean Heller - - - Mark Sanford - - - David A. Trott - - - Thomas MacArthur - - - Robert P. Casey, Jr. - - - Amy Klobuchar - - - Jeff Fortenberry - - - Vicky Hartzler - - - Frank D. Lucas - - - Adam B. Schiff - - - Michael R. Turner - - - Doug LaMalfa - - - Mark Takano - - - Susan W. Brooks - - - Chris Stewart - - - Jody B. Hice - - - Mike Bost - - - Thom Tillis - - - Roger W. Marshall - - - John R. Curtis - - - Lucy McBath - - - Andy Levin - - - Debra A. Haaland - - - Scott P. Brown - - - Rick Berg - - - Ben Chandler - - - Chip Cravaack - - - Nan A. S. Hayworth - - - Mike Pence - - - Jo Bonner - - - Mark Kirk - - - Scott Garrett - - - Jeff Miller - - - Pedro R. Pierluisi - - - Curt Clawson - - - Michelle Lujan Grisham - - - Dennis A. Ross - - - Elizabeth H. Esty - - - Barbara Comstock - - - Brenda Jones - - - Mark Meadows - - - Brian Higgins - - - James P. McGovern - - - Glenn Thompson - - - Chris Van Hollen - - - Robert J. Wittman - - - Ken Buck - - - Cindy Hyde-Smith - - - Mary Gay Scanlon - - - Madeleine Dean - - - Enid Greene Waldholtz - - - Steve Austria - - - Russ Carnahan - - - Kathleen C. Hochul - - - Alan Nunnelee - - - Donna F. Edwards - - - Steve Israel - - - Matt Salmon - - - Alan Grayson - - - Xavier Becerra - - - James B. Renacci - - - Maria Cantwell - - - Paul A. Gosar - - - H. Morgan Griffith - - - Gary C. Peters - - - Mike Quigley - - - Mike Rogers - - - John Shimkus - - - Mac Thornberry - - - Mark E. Amodei - - - Donald M. Payne, Jr. - - - Scott H. Peters - - - Daniel T. Kildee - - - Brad R. Wenstrup - - - Tim Kaine - - - Donald Norcross - - - Margaret Wood Hassan - - - Andy Biggs - - - J. Luis Correa - - - Tina Smith - - - Debbie Lesko - - - Hansen Clarke - - - Tim Holden - - - Robert E. Andrews - - - Bruce L. Braley - - - Cresent Hardy - - - Trent Franks - - - Jeb Hensarling - - - Bill Cassidy - - - Diana DeGette - - - Andy Harris - - - John Hoeven - - - Lisa Murkowski - - - Greg Walden - - - Steve Womack - - - David P. Joyce - - - Tom Rice - - - Earl L. "Buddy" Carter - - - Val Butler Demings - - - Jacky Rosen - - - Joseph D. Morelle - - - Susan Wild - - - John Joyce - - - Thomas P. Tiffany - - - Sandy Adams - - - Michele Bachmann - - - Mike McIntyre - - - Steve Stockman - - - Chaka Fattah - - - Charles W. Boustany Jr. - - - John C. Carney Jr. - - - Reid J. Ribble - - - Lou Barletta - - - John Abney Culberson - - - Gregg Harper - - - Daniel M. Donovan, Jr. - - - Jon Tester - - - Jeff Merkley - - - Wm. Lacy Clay - - - Robert E. Latta - - - Tom McClintock - - - Scott R. Tipton - - - Ann M. Kuster - - - Robin L. Kelly - - - J. French Hill - - - Charlie Crist - - - Ron Estes - - - Jesús G. "Chuy" García - - - Greg Pence - - - Denny Rehberg - - - Mary L. Landrieu - - - John Barrow - - - John Campbell - - - Jim Gerlach - - - Jack Kingston - - - Michael H. Michaud - - - Patrick Meehan - - - Mike Coffman - - - Joe Donnelly - - - Pete Sessions - - - Heidi Heitkamp - - - Rod Blum - - - Jason Lewis - - - Sheldon Whitehouse - - - Lindsey Graham - - - Kevin Brady - - - Richard Burr - - - Henry Cuellar - - - Ron Johnson - - - Billy Long - - - Stephen F. Lynch - - - Chellie Pingree - - - Rob Portman - - - Gregorio Kilili Camacho Sablan - - - Bill Foster - - - Ted S. Yoho - - - Bradley Byrne - - - Dan Newhouse - - - Glenn Grothman - - - David J. Trone - - - Steven C. LaTourette - - - Candice S. Miller - - - Cynthia M. Lummis - - - Tom Price - - - Robert Menendez - - - Mark R. Warner - - - Mo Brooks - - - Jim Cooper - - - Bill Flores - - - Bob Gibbs - - - Bill Johnson - - - Henry C. "Hank" Johnson, Jr. - - - Doug Lamborn - - - Betty McCollum - - - Jerry Moran - - - Brad Sherman - - - Suzanne Bonamici - - - Gary J. Palmer - - - Ralph Lee Abraham - - - Brenda L. Lawrence - - - Mike Rounds - - - Dwight Evans - - - Adriano Espaillat - - - Doug Jones - - - Mike Braun - - - Brad Miller - - - Kay R. Hagan - - - Dave Camp - - - Luther Strange - - - Claire McCaskill - - - Luis V. Gutiérrez - - - Darrell E. Issa - - - Bruce Poliquin - - - Karen Bass - - - Ken Calvert - - - Shelley Moore Capito - - - Steve Chabot - - - Judy Chu - - - Joe Courtney - - - Michael F. Doyle - - - Louie Gohmert - - - Gregory W. Meeks - - - Ed Perlmutter - - - Christopher H. Smith - - - Fred Upton - - - Nydia M. Velázquez - - - Randy K. Weber, Sr. - - - Debbie Dingell - - - Neal P. Dunn - - - Francis Rooney - - - Ralph Norman - - - Jefferson Van Drew - - - Ron Wright - - - Charles F. Bass - - - David Dreier - - - Steven R. Rothman - - - Janice Hahn - - - Dan Benishek - - - J. Randy Forbes - - - Tim Murphy - - - Bob Corker - - - Michael E. Capuano - - - Bob Goodlatte - - - Leonard Lance - - - Ileana Ros-Lehtinen - - - Carol Shea-Porter - - - John J. Faso - - - Tom Marino - - - Sherrod Brown - - - John Barrasso - - - Susan M. Collins - - - John Cornyn - - - Marsha Blackburn - - - Jim Costa - - - Marcia L. Fudge - - - William R. Keating - - - David Loebsack - - - Blaine Luetkemeyer - - - Julia Brownley - - - Denny Heck - - - Mark DeSaulnier - - - John H. Rutherford - - - Ed Case - - - Rick Scott - - - Shelley Berkley - - - Brian P. Bilbray - - - Ann Marie Buerkle - - - Larry Kissell - - - Jean Schmidt - - - Jim DeMint - - - John F. Tierney - - - Kerry L. Bentivolio - - - John Fleming - - - Richard L. Hanna - - - Richard B. Nugent - - - Al Franken - - - Diane Black - - - Edward R. Royce - - - Colleen Hanabusa - - - Elijah E. Cummings - - - Roger F. Wicker - - - Rob Bishop - - - Vern Buchanan - - - Mike Crapo - - - Kenny Marchant - - - Jerry McNerney - - - Gwen Moore - - - Frank Pallone, Jr. - - - Kurt Schrader - - - Albio Sires - - - Mike Thompson - - - Tim Walberg - - - Deb Fischer - - - Rick W. Allen - - - John Kennedy - - - Jo Ann Emerson - - - Mark Udall - - - Timothy H. Bishop - - - Mike Johanns - - - Lynn A. Westmoreland - - - David G. Reichert - - - Chris Collins - - - Debbie Stabenow - - - Roy Blunt - - - John Boozman - - - Michael C. Burgess - - - Gerald E. Connolly - - - Sheila Jackson Lee - - - Patty Murray - - - Charles E. Schumer - - - Michael K. Simpson - - - Jackie Speier - - - Dina Titus - - - Joyce Beatty - - - Donald S. Beyer, Jr. - - - Ann Kirkpatrick - - - Sylvia R. Garcia - - - Carol D. Miller - - - Francisco "Quico" Canseco - - - Jerry F. Costello - - - William L. Owens - - - Nick J. Rahall II - - - William L. Enyart - - - John A. Boehner - - - Randy Neugebauer - - - Brad Ashford - - - Joe Barton - - - Jack Reed - - - Steve Cohen - - - Tom Cole - - - Steve King - - - Richard E. Neal - - - Paul Tonko - - - Peter J. Visclosky - - - Daniel Webster - - - Ron Wyden - - - Elizabeth Warren - - - Roger Williams - - - David Perdue - - - Kent Conrad - - - David Alan Curson - - - Tom Coburn - - - Rush Holt - - - Tom Latham - - - Gary G. Miller - - - Allyson Y. Schwartz - - - Ted Poe - - - Robert Pittenger - - - Tom Udall - - - Earl Blumenauer - - - K. Michael Conaway - - - Raúl M. Grijalva - - - Mike Kelly - - - John B. Larson - - - Bennie G. Thompson - - - Lois Frankel - - - Brian Babin - - - Al Lawson, Jr. - - - Kweisi Mfume - - - Olympia J. Snowe - - - W. Todd Akin - - - Joe Baca - - - Spencer Bachus - - - John Kline - - - John J. Duncan, Jr. - - - Gene Green - - - Stevan Pearce - - - Dana Rohrabacher - - - Lamar Smith - - - Thomas R. Carper - - - Jeanne Shaheen - - - Joe Manchin, III - - - Sanford D. Bishop, Jr. - - - G. K. Butterfield - - - Peter A. DeFazio - - - Eliot L. Engel - - - Al Green - - - Mazie K. Hirono - - - Zoe Lofgren - - - David B. McKinley - - - Jerrold Nadler - - - Bill Posey - - - Robert C. "Bobby" Scott - - - Peter Welch - - - Joe Wilson - - - John A. Yarmuth - - - Aumua Amata Coleman Radewagen - - - Jack Bergman - - - Mitt Romney - - - Jim Webb - - - Timothy V. Johnson - - - Dennis J. Kucinich - - - Daniel E. Lungren - - - Rodney Alexander - - - Tim Johnson - - - Paul C. Broun - - - Corrine Brown - - - Jeff Sessions - - - Rodney P. Frelinghuysen - - - Frank A. LoBiondo - - - Niki Tsongas - - - Richard Blumenthal - - - Lloyd Doggett - - - Marcy Kaptur - - - Barbara Lee - - - Carolyn B. Maloney - - - Edward J. Markey - - - C. A. Dutch Ruppersberger - - - Bobby L. Rush - - - Alma S. Adams - - - Tom O’Halleran - - - Charles A. Gonzalez - - - Wally Herger - - - Melvin L. Watt - - - Donna M. Christensen - - - George Miller - - - James P. Moran - - - Ron Barber - - - Robert A. Brady - - - John Garamendi - - - David P. Roe - - - David Scott - - - Bonnie Watson Coleman - - - James R. Baird - - - Elton Gallegly - - - Donald A. Manzullo - - - Silvestre Reyes - - - Carolyn McCarthy - - - Ander Crenshaw - - - Johnny Isakson - - - Richard J. Durbin - - - Michael B. Enzi - - - Emanuel Cleaver - - - Susan A. Davis - - - Peter T. King - - - Doris O. Matsui - - - Collin C. Peterson - - - Janice D. Schakowsky - - - Angus S. King, Jr. - - - Jeff Bingaman - - - Kay Bailey Hutchison - - - John F. Kerry - - - Saxby Chambliss - - - Eni F. H. Faleomavaega - - - Ed Pastor - - - Ed Whitfield - - - Daniel Coats - - - John L. Mica - - - Richard M. Nolan - - - Walter B. Jones - - - Benjamin L. Cardin - - - James E. Risch - - - Rosa L. DeLauro - - - Virginia Foxx - - - Kay Granger - - - F. James Sensenbrenner, Jr. - - - José E. Serrano - - - Paul Cook - - - Bob Filner - - - Joseph I. Lieberman - - - Gary L. Ackerman - - - Phil Gingrey - - - Jon Kyl - - - Bill Nelson - - - Mitch McConnell - - - Anna G. Eshoo - - - Frederica S. Wilson - - - Ben Nelson - - - Howard L. Berman - - - Sue Wilkins Myrick - - - Cliff Stearns - - - Robert L. Turner - - - Max Baucus - - - Doc Hastings - - - Gloria Negrete McLeod - - - Sam Farr - - - Michael M. Honda - - - Bernard Sanders - - - John R. Carter - - - Danny K. Davis - - - Lucille Roybal-Allard - - - Alan S. Lowenthal - - - Donna E. Shalala - - - Norman D. Dicks - - - Barney Frank - - - Thomas E. Petri - - - Barbara Boxer - - - Rubén Hinojosa - - - John Lewis - - - Lamar Alexander - - - James E. Clyburn - - - Patrick J. Leahy - - - Nancy Pelosi - - - David E. Price - - - Tom Harkin - - - Henry A. Waxman - - - Frank R. Wolf - - - Harry Reid - - - Joseph R. Pitts - - - Steny H. Hoyer - - - Dan Burton - - - Maurice D. Hinchey - - - Howard P. "Buck" McKeon - - - Lois Capps - - - Maxine Waters - - - Judy Biggert - - - Lynn C. Woolsey - - - John D. Rockefeller, IV - - - Thad Cochran - - - Nita M. Lowey - - - Eleanor Holmes Norton - - - Bill Pascrell, Jr. - - - Harold Rogers - - - John W. Olver - - - Barbara A. Mikulski - - - Jim McDermott - - - John McCain - - - Pat Roberts - - - Alcee L. Hastings - - - Grace F. Napolitano - - - Herb Kohl - - - Ron Paul - - - Eddie Bernice Johnson - - - Leonard L. Boswell - - - Jerry Lewis - - - Edolphus Towns - - - Carl Levin - - - Orrin G. Hatch - - - James M. Inhofe - - - Richard C. Shelby - - - Madeleine Z. Bordallo - - - Dianne Feinstein - - - Chuck Grassley - - - Don Young - - - Richard G. Lugar - - - Fortney Pete Stark - - - Howard Coble - - - Sander M. Levin - - - C. W. Bill Young - - - Charles B. Rangel - - - Sam Johnson - - - Dale E. Kildee - - - John Conyers, Jr. - - - Louise McIntosh Slaughter - - - Roscoe G. Bartlett - - - John D. Dingell - - - Daniel K. Inouye - - - Daniel K. Akaka - - - Frank R. Lautenberg - - - Ralph M. Hall - + Alexandria Ocasio-Cortez + Abby Finkenauer + Katie Hill + Josh Harder + Lauren Underwood + Max Rose + Elise M. Stefanik + Mike Gallagher + Conor Lamb + Joe Neguse + Xochitl Torres Small + Anthony Gonzalez + William R. Timmons IV + Dan Crenshaw + Patrick Murphy + Trey Hollingsworth + Haley M. Stevens + Guy Reschenthaler + Colin Z. Allred + Matt Gaetz + Andy Kim + Joe Cunningham + Lance Gooden + Jared F. Golden + Aaron Schock + Tulsi Gabbard + Michael F. Q. San Nicolas + Ilhan Omar + Bryan Steil + Carlos Curbelo + Ruben J. Kihuen + Justin Amash + Eric Swalwell + Joseph P. Kennedy III + Jason Smith + Lee M. Zeldin + Brian J. Mast + Sharice Davids + Chris Pappas + Scott Taylor + Ruben Gallego + Pete Aguilar + Jim Banks + Jason Crow + Abigail Davis Spanberger + Josh Hawley + Ron DeSantis + Jaime Herrera Beutler + Adam Kinzinger + Seth Moulton + Stephanie N. Murphy + Darren Soto + Mike Levin + W. Gregory Steube + Anthony Brindisi + David G. Valadao + Tom Cotton + Markwayne Mullin + Brendan F. Boyle + Will Hurd + Antonio Delgado + Benjamin Quayle + Trey Radel + Marlin A. Stutzman + Kevin Yoder + Ryan A. Costello + Duncan Hunter + Martha Roby + Kyrsten Sinema + Ro Khanna + Nanette Diaz Barragán + Jenniffer González-Colón + Steve Watkins + Elissa Slotkin + Rashida Tlaib + Kelly Armstrong + Kendra S. Horn + Dusty Johnson + Mike Garcia + Jim Bridenstine + Jared Polis + Mia B. Love + Patrick T. McHenry + Grace Meng + Josh Gottheimer + Michael Cloud + Lizzie Fletcher + Elaine G. Luria + Vance M. McAllister + André Carson + Cory Gardner + Joaquin Castro + Derek Kilmer + Jimmy Gomez + Katie Porter + Michael Waltz + Ayanna Pressley + Ben McAdams + Dan Boren + Jon Runyan + Stephen Lee Fincher + Christopher Murphy + Devin Nunes + Cedric L. Richmond + Tim Ryan + Andy Barr + Raja Krishnamoorthi + Brian K. Fitzpatrick + Steven Horsford + Jahana Hayes + Russ Fulcher + Lori Trahan + David W. Jolly + Beto O’Rourke + Thomas A. Garrett, Jr. + Ben Ray Luján + Todd Young + Brian Schatz + Raul Ruiz + Garret Graves + David Rouzer + Ben Sasse + James Comer + Mike Johnson + Jodey C. Arrington + Angie Craig + Mikie Sherrill + Van Taylor + Chip Roy + Ben Cline + Heath Shuler + Kristi L. Noem + Sean P. Duffy + Martin Heinrich + Mike Lee + Tom Reed + Marco Rubio + Thomas Massie + Richard Hudson + Marc A. Veasey + Alexander X. Mooney + Ted Budd + Gilbert Ray Cisneros, Jr. + Debbie Mucarsel-Powell + Sean Casten + Jeffrey M. Landry + Michael G. Grimm + Frank C. Guinta + Todd Rokita + Thomas J. Rooney + Paul D. Ryan + Tom Graves + Steven M. Palazzo + Adrian Smith + Rob Woodall + Rodney Davis + Hakeem S. Jeffries + Ted Cruz + Joni Ernst + Warren Davidson + Greg Stanton + Michael Guest + Denver Riggleman + Kelly Loeffler + William M. Cowan + Robert Hurt + Robert J. Dold + Luke Messer + Bill Huizenga + Cathy McMorris Rodgers + Austin Scott + Linda T. Sánchez + Cory A. Booker + Ted Lieu + Mark Walker + Jimmy Panetta + Dean Phillips + Veronica Escobar + Jason Altmire + Tim Griffin + Daniel B. Maffei + Kelly Ayotte + Tim Huelskamp + David Young + James Lankford + Tammy Duckworth + George Holding + Darin LaHood + Jennifer Wexton + Kim Schrier + Connie Mack + Mark Takai + Mick Mulvaney + Jason Chaffetz + Jeff Denham + Raúl R. Labrador + Mike Bishop + Bruce Westerman + Vicente Gonzalez + Chrissy Houlahan + Randy Hultgren + Stephen Knight + Kirsten E. Gillibrand + Kathy Castor + Eric A. "Rick" Crawford + Theodore E. Deutch + Jeff Duncan + James A. Himes + Daniel Lipinski + Debbie Wasserman Schultz + Doug Collins + Sean Patrick Maloney + Stacey E. Plaskett + Trent Kelly + A. Drew Ferguson IV + David Kustoff + Liz Cheney + Ross Spano + Pete Stauber + Susie Lee + Martha McSally + Chris Jacobs + Jesse L. Jackson Jr. + David Rivera + John Sullivan + Jeff Chiesa + Steve Southerland II + Erik Paulsen + John Ratcliffe + Robert B. Aderholt + Rick Larsen + Kevin McCarthy + Steve Scalise + Tim Scott + Terri A. Sewell + Adam Smith + Steve Stivers + Ami Bera + Norma J. Torres + Kathleen M. Rice + Pramila Jayapal + Cynthia Axne + Tom Malinowski + John W. Rose + Fred Keller + Robert T. Schilling + Renee L. Ellmers + Christopher P. Gibson + Trey Gowdy + Timothy J. Walz + Dave Brat + Michael F. Bennet + Yvette D. Clarke + Scott DesJarlais + Brett Guthrie + Jim Jordan + James R. Langevin + Jared Huffman + Mark Pocan + Dan Sullivan + Kamala D. Harris + Catherine Cortez Masto + Salud O. Carbajal + Lloyd Smucker + Daniel Meuser + Tim Burchett + Mark E. Green + Dan Bishop + Betty Sutton + Eric Cantor + Mark L. Pryor + Mike Rogers + Joe Garcia + Michael G. Fitzpatrick + Gwen Graham + Mike Pompeo + Keith Ellison + Lynn Jenkins + John K. Delaney + Steve Russell + Christopher A. Coons + Gus M. Bilirakis + Sam Graves + Ron Kind + Rand Paul + Tony Cárdenas + Jackie Walorski + Filemon Vela + Katherine M. Clark + Barry Loudermilk + Don Bacon + TJ Cox + Gregory F. Murphy + Mark S. Critz + Todd Russell Platts + Laura Richardson + Mark Begich + Lee Terry + Patrick J. Tiberi + Joseph Crowley + Jeff Flake + Keith J. Rothfus + Mimi Walters + Karen C. Handel + Tammy Baldwin + Larry Bucshon + Charles J. "Chuck" Fleischmann + Michael T. McCaul + Pete Olson + John P. Sarbanes + David Schweikert + Suzan K. DelBene + Ann Wagner + Steve Daines + Scott Perry + John Katko + Lisa Blunt Rochester + Jamie Raskin + Thomas R. Suozzi + Troy Balderson + Jim Hagedorn + Mary Bono Mack + Mike Ross + Joe Walsh + Allen B. West + Pete P. Gallego + David Vitter + Joseph J. Heck + Ryan K. Zinke + Blake Farenthold + Peter J. Roskam + Bill Shuster + Claudia Tenney + David N. Cicilline + Mario Diaz-Balart + John Thune + Patrick J. Toomey + Juan Vargas + Cheri Bustos + Kevin Cramer + Matt Cartwright + John R. Moolenaar + Tom Emmer + Bradley Scott Schneider + Clay Higgins + Anthony G. Brown + Paul Mitchell + A. Donald McEachin + Greg Gianforte + Kevin Hern + Harley Rouda + Jim Matheson + John E. Walsh + E. Scott Rigell + Loretta Sanchez + Charles W. Dent + Evan H. Jenkins + Dean Heller + Mark Sanford + David A. Trott + Thomas MacArthur + Robert P. Casey, Jr. + Amy Klobuchar + Jeff Fortenberry + Vicky Hartzler + Frank D. Lucas + Adam B. Schiff + Michael R. Turner + Doug LaMalfa + Mark Takano + Susan W. Brooks + Chris Stewart + Jody B. Hice + Mike Bost + Thom Tillis + Roger W. Marshall + John R. Curtis + Lucy McBath + Andy Levin + Debra A. Haaland + Scott P. Brown + Rick Berg + Ben Chandler + Chip Cravaack + Nan A. S. Hayworth + Mike Pence + Jo Bonner + Mark Kirk + Scott Garrett + Jeff Miller + Pedro R. Pierluisi + Curt Clawson + Michelle Lujan Grisham + Dennis A. Ross + Elizabeth H. Esty + Barbara Comstock + Brenda Jones + Mark Meadows + Brian Higgins + James P. McGovern + Glenn Thompson + Chris Van Hollen + Robert J. Wittman + Ken Buck + Cindy Hyde-Smith + Mary Gay Scanlon + Madeleine Dean + Enid Greene Waldholtz + Steve Austria + Russ Carnahan + Kathleen C. Hochul + Alan Nunnelee + Donna F. Edwards + Steve Israel + Matt Salmon + Alan Grayson + Xavier Becerra + James B. Renacci + Maria Cantwell + Paul A. Gosar + H. Morgan Griffith + Gary C. Peters + Mike Quigley + Mike Rogers + John Shimkus + Mac Thornberry + Mark E. Amodei + Donald M. Payne, Jr. + Scott H. Peters + Daniel T. Kildee + Brad R. Wenstrup + Tim Kaine + Donald Norcross + Margaret Wood Hassan + Andy Biggs + J. Luis Correa + Tina Smith + Debbie Lesko + Hansen Clarke + Tim Holden + Robert E. Andrews + Bruce L. Braley + Cresent Hardy + Trent Franks + Jeb Hensarling + Bill Cassidy + Diana DeGette + Andy Harris + John Hoeven + Lisa Murkowski + Greg Walden + Steve Womack + David P. Joyce + Tom Rice + Earl L. "Buddy" Carter + Val Butler Demings + Jacky Rosen + Joseph D. Morelle + Susan Wild + John Joyce + Thomas P. Tiffany + Sandy Adams + Michele Bachmann + Mike McIntyre + Steve Stockman + Chaka Fattah + Charles W. Boustany Jr. + John C. Carney Jr. + Reid J. Ribble + Lou Barletta + John Abney Culberson + Gregg Harper + Daniel M. Donovan, Jr. + Jon Tester + Jeff Merkley + Wm. Lacy Clay + Robert E. Latta + Tom McClintock + Scott R. Tipton + Ann M. Kuster + Robin L. Kelly + J. French Hill + Charlie Crist + Ron Estes + Jesús G. "Chuy" García + Greg Pence + Denny Rehberg + Mary L. Landrieu + John Barrow + John Campbell + Jim Gerlach + Jack Kingston + Michael H. Michaud + Patrick Meehan + Mike Coffman + Joe Donnelly + Pete Sessions + Heidi Heitkamp + Rod Blum + Jason Lewis + Sheldon Whitehouse + Lindsey Graham + Kevin Brady + Richard Burr + Henry Cuellar + Ron Johnson + Billy Long + Stephen F. Lynch + Chellie Pingree + Rob Portman + Gregorio Kilili Camacho Sablan + Bill Foster + Ted S. Yoho + Bradley Byrne + Dan Newhouse + Glenn Grothman + David J. Trone + Steven C. LaTourette + Candice S. Miller + Cynthia M. Lummis + Tom Price + Robert Menendez + Mark R. Warner + Mo Brooks + Jim Cooper + Bill Flores + Bob Gibbs + Bill Johnson + Henry C. "Hank" Johnson, Jr. + Doug Lamborn + Betty McCollum + Jerry Moran + Brad Sherman + Suzanne Bonamici + Gary J. Palmer + Ralph Lee Abraham + Brenda L. Lawrence + Mike Rounds + Dwight Evans + Adriano Espaillat + Doug Jones + Mike Braun + Brad Miller + Kay R. Hagan + Dave Camp + Luther Strange + Claire McCaskill + Luis V. Gutiérrez + Darrell E. Issa + Bruce Poliquin + Karen Bass + Ken Calvert + Shelley Moore Capito + Steve Chabot + Judy Chu + Joe Courtney + Michael F. Doyle + Louie Gohmert + Gregory W. Meeks + Ed Perlmutter + Christopher H. Smith + Fred Upton + Nydia M. Velázquez + Randy K. Weber, Sr. + Debbie Dingell + Neal P. Dunn + Francis Rooney + Ralph Norman + Jefferson Van Drew + Ron Wright + Charles F. Bass + David Dreier + Steven R. Rothman + Janice Hahn + Dan Benishek + J. Randy Forbes + Tim Murphy + Bob Corker + Michael E. Capuano + Bob Goodlatte + Leonard Lance + Ileana Ros-Lehtinen + Carol Shea-Porter + John J. Faso + Tom Marino + Sherrod Brown + John Barrasso + Susan M. Collins + John Cornyn + Marsha Blackburn + Jim Costa + Marcia L. Fudge + William R. Keating + David Loebsack + Blaine Luetkemeyer + Julia Brownley + Denny Heck + Mark DeSaulnier + John H. Rutherford + Ed Case + Rick Scott + Shelley Berkley + Brian P. Bilbray + Ann Marie Buerkle + Larry Kissell + Jean Schmidt + Jim DeMint + John F. Tierney + Kerry L. Bentivolio + John Fleming + Richard L. Hanna + Richard B. Nugent + Al Franken + Diane Black + Edward R. Royce + Colleen Hanabusa + Elijah E. Cummings + Roger F. Wicker + Rob Bishop + Vern Buchanan + Mike Crapo + Kenny Marchant + Jerry McNerney + Gwen Moore + Frank Pallone, Jr. + Kurt Schrader + Albio Sires + Mike Thompson + Tim Walberg + Deb Fischer + Rick W. Allen + John Kennedy + Jo Ann Emerson + Mark Udall + Timothy H. Bishop + Mike Johanns + Lynn A. Westmoreland + David G. Reichert + Chris Collins + Debbie Stabenow + Roy Blunt + John Boozman + Michael C. Burgess + Gerald E. Connolly + Sheila Jackson Lee + Patty Murray + Charles E. Schumer + Michael K. Simpson + Jackie Speier + Dina Titus + Joyce Beatty + Donald S. Beyer, Jr. + Ann Kirkpatrick + Sylvia R. Garcia + Carol D. Miller + Francisco "Quico" Canseco + Jerry F. Costello + William L. Owens + Nick J. Rahall II + William L. Enyart + John A. Boehner + Randy Neugebauer + Brad Ashford + Joe Barton + Jack Reed + Steve Cohen + Tom Cole + Steve King + Richard E. Neal + Paul Tonko + Peter J. Visclosky + Daniel Webster + Ron Wyden + Elizabeth Warren + Roger Williams + David Perdue + Kent Conrad + David Alan Curson + Tom Coburn + Rush Holt + Tom Latham + Gary G. Miller + Allyson Y. Schwartz + Ted Poe + Robert Pittenger + Tom Udall + Earl Blumenauer + K. Michael Conaway + Raúl M. Grijalva + Mike Kelly + John B. Larson + Bennie G. Thompson + Lois Frankel + Brian Babin + Al Lawson, Jr. + Kweisi Mfume + Olympia J. Snowe + W. Todd Akin + Joe Baca + Spencer Bachus + John Kline + John J. Duncan, Jr. + Gene Green + Stevan Pearce + Dana Rohrabacher + Lamar Smith + Thomas R. Carper + Jeanne Shaheen + Joe Manchin, III + Sanford D. Bishop, Jr. + G. K. Butterfield + Peter A. DeFazio + Eliot L. Engel + Al Green + Mazie K. Hirono + Zoe Lofgren + David B. McKinley + Jerrold Nadler + Bill Posey + Robert C. "Bobby" Scott + Peter Welch + Joe Wilson + John A. Yarmuth + Aumua Amata Coleman Radewagen + Jack Bergman + Mitt Romney + Jim Webb + Timothy V. Johnson + Dennis J. Kucinich + Daniel E. Lungren + Rodney Alexander + Tim Johnson + Paul C. Broun + Corrine Brown + Jeff Sessions + Rodney P. Frelinghuysen + Frank A. LoBiondo + Niki Tsongas + Richard Blumenthal + Lloyd Doggett + Marcy Kaptur + Barbara Lee + Carolyn B. Maloney + Edward J. Markey + C. A. Dutch Ruppersberger + Bobby L. Rush + Alma S. Adams + Tom O’Halleran + Charles A. Gonzalez + Wally Herger + Melvin L. Watt + Donna M. Christensen + George Miller + James P. Moran + Ron Barber + Robert A. Brady + John Garamendi + David P. Roe + David Scott + Bonnie Watson Coleman + James R. Baird + Elton Gallegly + Donald A. Manzullo + Silvestre Reyes + Carolyn McCarthy + Ander Crenshaw + Johnny Isakson + Richard J. Durbin + Michael B. Enzi + Emanuel Cleaver + Susan A. Davis + Peter T. King + Doris O. Matsui + Collin C. Peterson + Janice D. Schakowsky + Angus S. King, Jr. + Jeff Bingaman + Kay Bailey Hutchison + John F. Kerry + Saxby Chambliss + Eni F. H. Faleomavaega + Ed Pastor + Ed Whitfield + Daniel Coats + John L. Mica + Richard M. Nolan + Walter B. Jones + Benjamin L. Cardin + James E. Risch + Rosa L. DeLauro + Virginia Foxx + Kay Granger + F. James Sensenbrenner, Jr. + José E. Serrano + Paul Cook + Bob Filner + Joseph I. Lieberman + Gary L. Ackerman + Phil Gingrey + Jon Kyl + Bill Nelson + Mitch McConnell + Anna G. Eshoo + Frederica S. Wilson + Ben Nelson + Howard L. Berman + Sue Wilkins Myrick + Cliff Stearns + Robert L. Turner + Max Baucus + Doc Hastings + Gloria Negrete McLeod + Sam Farr + Michael M. Honda + Bernard Sanders + John R. Carter + Danny K. Davis + Lucille Roybal-Allard + Alan S. Lowenthal + Donna E. Shalala + Norman D. Dicks + Barney Frank + Thomas E. Petri + Barbara Boxer + Rubén Hinojosa + John Lewis + Lamar Alexander + James E. Clyburn + Patrick J. Leahy + Nancy Pelosi + David E. Price + Tom Harkin + Henry A. Waxman + Frank R. Wolf + Harry Reid + Joseph R. Pitts + Steny H. Hoyer + Dan Burton + Maurice D. Hinchey + Howard P. "Buck" McKeon + Lois Capps + Maxine Waters + Judy Biggert + Lynn C. Woolsey + John D. Rockefeller, IV + Thad Cochran + Nita M. Lowey + Eleanor Holmes Norton + Bill Pascrell, Jr. + Harold Rogers + John W. Olver + Barbara A. Mikulski + Jim McDermott + John McCain + Pat Roberts + Alcee L. Hastings + Grace F. Napolitano + Herb Kohl + Ron Paul + Eddie Bernice Johnson + Leonard L. Boswell + Jerry Lewis + Edolphus Towns + Carl Levin + Orrin G. Hatch + James M. Inhofe + Richard C. Shelby + Madeleine Z. Bordallo + Dianne Feinstein + Chuck Grassley + Don Young + Richard G. Lugar + Fortney Pete Stark + Howard Coble + Sander M. Levin + C. W. Bill Young + Charles B. Rangel + Sam Johnson + Dale E. Kildee + John Conyers, Jr. + Louise McIntosh Slaughter + Roscoe G. Bartlett + John D. Dingell + Daniel K. Inouye + Daniel K. Akaka + Frank R. Lautenberg + Ralph M. Hall diff --git a/test/output/usCongressAgeGender.svg b/test/output/usCongressAgeGender.svg index 38f16a2e51..1376e719eb 100644 --- a/test/output/usCongressAgeGender.svg +++ b/test/output/usCongressAgeGender.svg @@ -13,2728 +13,950 @@ white-space: pre; } - - - - 10 - - - - 5 - - - - 0 - - - - 5 - - - - 10 - - - - 15 - - - - 20 - - - - 25 - ← Women · Men → + + + + + + + + + + + + + + + + + + + + + + 10 + 5 + 0 + 5 + 10 + 15 + 20 + 25 + + + ← Women · Men → + + + + + + + + + + + + + 30 + 40 + 50 + 60 + 70 + 80 + 90 + 100 - - - 30 - - - 40 - - - 50 - - - 60 - - - 70 - - - 80 - - - 90 - - - 100 - Age → + + Age → - - Alexandria Ocasio-Cortez - - - Abby Finkenauer - - - Katie Hill - - - Josh Harder - - - Lauren Underwood - - - Max Rose - - - Elise M. Stefanik - - - Mike Gallagher - - - Conor Lamb - - - Joe Neguse - - - Xochitl Torres Small - - - Anthony Gonzalez - - - William R. Timmons IV - - - Dan Crenshaw - - - Patrick Murphy - - - Trey Hollingsworth - - - Haley M. Stevens - - - Guy Reschenthaler - - - Colin Z. Allred - - - Matt Gaetz - - - Andy Kim - - - Joe Cunningham - - - Lance Gooden - - - Jared F. Golden - - - Aaron Schock - - - Tulsi Gabbard - - - Michael F. Q. San Nicolas - - - Ilhan Omar - - - Bryan Steil - - - Carlos Curbelo - - - Ruben J. Kihuen - - - Justin Amash - - - Eric Swalwell - - - Joseph P. Kennedy III - - - Jason Smith - - - Lee M. Zeldin - - - Brian J. Mast - - - Sharice Davids - - - Chris Pappas - - - Scott Taylor - - - Ruben Gallego - - - Pete Aguilar - - - Jim Banks - - - Jason Crow - - - Abigail Davis Spanberger - - - Josh Hawley - - - Ron DeSantis - - - Jaime Herrera Beutler - - - Adam Kinzinger - - - Seth Moulton - - - Stephanie N. Murphy - - - Darren Soto - - - Mike Levin - - - W. Gregory Steube - - - Anthony Brindisi - - - David G. Valadao - - - Tom Cotton - - - Markwayne Mullin - - - Brendan F. Boyle - - - Will Hurd - - - Antonio Delgado - - - Benjamin Quayle - - - Trey Radel - - - Marlin A. Stutzman - - - Kevin Yoder - - - Ryan A. Costello - - - Duncan Hunter - - - Martha Roby - - - Kyrsten Sinema - - - Ro Khanna - - - Nanette Diaz Barragán - - - Jenniffer González-Colón - - - Steve Watkins - - - Elissa Slotkin - - - Rashida Tlaib - - - Kelly Armstrong - - - Kendra S. Horn - - - Dusty Johnson - - - Mike Garcia - - - Jim Bridenstine - - - Jared Polis - - - Mia B. Love - - - Patrick T. McHenry - - - Grace Meng - - - Josh Gottheimer - - - Michael Cloud - - - Lizzie Fletcher - - - Elaine G. Luria - - - Vance M. McAllister - - - André Carson - - - Cory Gardner - - - Joaquin Castro - - - Derek Kilmer - - - Jimmy Gomez - - - Katie Porter - - - Michael Waltz - - - Ayanna Pressley - - - Ben McAdams - - - Dan Boren - - - Jon Runyan - - - Stephen Lee Fincher - - - Christopher Murphy - - - Devin Nunes - - - Cedric L. Richmond - - - Tim Ryan - - - Andy Barr - - - Raja Krishnamoorthi - - - Brian K. Fitzpatrick - - - Steven Horsford - - - Jahana Hayes - - - Russ Fulcher - - - Lori Trahan - - - David W. Jolly - - - Beto O’Rourke - - - Thomas A. Garrett, Jr. - - - Ben Ray Luján - - - Todd Young - - - Brian Schatz - - - Raul Ruiz - - - Garret Graves - - - David Rouzer - - - Ben Sasse - - - James Comer - - - Mike Johnson - - - Jodey C. Arrington - - - Angie Craig - - - Mikie Sherrill - - - Van Taylor - - - Chip Roy - - - Ben Cline - - - Heath Shuler - - - Kristi L. Noem - - - Sean P. Duffy - - - Martin Heinrich - - - Mike Lee - - - Tom Reed - - - Marco Rubio - - - Thomas Massie - - - Richard Hudson - - - Marc A. Veasey - - - Alexander X. Mooney - - - Ted Budd - - - Gilbert Ray Cisneros, Jr. - - - Debbie Mucarsel-Powell - - - Sean Casten - - - Jeffrey M. Landry - - - Michael G. Grimm - - - Frank C. Guinta - - - Todd Rokita - - - Thomas J. Rooney - - - Paul D. Ryan - - - Tom Graves - - - Steven M. Palazzo - - - Adrian Smith - - - Rob Woodall - - - Rodney Davis - - - Hakeem S. Jeffries - - - Ted Cruz - - - Joni Ernst - - - Warren Davidson - - - Greg Stanton - - - Michael Guest - - - Denver Riggleman - - - Kelly Loeffler - - - William M. Cowan - - - Robert Hurt - - - Robert J. Dold - - - Luke Messer - - - Bill Huizenga - - - Cathy McMorris Rodgers - - - Austin Scott - - - Linda T. Sánchez - - - Cory A. Booker - - - Ted Lieu - - - Mark Walker - - - Jimmy Panetta - - - Dean Phillips - - - Veronica Escobar - - - Jason Altmire - - - Tim Griffin - - - Daniel B. Maffei - - - Kelly Ayotte - - - Tim Huelskamp - - - David Young - - - James Lankford - - - Tammy Duckworth - - - George Holding - - - Darin LaHood - - - Jennifer Wexton - - - Kim Schrier - - - Connie Mack - - - Mark Takai - - - Mick Mulvaney - - - Jason Chaffetz - - - Jeff Denham - - - Raúl R. Labrador - - - Mike Bishop - - - Bruce Westerman - - - Vicente Gonzalez - - - Chrissy Houlahan - - - Randy Hultgren - - - Stephen Knight - - - Kirsten E. Gillibrand - - - Kathy Castor - - - Eric A. "Rick" Crawford - - - Theodore E. Deutch - - - Jeff Duncan - - - James A. Himes - - - Daniel Lipinski - - - Debbie Wasserman Schultz - - - Doug Collins - - - Sean Patrick Maloney - - - Stacey E. Plaskett - - - Trent Kelly - - - A. Drew Ferguson IV - - - David Kustoff - - - Liz Cheney - - - Ross Spano - - - Pete Stauber - - - Susie Lee - - - Martha McSally - - - Chris Jacobs - - - Jesse L. Jackson Jr. - - - David Rivera - - - John Sullivan - - - Jeff Chiesa - - - Steve Southerland II - - - Erik Paulsen - - - John Ratcliffe - - - Robert B. Aderholt - - - Rick Larsen - - - Kevin McCarthy - - - Steve Scalise - - - Tim Scott - - - Terri A. Sewell - - - Adam Smith - - - Steve Stivers - - - Ami Bera - - - Norma J. Torres - - - Kathleen M. Rice - - - Pramila Jayapal - - - Cynthia Axne - - - Tom Malinowski - - - John W. Rose - - - Fred Keller - - - Robert T. Schilling - - - Renee L. Ellmers - - - Christopher P. Gibson - - - Trey Gowdy - - - Timothy J. Walz - - - Dave Brat - - - Michael F. Bennet - - - Yvette D. Clarke - - - Scott DesJarlais - - - Brett Guthrie - - - Jim Jordan - - - James R. Langevin - - - Jared Huffman - - - Mark Pocan - - - Dan Sullivan - - - Kamala D. Harris - - - Catherine Cortez Masto - - - Salud O. Carbajal - - - Lloyd Smucker - - - Daniel Meuser - - - Tim Burchett - - - Mark E. Green - - - Dan Bishop - - - Betty Sutton - - - Eric Cantor - - - Mark L. Pryor - - - Mike Rogers - - - Joe Garcia - - - Michael G. Fitzpatrick - - - Gwen Graham - - - Mike Pompeo - - - Keith Ellison - - - Lynn Jenkins - - - John K. Delaney - - - Steve Russell - - - Christopher A. Coons - - - Gus M. Bilirakis - - - Sam Graves - - - Ron Kind - - - Rand Paul - - - Tony Cárdenas - - - Jackie Walorski - - - Filemon Vela - - - Katherine M. Clark - - - Barry Loudermilk - - - Don Bacon - - - TJ Cox - - - Gregory F. Murphy - - - Mark S. Critz - - - Todd Russell Platts - - - Laura Richardson - - - Mark Begich - - - Lee Terry - - - Patrick J. Tiberi - - - Joseph Crowley - - - Jeff Flake - - - Keith J. Rothfus - - - Mimi Walters - - - Karen C. Handel - - - Tammy Baldwin - - - Larry Bucshon - - - Charles J. "Chuck" Fleischmann - - - Michael T. McCaul - - - Pete Olson - - - John P. Sarbanes - - - David Schweikert - - - Suzan K. DelBene - - - Ann Wagner - - - Steve Daines - - - Scott Perry - - - John Katko - - - Lisa Blunt Rochester - - - Jamie Raskin - - - Thomas R. Suozzi - - - Troy Balderson - - - Jim Hagedorn - - - Mary Bono Mack - - - Mike Ross - - - Joe Walsh - - - Allen B. West - - - Pete P. Gallego - - - David Vitter - - - Joseph J. Heck - - - Ryan K. Zinke - - - Blake Farenthold - - - Peter J. Roskam - - - Bill Shuster - - - Claudia Tenney - - - David N. Cicilline - - - Mario Diaz-Balart - - - John Thune - - - Patrick J. Toomey - - - Juan Vargas - - - Cheri Bustos - - - Kevin Cramer - - - Matt Cartwright - - - John R. Moolenaar - - - Tom Emmer - - - Bradley Scott Schneider - - - Clay Higgins - - - Anthony G. Brown - - - Paul Mitchell - - - A. Donald McEachin - - - Greg Gianforte - - - Kevin Hern - - - Harley Rouda - - - Jim Matheson - - - John E. Walsh - - - E. Scott Rigell - - - Loretta Sanchez - - - Charles W. Dent - - - Evan H. Jenkins - - - Dean Heller - - - Mark Sanford - - - David A. Trott - - - Thomas MacArthur - - - Robert P. Casey, Jr. - - - Amy Klobuchar - - - Jeff Fortenberry - - - Vicky Hartzler - - - Frank D. Lucas - - - Adam B. Schiff - - - Michael R. Turner - - - Doug LaMalfa - - - Mark Takano - - - Susan W. Brooks - - - Chris Stewart - - - Jody B. Hice - - - Mike Bost - - - Thom Tillis - - - Roger W. Marshall - - - John R. Curtis - - - Lucy McBath - - - Andy Levin - - - Debra A. Haaland - - - Scott P. Brown - - - Rick Berg - - - Ben Chandler - - - Chip Cravaack - - - Nan A. S. Hayworth - - - Mike Pence - - - Jo Bonner - - - Mark Kirk - - - Scott Garrett - - - Jeff Miller - - - Pedro R. Pierluisi - - - Curt Clawson - - - Michelle Lujan Grisham - - - Dennis A. Ross - - - Elizabeth H. Esty - - - Barbara Comstock - - - Brenda Jones - - - Mark Meadows - - - Brian Higgins - - - James P. McGovern - - - Glenn Thompson - - - Chris Van Hollen - - - Robert J. Wittman - - - Ken Buck - - - Cindy Hyde-Smith - - - Mary Gay Scanlon - - - Madeleine Dean - - - Enid Greene Waldholtz - - - Steve Austria - - - Russ Carnahan - - - Kathleen C. Hochul - - - Alan Nunnelee - - - Donna F. Edwards - - - Steve Israel - - - Matt Salmon - - - Alan Grayson - - - Xavier Becerra - - - James B. Renacci - - - Maria Cantwell - - - Paul A. Gosar - - - H. Morgan Griffith - - - Gary C. Peters - - - Mike Quigley - - - Mike Rogers - - - John Shimkus - - - Mac Thornberry - - - Mark E. Amodei - - - Donald M. Payne, Jr. - - - Scott H. Peters - - - Daniel T. Kildee - - - Brad R. Wenstrup - - - Tim Kaine - - - Donald Norcross - - - Margaret Wood Hassan - - - Andy Biggs - - - J. Luis Correa - - - Tina Smith - - - Debbie Lesko - - - Hansen Clarke - - - Tim Holden - - - Robert E. Andrews - - - Bruce L. Braley - - - Cresent Hardy - - - Trent Franks - - - Jeb Hensarling - - - Bill Cassidy - - - Diana DeGette - - - Andy Harris - - - John Hoeven - - - Lisa Murkowski - - - Greg Walden - - - Steve Womack - - - David P. Joyce - - - Tom Rice - - - Earl L. "Buddy" Carter - - - Val Butler Demings - - - Jacky Rosen - - - Joseph D. Morelle - - - Susan Wild - - - John Joyce - - - Thomas P. Tiffany - - - Sandy Adams - - - Michele Bachmann - - - Mike McIntyre - - - Steve Stockman - - - Chaka Fattah - - - Charles W. Boustany Jr. - - - John C. Carney Jr. - - - Reid J. Ribble - - - Lou Barletta - - - John Abney Culberson - - - Gregg Harper - - - Daniel M. Donovan, Jr. - - - Jon Tester - - - Jeff Merkley - - - Wm. Lacy Clay - - - Robert E. Latta - - - Tom McClintock - - - Scott R. Tipton - - - Ann M. Kuster - - - Robin L. Kelly - - - J. French Hill - - - Charlie Crist - - - Ron Estes - - - Jesús G. "Chuy" García - - - Greg Pence - - - Denny Rehberg - - - Mary L. Landrieu - - - John Barrow - - - John Campbell - - - Jim Gerlach - - - Jack Kingston - - - Michael H. Michaud - - - Patrick Meehan - - - Mike Coffman - - - Joe Donnelly - - - Pete Sessions - - - Heidi Heitkamp - - - Rod Blum - - - Jason Lewis - - - Sheldon Whitehouse - - - Lindsey Graham - - - Kevin Brady - - - Richard Burr - - - Henry Cuellar - - - Ron Johnson - - - Billy Long - - - Stephen F. Lynch - - - Chellie Pingree - - - Rob Portman - - - Gregorio Kilili Camacho Sablan - - - Bill Foster - - - Ted S. Yoho - - - Bradley Byrne - - - Dan Newhouse - - - Glenn Grothman - - - David J. Trone - - - Steven C. LaTourette - - - Candice S. Miller - - - Cynthia M. Lummis - - - Tom Price - - - Robert Menendez - - - Mark R. Warner - - - Mo Brooks - - - Jim Cooper - - - Bill Flores - - - Bob Gibbs - - - Bill Johnson - - - Henry C. "Hank" Johnson, Jr. - - - Doug Lamborn - - - Betty McCollum - - - Jerry Moran - - - Brad Sherman - - - Suzanne Bonamici - - - Gary J. Palmer - - - Ralph Lee Abraham - - - Brenda L. Lawrence - - - Mike Rounds - - - Dwight Evans - - - Adriano Espaillat - - - Doug Jones - - - Mike Braun - - - Brad Miller - - - Kay R. Hagan - - - Dave Camp - - - Luther Strange - - - Claire McCaskill - - - Luis V. Gutiérrez - - - Darrell E. Issa - - - Bruce Poliquin - - - Karen Bass - - - Ken Calvert - - - Shelley Moore Capito - - - Steve Chabot - - - Judy Chu - - - Joe Courtney - - - Michael F. Doyle - - - Louie Gohmert - - - Gregory W. Meeks - - - Ed Perlmutter - - - Christopher H. Smith - - - Fred Upton - - - Nydia M. Velázquez - - - Randy K. Weber, Sr. - - - Debbie Dingell - - - Neal P. Dunn - - - Francis Rooney - - - Ralph Norman - - - Jefferson Van Drew - - - Ron Wright - - - Charles F. Bass - - - David Dreier - - - Steven R. Rothman - - - Janice Hahn - - - Dan Benishek - - - J. Randy Forbes - - - Tim Murphy - - - Bob Corker - - - Michael E. Capuano - - - Bob Goodlatte - - - Leonard Lance - - - Ileana Ros-Lehtinen - - - Carol Shea-Porter - - - John J. Faso - - - Tom Marino - - - Sherrod Brown - - - John Barrasso - - - Susan M. Collins - - - John Cornyn - - - Marsha Blackburn - - - Jim Costa - - - Marcia L. Fudge - - - William R. Keating - - - David Loebsack - - - Blaine Luetkemeyer - - - Julia Brownley - - - Denny Heck - - - Mark DeSaulnier - - - John H. Rutherford - - - Ed Case - - - Rick Scott - - - Shelley Berkley - - - Brian P. Bilbray - - - Ann Marie Buerkle - - - Larry Kissell - - - Jean Schmidt - - - Jim DeMint - - - John F. Tierney - - - Kerry L. Bentivolio - - - John Fleming - - - Richard L. Hanna - - - Richard B. Nugent - - - Al Franken - - - Diane Black - - - Edward R. Royce - - - Colleen Hanabusa - - - Elijah E. Cummings - - - Roger F. Wicker - - - Rob Bishop - - - Vern Buchanan - - - Mike Crapo - - - Kenny Marchant - - - Jerry McNerney - - - Gwen Moore - - - Frank Pallone, Jr. - - - Kurt Schrader - - - Albio Sires - - - Mike Thompson - - - Tim Walberg - - - Deb Fischer - - - Rick W. Allen - - - John Kennedy - - - Jo Ann Emerson - - - Mark Udall - - - Timothy H. Bishop - - - Mike Johanns - - - Lynn A. Westmoreland - - - David G. Reichert - - - Chris Collins - - - Debbie Stabenow - - - Roy Blunt - - - John Boozman - - - Michael C. Burgess - - - Gerald E. Connolly - - - Sheila Jackson Lee - - - Patty Murray - - - Charles E. Schumer - - - Michael K. Simpson - - - Jackie Speier - - - Dina Titus - - - Joyce Beatty - - - Donald S. Beyer, Jr. - - - Ann Kirkpatrick - - - Sylvia R. Garcia - - - Carol D. Miller - - - Francisco "Quico" Canseco - - - Jerry F. Costello - - - William L. Owens - - - Nick J. Rahall II - - - William L. Enyart - - - John A. Boehner - - - Randy Neugebauer - - - Brad Ashford - - - Joe Barton - - - Jack Reed - - - Steve Cohen - - - Tom Cole - - - Steve King - - - Richard E. Neal - - - Paul Tonko - - - Peter J. Visclosky - - - Daniel Webster - - - Ron Wyden - - - Elizabeth Warren - - - Roger Williams - - - David Perdue - - - Kent Conrad - - - David Alan Curson - - - Tom Coburn - - - Rush Holt - - - Tom Latham - - - Gary G. Miller - - - Allyson Y. Schwartz - - - Ted Poe - - - Robert Pittenger - - - Tom Udall - - - Earl Blumenauer - - - K. Michael Conaway - - - Raúl M. Grijalva - - - Mike Kelly - - - John B. Larson - - - Bennie G. Thompson - - - Lois Frankel - - - Brian Babin - - - Al Lawson, Jr. - - - Kweisi Mfume - - - Olympia J. Snowe - - - W. Todd Akin - - - Joe Baca - - - Spencer Bachus - - - John Kline - - - John J. Duncan, Jr. - - - Gene Green - - - Stevan Pearce - - - Dana Rohrabacher - - - Lamar Smith - - - Thomas R. Carper - - - Jeanne Shaheen - - - Joe Manchin, III - - - Sanford D. Bishop, Jr. - - - G. K. Butterfield - - - Peter A. DeFazio - - - Eliot L. Engel - - - Al Green - - - Mazie K. Hirono - - - Zoe Lofgren - - - David B. McKinley - - - Jerrold Nadler - - - Bill Posey - - - Robert C. "Bobby" Scott - - - Peter Welch - - - Joe Wilson - - - John A. Yarmuth - - - Aumua Amata Coleman Radewagen - - - Jack Bergman - - - Mitt Romney - - - Jim Webb - - - Timothy V. Johnson - - - Dennis J. Kucinich - - - Daniel E. Lungren - - - Rodney Alexander - - - Tim Johnson - - - Paul C. Broun - - - Corrine Brown - - - Jeff Sessions - - - Rodney P. Frelinghuysen - - - Frank A. LoBiondo - - - Niki Tsongas - - - Richard Blumenthal - - - Lloyd Doggett - - - Marcy Kaptur - - - Barbara Lee - - - Carolyn B. Maloney - - - Edward J. Markey - - - C. A. Dutch Ruppersberger - - - Bobby L. Rush - - - Alma S. Adams - - - Tom O’Halleran - - - Charles A. Gonzalez - - - Wally Herger - - - Melvin L. Watt - - - Donna M. Christensen - - - George Miller - - - James P. Moran - - - Ron Barber - - - Robert A. Brady - - - John Garamendi - - - David P. Roe - - - David Scott - - - Bonnie Watson Coleman - - - James R. Baird - - - Elton Gallegly - - - Donald A. Manzullo - - - Silvestre Reyes - - - Carolyn McCarthy - - - Ander Crenshaw - - - Johnny Isakson - - - Richard J. Durbin - - - Michael B. Enzi - - - Emanuel Cleaver - - - Susan A. Davis - - - Peter T. King - - - Doris O. Matsui - - - Collin C. Peterson - - - Janice D. Schakowsky - - - Angus S. King, Jr. - - - Jeff Bingaman - - - Kay Bailey Hutchison - - - John F. Kerry - - - Saxby Chambliss - - - Eni F. H. Faleomavaega - - - Ed Pastor - - - Ed Whitfield - - - Daniel Coats - - - John L. Mica - - - Richard M. Nolan - - - Walter B. Jones - - - Benjamin L. Cardin - - - James E. Risch - - - Rosa L. DeLauro - - - Virginia Foxx - - - Kay Granger - - - F. James Sensenbrenner, Jr. - - - José E. Serrano - - - Paul Cook - - - Bob Filner - - - Joseph I. Lieberman - - - Gary L. Ackerman - - - Phil Gingrey - - - Jon Kyl - - - Bill Nelson - - - Mitch McConnell - - - Anna G. Eshoo - - - Frederica S. Wilson - - - Ben Nelson - - - Howard L. Berman - - - Sue Wilkins Myrick - - - Cliff Stearns - - - Robert L. Turner - - - Max Baucus - - - Doc Hastings - - - Gloria Negrete McLeod - - - Sam Farr - - - Michael M. Honda - - - Bernard Sanders - - - John R. Carter - - - Danny K. Davis - - - Lucille Roybal-Allard - - - Alan S. Lowenthal - - - Donna E. Shalala - - - Norman D. Dicks - - - Barney Frank - - - Thomas E. Petri - - - Barbara Boxer - - - Rubén Hinojosa - - - John Lewis - - - Lamar Alexander - - - James E. Clyburn - - - Patrick J. Leahy - - - Nancy Pelosi - - - David E. Price - - - Tom Harkin - - - Henry A. Waxman - - - Frank R. Wolf - - - Harry Reid - - - Joseph R. Pitts - - - Steny H. Hoyer - - - Dan Burton - - - Maurice D. Hinchey - - - Howard P. "Buck" McKeon - - - Lois Capps - - - Maxine Waters - - - Judy Biggert - - - Lynn C. Woolsey - - - John D. Rockefeller, IV - - - Thad Cochran - - - Nita M. Lowey - - - Eleanor Holmes Norton - - - Bill Pascrell, Jr. - - - Harold Rogers - - - John W. Olver - - - Barbara A. Mikulski - - - Jim McDermott - - - John McCain - - - Pat Roberts - - - Alcee L. Hastings - - - Grace F. Napolitano - - - Herb Kohl - - - Ron Paul - - - Eddie Bernice Johnson - - - Leonard L. Boswell - - - Jerry Lewis - - - Edolphus Towns - - - Carl Levin - - - Orrin G. Hatch - - - James M. Inhofe - - - Richard C. Shelby - - - Madeleine Z. Bordallo - - - Dianne Feinstein - - - Chuck Grassley - - - Don Young - - - Richard G. Lugar - - - Fortney Pete Stark - - - Howard Coble - - - Sander M. Levin - - - C. W. Bill Young - - - Charles B. Rangel - - - Sam Johnson - - - Dale E. Kildee - - - John Conyers, Jr. - - - Louise McIntosh Slaughter - - - Roscoe G. Bartlett - - - John D. Dingell - - - Daniel K. Inouye - - - Daniel K. Akaka - - - Frank R. Lautenberg - - - Ralph M. Hall - + Alexandria Ocasio-Cortez + Abby Finkenauer + Katie Hill + Josh Harder + Lauren Underwood + Max Rose + Elise M. Stefanik + Mike Gallagher + Conor Lamb + Joe Neguse + Xochitl Torres Small + Anthony Gonzalez + William R. Timmons IV + Dan Crenshaw + Patrick Murphy + Trey Hollingsworth + Haley M. Stevens + Guy Reschenthaler + Colin Z. Allred + Matt Gaetz + Andy Kim + Joe Cunningham + Lance Gooden + Jared F. Golden + Aaron Schock + Tulsi Gabbard + Michael F. Q. San Nicolas + Ilhan Omar + Bryan Steil + Carlos Curbelo + Ruben J. Kihuen + Justin Amash + Eric Swalwell + Joseph P. Kennedy III + Jason Smith + Lee M. Zeldin + Brian J. Mast + Sharice Davids + Chris Pappas + Scott Taylor + Ruben Gallego + Pete Aguilar + Jim Banks + Jason Crow + Abigail Davis Spanberger + Josh Hawley + Ron DeSantis + Jaime Herrera Beutler + Adam Kinzinger + Seth Moulton + Stephanie N. Murphy + Darren Soto + Mike Levin + W. Gregory Steube + Anthony Brindisi + David G. Valadao + Tom Cotton + Markwayne Mullin + Brendan F. Boyle + Will Hurd + Antonio Delgado + Benjamin Quayle + Trey Radel + Marlin A. Stutzman + Kevin Yoder + Ryan A. Costello + Duncan Hunter + Martha Roby + Kyrsten Sinema + Ro Khanna + Nanette Diaz Barragán + Jenniffer González-Colón + Steve Watkins + Elissa Slotkin + Rashida Tlaib + Kelly Armstrong + Kendra S. Horn + Dusty Johnson + Mike Garcia + Jim Bridenstine + Jared Polis + Mia B. Love + Patrick T. McHenry + Grace Meng + Josh Gottheimer + Michael Cloud + Lizzie Fletcher + Elaine G. Luria + Vance M. McAllister + André Carson + Cory Gardner + Joaquin Castro + Derek Kilmer + Jimmy Gomez + Katie Porter + Michael Waltz + Ayanna Pressley + Ben McAdams + Dan Boren + Jon Runyan + Stephen Lee Fincher + Christopher Murphy + Devin Nunes + Cedric L. Richmond + Tim Ryan + Andy Barr + Raja Krishnamoorthi + Brian K. Fitzpatrick + Steven Horsford + Jahana Hayes + Russ Fulcher + Lori Trahan + David W. Jolly + Beto O’Rourke + Thomas A. Garrett, Jr. + Ben Ray Luján + Todd Young + Brian Schatz + Raul Ruiz + Garret Graves + David Rouzer + Ben Sasse + James Comer + Mike Johnson + Jodey C. Arrington + Angie Craig + Mikie Sherrill + Van Taylor + Chip Roy + Ben Cline + Heath Shuler + Kristi L. Noem + Sean P. Duffy + Martin Heinrich + Mike Lee + Tom Reed + Marco Rubio + Thomas Massie + Richard Hudson + Marc A. Veasey + Alexander X. Mooney + Ted Budd + Gilbert Ray Cisneros, Jr. + Debbie Mucarsel-Powell + Sean Casten + Jeffrey M. Landry + Michael G. Grimm + Frank C. Guinta + Todd Rokita + Thomas J. Rooney + Paul D. Ryan + Tom Graves + Steven M. Palazzo + Adrian Smith + Rob Woodall + Rodney Davis + Hakeem S. Jeffries + Ted Cruz + Joni Ernst + Warren Davidson + Greg Stanton + Michael Guest + Denver Riggleman + Kelly Loeffler + William M. Cowan + Robert Hurt + Robert J. Dold + Luke Messer + Bill Huizenga + Cathy McMorris Rodgers + Austin Scott + Linda T. Sánchez + Cory A. Booker + Ted Lieu + Mark Walker + Jimmy Panetta + Dean Phillips + Veronica Escobar + Jason Altmire + Tim Griffin + Daniel B. Maffei + Kelly Ayotte + Tim Huelskamp + David Young + James Lankford + Tammy Duckworth + George Holding + Darin LaHood + Jennifer Wexton + Kim Schrier + Connie Mack + Mark Takai + Mick Mulvaney + Jason Chaffetz + Jeff Denham + Raúl R. Labrador + Mike Bishop + Bruce Westerman + Vicente Gonzalez + Chrissy Houlahan + Randy Hultgren + Stephen Knight + Kirsten E. Gillibrand + Kathy Castor + Eric A. "Rick" Crawford + Theodore E. Deutch + Jeff Duncan + James A. Himes + Daniel Lipinski + Debbie Wasserman Schultz + Doug Collins + Sean Patrick Maloney + Stacey E. Plaskett + Trent Kelly + A. Drew Ferguson IV + David Kustoff + Liz Cheney + Ross Spano + Pete Stauber + Susie Lee + Martha McSally + Chris Jacobs + Jesse L. Jackson Jr. + David Rivera + John Sullivan + Jeff Chiesa + Steve Southerland II + Erik Paulsen + John Ratcliffe + Robert B. Aderholt + Rick Larsen + Kevin McCarthy + Steve Scalise + Tim Scott + Terri A. Sewell + Adam Smith + Steve Stivers + Ami Bera + Norma J. Torres + Kathleen M. Rice + Pramila Jayapal + Cynthia Axne + Tom Malinowski + John W. Rose + Fred Keller + Robert T. Schilling + Renee L. Ellmers + Christopher P. Gibson + Trey Gowdy + Timothy J. Walz + Dave Brat + Michael F. Bennet + Yvette D. Clarke + Scott DesJarlais + Brett Guthrie + Jim Jordan + James R. Langevin + Jared Huffman + Mark Pocan + Dan Sullivan + Kamala D. Harris + Catherine Cortez Masto + Salud O. Carbajal + Lloyd Smucker + Daniel Meuser + Tim Burchett + Mark E. Green + Dan Bishop + Betty Sutton + Eric Cantor + Mark L. Pryor + Mike Rogers + Joe Garcia + Michael G. Fitzpatrick + Gwen Graham + Mike Pompeo + Keith Ellison + Lynn Jenkins + John K. Delaney + Steve Russell + Christopher A. Coons + Gus M. Bilirakis + Sam Graves + Ron Kind + Rand Paul + Tony Cárdenas + Jackie Walorski + Filemon Vela + Katherine M. Clark + Barry Loudermilk + Don Bacon + TJ Cox + Gregory F. Murphy + Mark S. Critz + Todd Russell Platts + Laura Richardson + Mark Begich + Lee Terry + Patrick J. Tiberi + Joseph Crowley + Jeff Flake + Keith J. Rothfus + Mimi Walters + Karen C. Handel + Tammy Baldwin + Larry Bucshon + Charles J. "Chuck" Fleischmann + Michael T. McCaul + Pete Olson + John P. Sarbanes + David Schweikert + Suzan K. DelBene + Ann Wagner + Steve Daines + Scott Perry + John Katko + Lisa Blunt Rochester + Jamie Raskin + Thomas R. Suozzi + Troy Balderson + Jim Hagedorn + Mary Bono Mack + Mike Ross + Joe Walsh + Allen B. West + Pete P. Gallego + David Vitter + Joseph J. Heck + Ryan K. Zinke + Blake Farenthold + Peter J. Roskam + Bill Shuster + Claudia Tenney + David N. Cicilline + Mario Diaz-Balart + John Thune + Patrick J. Toomey + Juan Vargas + Cheri Bustos + Kevin Cramer + Matt Cartwright + John R. Moolenaar + Tom Emmer + Bradley Scott Schneider + Clay Higgins + Anthony G. Brown + Paul Mitchell + A. Donald McEachin + Greg Gianforte + Kevin Hern + Harley Rouda + Jim Matheson + John E. Walsh + E. Scott Rigell + Loretta Sanchez + Charles W. Dent + Evan H. Jenkins + Dean Heller + Mark Sanford + David A. Trott + Thomas MacArthur + Robert P. Casey, Jr. + Amy Klobuchar + Jeff Fortenberry + Vicky Hartzler + Frank D. Lucas + Adam B. Schiff + Michael R. Turner + Doug LaMalfa + Mark Takano + Susan W. Brooks + Chris Stewart + Jody B. Hice + Mike Bost + Thom Tillis + Roger W. Marshall + John R. Curtis + Lucy McBath + Andy Levin + Debra A. Haaland + Scott P. Brown + Rick Berg + Ben Chandler + Chip Cravaack + Nan A. S. Hayworth + Mike Pence + Jo Bonner + Mark Kirk + Scott Garrett + Jeff Miller + Pedro R. Pierluisi + Curt Clawson + Michelle Lujan Grisham + Dennis A. Ross + Elizabeth H. Esty + Barbara Comstock + Brenda Jones + Mark Meadows + Brian Higgins + James P. McGovern + Glenn Thompson + Chris Van Hollen + Robert J. Wittman + Ken Buck + Cindy Hyde-Smith + Mary Gay Scanlon + Madeleine Dean + Enid Greene Waldholtz + Steve Austria + Russ Carnahan + Kathleen C. Hochul + Alan Nunnelee + Donna F. Edwards + Steve Israel + Matt Salmon + Alan Grayson + Xavier Becerra + James B. Renacci + Maria Cantwell + Paul A. Gosar + H. Morgan Griffith + Gary C. Peters + Mike Quigley + Mike Rogers + John Shimkus + Mac Thornberry + Mark E. Amodei + Donald M. Payne, Jr. + Scott H. Peters + Daniel T. Kildee + Brad R. Wenstrup + Tim Kaine + Donald Norcross + Margaret Wood Hassan + Andy Biggs + J. Luis Correa + Tina Smith + Debbie Lesko + Hansen Clarke + Tim Holden + Robert E. Andrews + Bruce L. Braley + Cresent Hardy + Trent Franks + Jeb Hensarling + Bill Cassidy + Diana DeGette + Andy Harris + John Hoeven + Lisa Murkowski + Greg Walden + Steve Womack + David P. Joyce + Tom Rice + Earl L. "Buddy" Carter + Val Butler Demings + Jacky Rosen + Joseph D. Morelle + Susan Wild + John Joyce + Thomas P. Tiffany + Sandy Adams + Michele Bachmann + Mike McIntyre + Steve Stockman + Chaka Fattah + Charles W. Boustany Jr. + John C. Carney Jr. + Reid J. Ribble + Lou Barletta + John Abney Culberson + Gregg Harper + Daniel M. Donovan, Jr. + Jon Tester + Jeff Merkley + Wm. Lacy Clay + Robert E. Latta + Tom McClintock + Scott R. Tipton + Ann M. Kuster + Robin L. Kelly + J. French Hill + Charlie Crist + Ron Estes + Jesús G. "Chuy" García + Greg Pence + Denny Rehberg + Mary L. Landrieu + John Barrow + John Campbell + Jim Gerlach + Jack Kingston + Michael H. Michaud + Patrick Meehan + Mike Coffman + Joe Donnelly + Pete Sessions + Heidi Heitkamp + Rod Blum + Jason Lewis + Sheldon Whitehouse + Lindsey Graham + Kevin Brady + Richard Burr + Henry Cuellar + Ron Johnson + Billy Long + Stephen F. Lynch + Chellie Pingree + Rob Portman + Gregorio Kilili Camacho Sablan + Bill Foster + Ted S. Yoho + Bradley Byrne + Dan Newhouse + Glenn Grothman + David J. Trone + Steven C. LaTourette + Candice S. Miller + Cynthia M. Lummis + Tom Price + Robert Menendez + Mark R. Warner + Mo Brooks + Jim Cooper + Bill Flores + Bob Gibbs + Bill Johnson + Henry C. "Hank" Johnson, Jr. + Doug Lamborn + Betty McCollum + Jerry Moran + Brad Sherman + Suzanne Bonamici + Gary J. Palmer + Ralph Lee Abraham + Brenda L. Lawrence + Mike Rounds + Dwight Evans + Adriano Espaillat + Doug Jones + Mike Braun + Brad Miller + Kay R. Hagan + Dave Camp + Luther Strange + Claire McCaskill + Luis V. Gutiérrez + Darrell E. Issa + Bruce Poliquin + Karen Bass + Ken Calvert + Shelley Moore Capito + Steve Chabot + Judy Chu + Joe Courtney + Michael F. Doyle + Louie Gohmert + Gregory W. Meeks + Ed Perlmutter + Christopher H. Smith + Fred Upton + Nydia M. Velázquez + Randy K. Weber, Sr. + Debbie Dingell + Neal P. Dunn + Francis Rooney + Ralph Norman + Jefferson Van Drew + Ron Wright + Charles F. Bass + David Dreier + Steven R. Rothman + Janice Hahn + Dan Benishek + J. Randy Forbes + Tim Murphy + Bob Corker + Michael E. Capuano + Bob Goodlatte + Leonard Lance + Ileana Ros-Lehtinen + Carol Shea-Porter + John J. Faso + Tom Marino + Sherrod Brown + John Barrasso + Susan M. Collins + John Cornyn + Marsha Blackburn + Jim Costa + Marcia L. Fudge + William R. Keating + David Loebsack + Blaine Luetkemeyer + Julia Brownley + Denny Heck + Mark DeSaulnier + John H. Rutherford + Ed Case + Rick Scott + Shelley Berkley + Brian P. Bilbray + Ann Marie Buerkle + Larry Kissell + Jean Schmidt + Jim DeMint + John F. Tierney + Kerry L. Bentivolio + John Fleming + Richard L. Hanna + Richard B. Nugent + Al Franken + Diane Black + Edward R. Royce + Colleen Hanabusa + Elijah E. Cummings + Roger F. Wicker + Rob Bishop + Vern Buchanan + Mike Crapo + Kenny Marchant + Jerry McNerney + Gwen Moore + Frank Pallone, Jr. + Kurt Schrader + Albio Sires + Mike Thompson + Tim Walberg + Deb Fischer + Rick W. Allen + John Kennedy + Jo Ann Emerson + Mark Udall + Timothy H. Bishop + Mike Johanns + Lynn A. Westmoreland + David G. Reichert + Chris Collins + Debbie Stabenow + Roy Blunt + John Boozman + Michael C. Burgess + Gerald E. Connolly + Sheila Jackson Lee + Patty Murray + Charles E. Schumer + Michael K. Simpson + Jackie Speier + Dina Titus + Joyce Beatty + Donald S. Beyer, Jr. + Ann Kirkpatrick + Sylvia R. Garcia + Carol D. Miller + Francisco "Quico" Canseco + Jerry F. Costello + William L. Owens + Nick J. Rahall II + William L. Enyart + John A. Boehner + Randy Neugebauer + Brad Ashford + Joe Barton + Jack Reed + Steve Cohen + Tom Cole + Steve King + Richard E. Neal + Paul Tonko + Peter J. Visclosky + Daniel Webster + Ron Wyden + Elizabeth Warren + Roger Williams + David Perdue + Kent Conrad + David Alan Curson + Tom Coburn + Rush Holt + Tom Latham + Gary G. Miller + Allyson Y. Schwartz + Ted Poe + Robert Pittenger + Tom Udall + Earl Blumenauer + K. Michael Conaway + Raúl M. Grijalva + Mike Kelly + John B. Larson + Bennie G. Thompson + Lois Frankel + Brian Babin + Al Lawson, Jr. + Kweisi Mfume + Olympia J. Snowe + W. Todd Akin + Joe Baca + Spencer Bachus + John Kline + John J. Duncan, Jr. + Gene Green + Stevan Pearce + Dana Rohrabacher + Lamar Smith + Thomas R. Carper + Jeanne Shaheen + Joe Manchin, III + Sanford D. Bishop, Jr. + G. K. Butterfield + Peter A. DeFazio + Eliot L. Engel + Al Green + Mazie K. Hirono + Zoe Lofgren + David B. McKinley + Jerrold Nadler + Bill Posey + Robert C. "Bobby" Scott + Peter Welch + Joe Wilson + John A. Yarmuth + Aumua Amata Coleman Radewagen + Jack Bergman + Mitt Romney + Jim Webb + Timothy V. Johnson + Dennis J. Kucinich + Daniel E. Lungren + Rodney Alexander + Tim Johnson + Paul C. Broun + Corrine Brown + Jeff Sessions + Rodney P. Frelinghuysen + Frank A. LoBiondo + Niki Tsongas + Richard Blumenthal + Lloyd Doggett + Marcy Kaptur + Barbara Lee + Carolyn B. Maloney + Edward J. Markey + C. A. Dutch Ruppersberger + Bobby L. Rush + Alma S. Adams + Tom O’Halleran + Charles A. Gonzalez + Wally Herger + Melvin L. Watt + Donna M. Christensen + George Miller + James P. Moran + Ron Barber + Robert A. Brady + John Garamendi + David P. Roe + David Scott + Bonnie Watson Coleman + James R. Baird + Elton Gallegly + Donald A. Manzullo + Silvestre Reyes + Carolyn McCarthy + Ander Crenshaw + Johnny Isakson + Richard J. Durbin + Michael B. Enzi + Emanuel Cleaver + Susan A. Davis + Peter T. King + Doris O. Matsui + Collin C. Peterson + Janice D. Schakowsky + Angus S. King, Jr. + Jeff Bingaman + Kay Bailey Hutchison + John F. Kerry + Saxby Chambliss + Eni F. H. Faleomavaega + Ed Pastor + Ed Whitfield + Daniel Coats + John L. Mica + Richard M. Nolan + Walter B. Jones + Benjamin L. Cardin + James E. Risch + Rosa L. DeLauro + Virginia Foxx + Kay Granger + F. James Sensenbrenner, Jr. + José E. Serrano + Paul Cook + Bob Filner + Joseph I. Lieberman + Gary L. Ackerman + Phil Gingrey + Jon Kyl + Bill Nelson + Mitch McConnell + Anna G. Eshoo + Frederica S. Wilson + Ben Nelson + Howard L. Berman + Sue Wilkins Myrick + Cliff Stearns + Robert L. Turner + Max Baucus + Doc Hastings + Gloria Negrete McLeod + Sam Farr + Michael M. Honda + Bernard Sanders + John R. Carter + Danny K. Davis + Lucille Roybal-Allard + Alan S. Lowenthal + Donna E. Shalala + Norman D. Dicks + Barney Frank + Thomas E. Petri + Barbara Boxer + Rubén Hinojosa + John Lewis + Lamar Alexander + James E. Clyburn + Patrick J. Leahy + Nancy Pelosi + David E. Price + Tom Harkin + Henry A. Waxman + Frank R. Wolf + Harry Reid + Joseph R. Pitts + Steny H. Hoyer + Dan Burton + Maurice D. Hinchey + Howard P. "Buck" McKeon + Lois Capps + Maxine Waters + Judy Biggert + Lynn C. Woolsey + John D. Rockefeller, IV + Thad Cochran + Nita M. Lowey + Eleanor Holmes Norton + Bill Pascrell, Jr. + Harold Rogers + John W. Olver + Barbara A. Mikulski + Jim McDermott + John McCain + Pat Roberts + Alcee L. Hastings + Grace F. Napolitano + Herb Kohl + Ron Paul + Eddie Bernice Johnson + Leonard L. Boswell + Jerry Lewis + Edolphus Towns + Carl Levin + Orrin G. Hatch + James M. Inhofe + Richard C. Shelby + Madeleine Z. Bordallo + Dianne Feinstein + Chuck Grassley + Don Young + Richard G. Lugar + Fortney Pete Stark + Howard Coble + Sander M. Levin + C. W. Bill Young + Charles B. Rangel + Sam Johnson + Dale E. Kildee + John Conyers, Jr. + Louise McIntosh Slaughter + Roscoe G. Bartlett + John D. Dingell + Daniel K. Inouye + Daniel K. Akaka + Frank R. Lautenberg + Ralph M. Hall diff --git a/test/output/usCongressAgeSymbolExplicit.svg b/test/output/usCongressAgeSymbolExplicit.svg index ad4a01e9d5..5be29343a0 100644 --- a/test/output/usCongressAgeSymbolExplicit.svg +++ b/test/output/usCongressAgeSymbolExplicit.svg @@ -13,2724 +13,947 @@ white-space: pre; } - - - - 0 - - - - 5 - - - - 10 - - - - 15 - - - - 20 - - - - 25 - - - - 30 - ↑ Frequency + + + + + + + + + + + + + + + + + + + + 0 + 5 + 10 + 15 + 20 + 25 + 30 + + + ↑ Frequency + + + + + + + + + + + + + 30 + 40 + 50 + 60 + 70 + 80 + 90 + 100 - - - 30 - - - 40 - - - 50 - - - 60 - - - 70 - - - 80 - - - 90 - - - 100 - Age → + + Age → - - Alexandria Ocasio-Cortez - - - Abby Finkenauer - - - Katie Hill - - - Josh Harder - - - Lauren Underwood - - - Max Rose - - - Elise M. Stefanik - - - Mike Gallagher - - - Conor Lamb - - - Joe Neguse - - - Xochitl Torres Small - - - Anthony Gonzalez - - - William R. Timmons IV - - - Dan Crenshaw - - - Patrick Murphy - - - Trey Hollingsworth - - - Haley M. Stevens - - - Guy Reschenthaler - - - Colin Z. Allred - - - Matt Gaetz - - - Andy Kim - - - Joe Cunningham - - - Lance Gooden - - - Jared F. Golden - - - Aaron Schock - - - Tulsi Gabbard - - - Michael F. Q. San Nicolas - - - Ilhan Omar - - - Bryan Steil - - - Carlos Curbelo - - - Ruben J. Kihuen - - - Justin Amash - - - Eric Swalwell - - - Joseph P. Kennedy III - - - Jason Smith - - - Lee M. Zeldin - - - Brian J. Mast - - - Sharice Davids - - - Chris Pappas - - - Scott Taylor - - - Ruben Gallego - - - Pete Aguilar - - - Jim Banks - - - Jason Crow - - - Abigail Davis Spanberger - - - Josh Hawley - - - Ron DeSantis - - - Jaime Herrera Beutler - - - Adam Kinzinger - - - Seth Moulton - - - Stephanie N. Murphy - - - Darren Soto - - - Mike Levin - - - W. Gregory Steube - - - Anthony Brindisi - - - David G. Valadao - - - Tom Cotton - - - Markwayne Mullin - - - Brendan F. Boyle - - - Will Hurd - - - Antonio Delgado - - - Benjamin Quayle - - - Trey Radel - - - Marlin A. Stutzman - - - Kevin Yoder - - - Ryan A. Costello - - - Duncan Hunter - - - Martha Roby - - - Kyrsten Sinema - - - Ro Khanna - - - Nanette Diaz Barragán - - - Jenniffer González-Colón - - - Steve Watkins - - - Elissa Slotkin - - - Rashida Tlaib - - - Kelly Armstrong - - - Kendra S. Horn - - - Dusty Johnson - - - Mike Garcia - - - Jim Bridenstine - - - Jared Polis - - - Mia B. Love - - - Patrick T. McHenry - - - Grace Meng - - - Josh Gottheimer - - - Michael Cloud - - - Lizzie Fletcher - - - Elaine G. Luria - - - Vance M. McAllister - - - André Carson - - - Cory Gardner - - - Joaquin Castro - - - Derek Kilmer - - - Jimmy Gomez - - - Katie Porter - - - Michael Waltz - - - Ayanna Pressley - - - Ben McAdams - - - Dan Boren - - - Jon Runyan - - - Stephen Lee Fincher - - - Christopher Murphy - - - Devin Nunes - - - Cedric L. Richmond - - - Tim Ryan - - - Andy Barr - - - Raja Krishnamoorthi - - - Brian K. Fitzpatrick - - - Steven Horsford - - - Jahana Hayes - - - Russ Fulcher - - - Lori Trahan - - - David W. Jolly - - - Beto O’Rourke - - - Thomas A. Garrett, Jr. - - - Ben Ray Luján - - - Todd Young - - - Brian Schatz - - - Raul Ruiz - - - Garret Graves - - - David Rouzer - - - Ben Sasse - - - James Comer - - - Mike Johnson - - - Jodey C. Arrington - - - Angie Craig - - - Mikie Sherrill - - - Van Taylor - - - Chip Roy - - - Ben Cline - - - Heath Shuler - - - Kristi L. Noem - - - Sean P. Duffy - - - Martin Heinrich - - - Mike Lee - - - Tom Reed - - - Marco Rubio - - - Thomas Massie - - - Richard Hudson - - - Marc A. Veasey - - - Alexander X. Mooney - - - Ted Budd - - - Gilbert Ray Cisneros, Jr. - - - Debbie Mucarsel-Powell - - - Sean Casten - - - Jeffrey M. Landry - - - Michael G. Grimm - - - Frank C. Guinta - - - Todd Rokita - - - Thomas J. Rooney - - - Paul D. Ryan - - - Tom Graves - - - Steven M. Palazzo - - - Adrian Smith - - - Rob Woodall - - - Rodney Davis - - - Hakeem S. Jeffries - - - Ted Cruz - - - Joni Ernst - - - Warren Davidson - - - Greg Stanton - - - Michael Guest - - - Denver Riggleman - - - Kelly Loeffler - - - William M. Cowan - - - Robert Hurt - - - Robert J. Dold - - - Luke Messer - - - Bill Huizenga - - - Cathy McMorris Rodgers - - - Austin Scott - - - Linda T. Sánchez - - - Cory A. Booker - - - Ted Lieu - - - Mark Walker - - - Jimmy Panetta - - - Dean Phillips - - - Veronica Escobar - - - Jason Altmire - - - Tim Griffin - - - Daniel B. Maffei - - - Kelly Ayotte - - - Tim Huelskamp - - - David Young - - - James Lankford - - - Tammy Duckworth - - - George Holding - - - Darin LaHood - - - Jennifer Wexton - - - Kim Schrier - - - Connie Mack - - - Mark Takai - - - Mick Mulvaney - - - Jason Chaffetz - - - Jeff Denham - - - Raúl R. Labrador - - - Mike Bishop - - - Bruce Westerman - - - Vicente Gonzalez - - - Chrissy Houlahan - - - Randy Hultgren - - - Stephen Knight - - - Kirsten E. Gillibrand - - - Kathy Castor - - - Eric A. "Rick" Crawford - - - Theodore E. Deutch - - - Jeff Duncan - - - James A. Himes - - - Daniel Lipinski - - - Debbie Wasserman Schultz - - - Doug Collins - - - Sean Patrick Maloney - - - Stacey E. Plaskett - - - Trent Kelly - - - A. Drew Ferguson IV - - - David Kustoff - - - Liz Cheney - - - Ross Spano - - - Pete Stauber - - - Susie Lee - - - Martha McSally - - - Chris Jacobs - - - Jesse L. Jackson Jr. - - - David Rivera - - - John Sullivan - - - Jeff Chiesa - - - Steve Southerland II - - - Erik Paulsen - - - John Ratcliffe - - - Robert B. Aderholt - - - Rick Larsen - - - Kevin McCarthy - - - Steve Scalise - - - Tim Scott - - - Terri A. Sewell - - - Adam Smith - - - Steve Stivers - - - Ami Bera - - - Norma J. Torres - - - Kathleen M. Rice - - - Pramila Jayapal - - - Cynthia Axne - - - Tom Malinowski - - - John W. Rose - - - Fred Keller - - - Robert T. Schilling - - - Renee L. Ellmers - - - Christopher P. Gibson - - - Trey Gowdy - - - Timothy J. Walz - - - Dave Brat - - - Michael F. Bennet - - - Yvette D. Clarke - - - Scott DesJarlais - - - Brett Guthrie - - - Jim Jordan - - - James R. Langevin - - - Jared Huffman - - - Mark Pocan - - - Dan Sullivan - - - Kamala D. Harris - - - Catherine Cortez Masto - - - Salud O. Carbajal - - - Lloyd Smucker - - - Daniel Meuser - - - Tim Burchett - - - Mark E. Green - - - Dan Bishop - - - Betty Sutton - - - Eric Cantor - - - Mark L. Pryor - - - Mike Rogers - - - Joe Garcia - - - Michael G. Fitzpatrick - - - Gwen Graham - - - Mike Pompeo - - - Keith Ellison - - - Lynn Jenkins - - - John K. Delaney - - - Steve Russell - - - Christopher A. Coons - - - Gus M. Bilirakis - - - Sam Graves - - - Ron Kind - - - Rand Paul - - - Tony Cárdenas - - - Jackie Walorski - - - Filemon Vela - - - Katherine M. Clark - - - Barry Loudermilk - - - Don Bacon - - - TJ Cox - - - Gregory F. Murphy - - - Mark S. Critz - - - Todd Russell Platts - - - Laura Richardson - - - Mark Begich - - - Lee Terry - - - Patrick J. Tiberi - - - Joseph Crowley - - - Jeff Flake - - - Keith J. Rothfus - - - Mimi Walters - - - Karen C. Handel - - - Tammy Baldwin - - - Larry Bucshon - - - Charles J. "Chuck" Fleischmann - - - Michael T. McCaul - - - Pete Olson - - - John P. Sarbanes - - - David Schweikert - - - Suzan K. DelBene - - - Ann Wagner - - - Steve Daines - - - Scott Perry - - - John Katko - - - Lisa Blunt Rochester - - - Jamie Raskin - - - Thomas R. Suozzi - - - Troy Balderson - - - Jim Hagedorn - - - Mary Bono Mack - - - Mike Ross - - - Joe Walsh - - - Allen B. West - - - Pete P. Gallego - - - David Vitter - - - Joseph J. Heck - - - Ryan K. Zinke - - - Blake Farenthold - - - Peter J. Roskam - - - Bill Shuster - - - Claudia Tenney - - - David N. Cicilline - - - Mario Diaz-Balart - - - John Thune - - - Patrick J. Toomey - - - Juan Vargas - - - Cheri Bustos - - - Kevin Cramer - - - Matt Cartwright - - - John R. Moolenaar - - - Tom Emmer - - - Bradley Scott Schneider - - - Clay Higgins - - - Anthony G. Brown - - - Paul Mitchell - - - A. Donald McEachin - - - Greg Gianforte - - - Kevin Hern - - - Harley Rouda - - - Jim Matheson - - - John E. Walsh - - - E. Scott Rigell - - - Loretta Sanchez - - - Charles W. Dent - - - Evan H. Jenkins - - - Dean Heller - - - Mark Sanford - - - David A. Trott - - - Thomas MacArthur - - - Robert P. Casey, Jr. - - - Amy Klobuchar - - - Jeff Fortenberry - - - Vicky Hartzler - - - Frank D. Lucas - - - Adam B. Schiff - - - Michael R. Turner - - - Doug LaMalfa - - - Mark Takano - - - Susan W. Brooks - - - Chris Stewart - - - Jody B. Hice - - - Mike Bost - - - Thom Tillis - - - Roger W. Marshall - - - John R. Curtis - - - Lucy McBath - - - Andy Levin - - - Debra A. Haaland - - - Scott P. Brown - - - Rick Berg - - - Ben Chandler - - - Chip Cravaack - - - Nan A. S. Hayworth - - - Mike Pence - - - Jo Bonner - - - Mark Kirk - - - Scott Garrett - - - Jeff Miller - - - Pedro R. Pierluisi - - - Curt Clawson - - - Michelle Lujan Grisham - - - Dennis A. Ross - - - Elizabeth H. Esty - - - Barbara Comstock - - - Brenda Jones - - - Mark Meadows - - - Brian Higgins - - - James P. McGovern - - - Glenn Thompson - - - Chris Van Hollen - - - Robert J. Wittman - - - Ken Buck - - - Cindy Hyde-Smith - - - Mary Gay Scanlon - - - Madeleine Dean - - - Enid Greene Waldholtz - - - Steve Austria - - - Russ Carnahan - - - Kathleen C. Hochul - - - Alan Nunnelee - - - Donna F. Edwards - - - Steve Israel - - - Matt Salmon - - - Alan Grayson - - - Xavier Becerra - - - James B. Renacci - - - Maria Cantwell - - - Paul A. Gosar - - - H. Morgan Griffith - - - Gary C. Peters - - - Mike Quigley - - - Mike Rogers - - - John Shimkus - - - Mac Thornberry - - - Mark E. Amodei - - - Donald M. Payne, Jr. - - - Scott H. Peters - - - Daniel T. Kildee - - - Brad R. Wenstrup - - - Tim Kaine - - - Donald Norcross - - - Margaret Wood Hassan - - - Andy Biggs - - - J. Luis Correa - - - Tina Smith - - - Debbie Lesko - - - Hansen Clarke - - - Tim Holden - - - Robert E. Andrews - - - Bruce L. Braley - - - Cresent Hardy - - - Trent Franks - - - Jeb Hensarling - - - Bill Cassidy - - - Diana DeGette - - - Andy Harris - - - John Hoeven - - - Lisa Murkowski - - - Greg Walden - - - Steve Womack - - - David P. Joyce - - - Tom Rice - - - Earl L. "Buddy" Carter - - - Val Butler Demings - - - Jacky Rosen - - - Joseph D. Morelle - - - Susan Wild - - - John Joyce - - - Thomas P. Tiffany - - - Sandy Adams - - - Michele Bachmann - - - Mike McIntyre - - - Steve Stockman - - - Chaka Fattah - - - Charles W. Boustany Jr. - - - John C. Carney Jr. - - - Reid J. Ribble - - - Lou Barletta - - - John Abney Culberson - - - Gregg Harper - - - Daniel M. Donovan, Jr. - - - Jon Tester - - - Jeff Merkley - - - Wm. Lacy Clay - - - Robert E. Latta - - - Tom McClintock - - - Scott R. Tipton - - - Ann M. Kuster - - - Robin L. Kelly - - - J. French Hill - - - Charlie Crist - - - Ron Estes - - - Jesús G. "Chuy" García - - - Greg Pence - - - Denny Rehberg - - - Mary L. Landrieu - - - John Barrow - - - John Campbell - - - Jim Gerlach - - - Jack Kingston - - - Michael H. Michaud - - - Patrick Meehan - - - Mike Coffman - - - Joe Donnelly - - - Pete Sessions - - - Heidi Heitkamp - - - Rod Blum - - - Jason Lewis - - - Sheldon Whitehouse - - - Lindsey Graham - - - Kevin Brady - - - Richard Burr - - - Henry Cuellar - - - Ron Johnson - - - Billy Long - - - Stephen F. Lynch - - - Chellie Pingree - - - Rob Portman - - - Gregorio Kilili Camacho Sablan - - - Bill Foster - - - Ted S. Yoho - - - Bradley Byrne - - - Dan Newhouse - - - Glenn Grothman - - - David J. Trone - - - Steven C. LaTourette - - - Candice S. Miller - - - Cynthia M. Lummis - - - Tom Price - - - Robert Menendez - - - Mark R. Warner - - - Mo Brooks - - - Jim Cooper - - - Bill Flores - - - Bob Gibbs - - - Bill Johnson - - - Henry C. "Hank" Johnson, Jr. - - - Doug Lamborn - - - Betty McCollum - - - Jerry Moran - - - Brad Sherman - - - Suzanne Bonamici - - - Gary J. Palmer - - - Ralph Lee Abraham - - - Brenda L. Lawrence - - - Mike Rounds - - - Dwight Evans - - - Adriano Espaillat - - - Doug Jones - - - Mike Braun - - - Brad Miller - - - Kay R. Hagan - - - Dave Camp - - - Luther Strange - - - Claire McCaskill - - - Luis V. Gutiérrez - - - Darrell E. Issa - - - Bruce Poliquin - - - Karen Bass - - - Ken Calvert - - - Shelley Moore Capito - - - Steve Chabot - - - Judy Chu - - - Joe Courtney - - - Michael F. Doyle - - - Louie Gohmert - - - Gregory W. Meeks - - - Ed Perlmutter - - - Christopher H. Smith - - - Fred Upton - - - Nydia M. Velázquez - - - Randy K. Weber, Sr. - - - Debbie Dingell - - - Neal P. Dunn - - - Francis Rooney - - - Ralph Norman - - - Jefferson Van Drew - - - Ron Wright - - - Charles F. Bass - - - David Dreier - - - Steven R. Rothman - - - Janice Hahn - - - Dan Benishek - - - J. Randy Forbes - - - Tim Murphy - - - Bob Corker - - - Michael E. Capuano - - - Bob Goodlatte - - - Leonard Lance - - - Ileana Ros-Lehtinen - - - Carol Shea-Porter - - - John J. Faso - - - Tom Marino - - - Sherrod Brown - - - John Barrasso - - - Susan M. Collins - - - John Cornyn - - - Marsha Blackburn - - - Jim Costa - - - Marcia L. Fudge - - - William R. Keating - - - David Loebsack - - - Blaine Luetkemeyer - - - Julia Brownley - - - Denny Heck - - - Mark DeSaulnier - - - John H. Rutherford - - - Ed Case - - - Rick Scott - - - Shelley Berkley - - - Brian P. Bilbray - - - Ann Marie Buerkle - - - Larry Kissell - - - Jean Schmidt - - - Jim DeMint - - - John F. Tierney - - - Kerry L. Bentivolio - - - John Fleming - - - Richard L. Hanna - - - Richard B. Nugent - - - Al Franken - - - Diane Black - - - Edward R. Royce - - - Colleen Hanabusa - - - Elijah E. Cummings - - - Roger F. Wicker - - - Rob Bishop - - - Vern Buchanan - - - Mike Crapo - - - Kenny Marchant - - - Jerry McNerney - - - Gwen Moore - - - Frank Pallone, Jr. - - - Kurt Schrader - - - Albio Sires - - - Mike Thompson - - - Tim Walberg - - - Deb Fischer - - - Rick W. Allen - - - John Kennedy - - - Jo Ann Emerson - - - Mark Udall - - - Timothy H. Bishop - - - Mike Johanns - - - Lynn A. Westmoreland - - - David G. Reichert - - - Chris Collins - - - Debbie Stabenow - - - Roy Blunt - - - John Boozman - - - Michael C. Burgess - - - Gerald E. Connolly - - - Sheila Jackson Lee - - - Patty Murray - - - Charles E. Schumer - - - Michael K. Simpson - - - Jackie Speier - - - Dina Titus - - - Joyce Beatty - - - Donald S. Beyer, Jr. - - - Ann Kirkpatrick - - - Sylvia R. Garcia - - - Carol D. Miller - - - Francisco "Quico" Canseco - - - Jerry F. Costello - - - William L. Owens - - - Nick J. Rahall II - - - William L. Enyart - - - John A. Boehner - - - Randy Neugebauer - - - Brad Ashford - - - Joe Barton - - - Jack Reed - - - Steve Cohen - - - Tom Cole - - - Steve King - - - Richard E. Neal - - - Paul Tonko - - - Peter J. Visclosky - - - Daniel Webster - - - Ron Wyden - - - Elizabeth Warren - - - Roger Williams - - - David Perdue - - - Kent Conrad - - - David Alan Curson - - - Tom Coburn - - - Rush Holt - - - Tom Latham - - - Gary G. Miller - - - Allyson Y. Schwartz - - - Ted Poe - - - Robert Pittenger - - - Tom Udall - - - Earl Blumenauer - - - K. Michael Conaway - - - Raúl M. Grijalva - - - Mike Kelly - - - John B. Larson - - - Bennie G. Thompson - - - Lois Frankel - - - Brian Babin - - - Al Lawson, Jr. - - - Kweisi Mfume - - - Olympia J. Snowe - - - W. Todd Akin - - - Joe Baca - - - Spencer Bachus - - - John Kline - - - John J. Duncan, Jr. - - - Gene Green - - - Stevan Pearce - - - Dana Rohrabacher - - - Lamar Smith - - - Thomas R. Carper - - - Jeanne Shaheen - - - Joe Manchin, III - - - Sanford D. Bishop, Jr. - - - G. K. Butterfield - - - Peter A. DeFazio - - - Eliot L. Engel - - - Al Green - - - Mazie K. Hirono - - - Zoe Lofgren - - - David B. McKinley - - - Jerrold Nadler - - - Bill Posey - - - Robert C. "Bobby" Scott - - - Peter Welch - - - Joe Wilson - - - John A. Yarmuth - - - Aumua Amata Coleman Radewagen - - - Jack Bergman - - - Mitt Romney - - - Jim Webb - - - Timothy V. Johnson - - - Dennis J. Kucinich - - - Daniel E. Lungren - - - Rodney Alexander - - - Tim Johnson - - - Paul C. Broun - - - Corrine Brown - - - Jeff Sessions - - - Rodney P. Frelinghuysen - - - Frank A. LoBiondo - - - Niki Tsongas - - - Richard Blumenthal - - - Lloyd Doggett - - - Marcy Kaptur - - - Barbara Lee - - - Carolyn B. Maloney - - - Edward J. Markey - - - C. A. Dutch Ruppersberger - - - Bobby L. Rush - - - Alma S. Adams - - - Tom O’Halleran - - - Charles A. Gonzalez - - - Wally Herger - - - Melvin L. Watt - - - Donna M. Christensen - - - George Miller - - - James P. Moran - - - Ron Barber - - - Robert A. Brady - - - John Garamendi - - - David P. Roe - - - David Scott - - - Bonnie Watson Coleman - - - James R. Baird - - - Elton Gallegly - - - Donald A. Manzullo - - - Silvestre Reyes - - - Carolyn McCarthy - - - Ander Crenshaw - - - Johnny Isakson - - - Richard J. Durbin - - - Michael B. Enzi - - - Emanuel Cleaver - - - Susan A. Davis - - - Peter T. King - - - Doris O. Matsui - - - Collin C. Peterson - - - Janice D. Schakowsky - - - Angus S. King, Jr. - - - Jeff Bingaman - - - Kay Bailey Hutchison - - - John F. Kerry - - - Saxby Chambliss - - - Eni F. H. Faleomavaega - - - Ed Pastor - - - Ed Whitfield - - - Daniel Coats - - - John L. Mica - - - Richard M. Nolan - - - Walter B. Jones - - - Benjamin L. Cardin - - - James E. Risch - - - Rosa L. DeLauro - - - Virginia Foxx - - - Kay Granger - - - F. James Sensenbrenner, Jr. - - - José E. Serrano - - - Paul Cook - - - Bob Filner - - - Joseph I. Lieberman - - - Gary L. Ackerman - - - Phil Gingrey - - - Jon Kyl - - - Bill Nelson - - - Mitch McConnell - - - Anna G. Eshoo - - - Frederica S. Wilson - - - Ben Nelson - - - Howard L. Berman - - - Sue Wilkins Myrick - - - Cliff Stearns - - - Robert L. Turner - - - Max Baucus - - - Doc Hastings - - - Gloria Negrete McLeod - - - Sam Farr - - - Michael M. Honda - - - Bernard Sanders - - - John R. Carter - - - Danny K. Davis - - - Lucille Roybal-Allard - - - Alan S. Lowenthal - - - Donna E. Shalala - - - Norman D. Dicks - - - Barney Frank - - - Thomas E. Petri - - - Barbara Boxer - - - Rubén Hinojosa - - - John Lewis - - - Lamar Alexander - - - James E. Clyburn - - - Patrick J. Leahy - - - Nancy Pelosi - - - David E. Price - - - Tom Harkin - - - Henry A. Waxman - - - Frank R. Wolf - - - Harry Reid - - - Joseph R. Pitts - - - Steny H. Hoyer - - - Dan Burton - - - Maurice D. Hinchey - - - Howard P. "Buck" McKeon - - - Lois Capps - - - Maxine Waters - - - Judy Biggert - - - Lynn C. Woolsey - - - John D. Rockefeller, IV - - - Thad Cochran - - - Nita M. Lowey - - - Eleanor Holmes Norton - - - Bill Pascrell, Jr. - - - Harold Rogers - - - John W. Olver - - - Barbara A. Mikulski - - - Jim McDermott - - - John McCain - - - Pat Roberts - - - Alcee L. Hastings - - - Grace F. Napolitano - - - Herb Kohl - - - Ron Paul - - - Eddie Bernice Johnson - - - Leonard L. Boswell - - - Jerry Lewis - - - Edolphus Towns - - - Carl Levin - - - Orrin G. Hatch - - - James M. Inhofe - - - Richard C. Shelby - - - Madeleine Z. Bordallo - - - Dianne Feinstein - - - Chuck Grassley - - - Don Young - - - Richard G. Lugar - - - Fortney Pete Stark - - - Howard Coble - - - Sander M. Levin - - - C. W. Bill Young - - - Charles B. Rangel - - - Sam Johnson - - - Dale E. Kildee - - - John Conyers, Jr. - - - Louise McIntosh Slaughter - - - Roscoe G. Bartlett - - - John D. Dingell - - - Daniel K. Inouye - - - Daniel K. Akaka - - - Frank R. Lautenberg - - - Ralph M. Hall - + Alexandria Ocasio-Cortez + Abby Finkenauer + Katie Hill + Josh Harder + Lauren Underwood + Max Rose + Elise M. Stefanik + Mike Gallagher + Conor Lamb + Joe Neguse + Xochitl Torres Small + Anthony Gonzalez + William R. Timmons IV + Dan Crenshaw + Patrick Murphy + Trey Hollingsworth + Haley M. Stevens + Guy Reschenthaler + Colin Z. Allred + Matt Gaetz + Andy Kim + Joe Cunningham + Lance Gooden + Jared F. Golden + Aaron Schock + Tulsi Gabbard + Michael F. Q. San Nicolas + Ilhan Omar + Bryan Steil + Carlos Curbelo + Ruben J. Kihuen + Justin Amash + Eric Swalwell + Joseph P. Kennedy III + Jason Smith + Lee M. Zeldin + Brian J. Mast + Sharice Davids + Chris Pappas + Scott Taylor + Ruben Gallego + Pete Aguilar + Jim Banks + Jason Crow + Abigail Davis Spanberger + Josh Hawley + Ron DeSantis + Jaime Herrera Beutler + Adam Kinzinger + Seth Moulton + Stephanie N. Murphy + Darren Soto + Mike Levin + W. Gregory Steube + Anthony Brindisi + David G. Valadao + Tom Cotton + Markwayne Mullin + Brendan F. Boyle + Will Hurd + Antonio Delgado + Benjamin Quayle + Trey Radel + Marlin A. Stutzman + Kevin Yoder + Ryan A. Costello + Duncan Hunter + Martha Roby + Kyrsten Sinema + Ro Khanna + Nanette Diaz Barragán + Jenniffer González-Colón + Steve Watkins + Elissa Slotkin + Rashida Tlaib + Kelly Armstrong + Kendra S. Horn + Dusty Johnson + Mike Garcia + Jim Bridenstine + Jared Polis + Mia B. Love + Patrick T. McHenry + Grace Meng + Josh Gottheimer + Michael Cloud + Lizzie Fletcher + Elaine G. Luria + Vance M. McAllister + André Carson + Cory Gardner + Joaquin Castro + Derek Kilmer + Jimmy Gomez + Katie Porter + Michael Waltz + Ayanna Pressley + Ben McAdams + Dan Boren + Jon Runyan + Stephen Lee Fincher + Christopher Murphy + Devin Nunes + Cedric L. Richmond + Tim Ryan + Andy Barr + Raja Krishnamoorthi + Brian K. Fitzpatrick + Steven Horsford + Jahana Hayes + Russ Fulcher + Lori Trahan + David W. Jolly + Beto O’Rourke + Thomas A. Garrett, Jr. + Ben Ray Luján + Todd Young + Brian Schatz + Raul Ruiz + Garret Graves + David Rouzer + Ben Sasse + James Comer + Mike Johnson + Jodey C. Arrington + Angie Craig + Mikie Sherrill + Van Taylor + Chip Roy + Ben Cline + Heath Shuler + Kristi L. Noem + Sean P. Duffy + Martin Heinrich + Mike Lee + Tom Reed + Marco Rubio + Thomas Massie + Richard Hudson + Marc A. Veasey + Alexander X. Mooney + Ted Budd + Gilbert Ray Cisneros, Jr. + Debbie Mucarsel-Powell + Sean Casten + Jeffrey M. Landry + Michael G. Grimm + Frank C. Guinta + Todd Rokita + Thomas J. Rooney + Paul D. Ryan + Tom Graves + Steven M. Palazzo + Adrian Smith + Rob Woodall + Rodney Davis + Hakeem S. Jeffries + Ted Cruz + Joni Ernst + Warren Davidson + Greg Stanton + Michael Guest + Denver Riggleman + Kelly Loeffler + William M. Cowan + Robert Hurt + Robert J. Dold + Luke Messer + Bill Huizenga + Cathy McMorris Rodgers + Austin Scott + Linda T. Sánchez + Cory A. Booker + Ted Lieu + Mark Walker + Jimmy Panetta + Dean Phillips + Veronica Escobar + Jason Altmire + Tim Griffin + Daniel B. Maffei + Kelly Ayotte + Tim Huelskamp + David Young + James Lankford + Tammy Duckworth + George Holding + Darin LaHood + Jennifer Wexton + Kim Schrier + Connie Mack + Mark Takai + Mick Mulvaney + Jason Chaffetz + Jeff Denham + Raúl R. Labrador + Mike Bishop + Bruce Westerman + Vicente Gonzalez + Chrissy Houlahan + Randy Hultgren + Stephen Knight + Kirsten E. Gillibrand + Kathy Castor + Eric A. "Rick" Crawford + Theodore E. Deutch + Jeff Duncan + James A. Himes + Daniel Lipinski + Debbie Wasserman Schultz + Doug Collins + Sean Patrick Maloney + Stacey E. Plaskett + Trent Kelly + A. Drew Ferguson IV + David Kustoff + Liz Cheney + Ross Spano + Pete Stauber + Susie Lee + Martha McSally + Chris Jacobs + Jesse L. Jackson Jr. + David Rivera + John Sullivan + Jeff Chiesa + Steve Southerland II + Erik Paulsen + John Ratcliffe + Robert B. Aderholt + Rick Larsen + Kevin McCarthy + Steve Scalise + Tim Scott + Terri A. Sewell + Adam Smith + Steve Stivers + Ami Bera + Norma J. Torres + Kathleen M. Rice + Pramila Jayapal + Cynthia Axne + Tom Malinowski + John W. Rose + Fred Keller + Robert T. Schilling + Renee L. Ellmers + Christopher P. Gibson + Trey Gowdy + Timothy J. Walz + Dave Brat + Michael F. Bennet + Yvette D. Clarke + Scott DesJarlais + Brett Guthrie + Jim Jordan + James R. Langevin + Jared Huffman + Mark Pocan + Dan Sullivan + Kamala D. Harris + Catherine Cortez Masto + Salud O. Carbajal + Lloyd Smucker + Daniel Meuser + Tim Burchett + Mark E. Green + Dan Bishop + Betty Sutton + Eric Cantor + Mark L. Pryor + Mike Rogers + Joe Garcia + Michael G. Fitzpatrick + Gwen Graham + Mike Pompeo + Keith Ellison + Lynn Jenkins + John K. Delaney + Steve Russell + Christopher A. Coons + Gus M. Bilirakis + Sam Graves + Ron Kind + Rand Paul + Tony Cárdenas + Jackie Walorski + Filemon Vela + Katherine M. Clark + Barry Loudermilk + Don Bacon + TJ Cox + Gregory F. Murphy + Mark S. Critz + Todd Russell Platts + Laura Richardson + Mark Begich + Lee Terry + Patrick J. Tiberi + Joseph Crowley + Jeff Flake + Keith J. Rothfus + Mimi Walters + Karen C. Handel + Tammy Baldwin + Larry Bucshon + Charles J. "Chuck" Fleischmann + Michael T. McCaul + Pete Olson + John P. Sarbanes + David Schweikert + Suzan K. DelBene + Ann Wagner + Steve Daines + Scott Perry + John Katko + Lisa Blunt Rochester + Jamie Raskin + Thomas R. Suozzi + Troy Balderson + Jim Hagedorn + Mary Bono Mack + Mike Ross + Joe Walsh + Allen B. West + Pete P. Gallego + David Vitter + Joseph J. Heck + Ryan K. Zinke + Blake Farenthold + Peter J. Roskam + Bill Shuster + Claudia Tenney + David N. Cicilline + Mario Diaz-Balart + John Thune + Patrick J. Toomey + Juan Vargas + Cheri Bustos + Kevin Cramer + Matt Cartwright + John R. Moolenaar + Tom Emmer + Bradley Scott Schneider + Clay Higgins + Anthony G. Brown + Paul Mitchell + A. Donald McEachin + Greg Gianforte + Kevin Hern + Harley Rouda + Jim Matheson + John E. Walsh + E. Scott Rigell + Loretta Sanchez + Charles W. Dent + Evan H. Jenkins + Dean Heller + Mark Sanford + David A. Trott + Thomas MacArthur + Robert P. Casey, Jr. + Amy Klobuchar + Jeff Fortenberry + Vicky Hartzler + Frank D. Lucas + Adam B. Schiff + Michael R. Turner + Doug LaMalfa + Mark Takano + Susan W. Brooks + Chris Stewart + Jody B. Hice + Mike Bost + Thom Tillis + Roger W. Marshall + John R. Curtis + Lucy McBath + Andy Levin + Debra A. Haaland + Scott P. Brown + Rick Berg + Ben Chandler + Chip Cravaack + Nan A. S. Hayworth + Mike Pence + Jo Bonner + Mark Kirk + Scott Garrett + Jeff Miller + Pedro R. Pierluisi + Curt Clawson + Michelle Lujan Grisham + Dennis A. Ross + Elizabeth H. Esty + Barbara Comstock + Brenda Jones + Mark Meadows + Brian Higgins + James P. McGovern + Glenn Thompson + Chris Van Hollen + Robert J. Wittman + Ken Buck + Cindy Hyde-Smith + Mary Gay Scanlon + Madeleine Dean + Enid Greene Waldholtz + Steve Austria + Russ Carnahan + Kathleen C. Hochul + Alan Nunnelee + Donna F. Edwards + Steve Israel + Matt Salmon + Alan Grayson + Xavier Becerra + James B. Renacci + Maria Cantwell + Paul A. Gosar + H. Morgan Griffith + Gary C. Peters + Mike Quigley + Mike Rogers + John Shimkus + Mac Thornberry + Mark E. Amodei + Donald M. Payne, Jr. + Scott H. Peters + Daniel T. Kildee + Brad R. Wenstrup + Tim Kaine + Donald Norcross + Margaret Wood Hassan + Andy Biggs + J. Luis Correa + Tina Smith + Debbie Lesko + Hansen Clarke + Tim Holden + Robert E. Andrews + Bruce L. Braley + Cresent Hardy + Trent Franks + Jeb Hensarling + Bill Cassidy + Diana DeGette + Andy Harris + John Hoeven + Lisa Murkowski + Greg Walden + Steve Womack + David P. Joyce + Tom Rice + Earl L. "Buddy" Carter + Val Butler Demings + Jacky Rosen + Joseph D. Morelle + Susan Wild + John Joyce + Thomas P. Tiffany + Sandy Adams + Michele Bachmann + Mike McIntyre + Steve Stockman + Chaka Fattah + Charles W. Boustany Jr. + John C. Carney Jr. + Reid J. Ribble + Lou Barletta + John Abney Culberson + Gregg Harper + Daniel M. Donovan, Jr. + Jon Tester + Jeff Merkley + Wm. Lacy Clay + Robert E. Latta + Tom McClintock + Scott R. Tipton + Ann M. Kuster + Robin L. Kelly + J. French Hill + Charlie Crist + Ron Estes + Jesús G. "Chuy" García + Greg Pence + Denny Rehberg + Mary L. Landrieu + John Barrow + John Campbell + Jim Gerlach + Jack Kingston + Michael H. Michaud + Patrick Meehan + Mike Coffman + Joe Donnelly + Pete Sessions + Heidi Heitkamp + Rod Blum + Jason Lewis + Sheldon Whitehouse + Lindsey Graham + Kevin Brady + Richard Burr + Henry Cuellar + Ron Johnson + Billy Long + Stephen F. Lynch + Chellie Pingree + Rob Portman + Gregorio Kilili Camacho Sablan + Bill Foster + Ted S. Yoho + Bradley Byrne + Dan Newhouse + Glenn Grothman + David J. Trone + Steven C. LaTourette + Candice S. Miller + Cynthia M. Lummis + Tom Price + Robert Menendez + Mark R. Warner + Mo Brooks + Jim Cooper + Bill Flores + Bob Gibbs + Bill Johnson + Henry C. "Hank" Johnson, Jr. + Doug Lamborn + Betty McCollum + Jerry Moran + Brad Sherman + Suzanne Bonamici + Gary J. Palmer + Ralph Lee Abraham + Brenda L. Lawrence + Mike Rounds + Dwight Evans + Adriano Espaillat + Doug Jones + Mike Braun + Brad Miller + Kay R. Hagan + Dave Camp + Luther Strange + Claire McCaskill + Luis V. Gutiérrez + Darrell E. Issa + Bruce Poliquin + Karen Bass + Ken Calvert + Shelley Moore Capito + Steve Chabot + Judy Chu + Joe Courtney + Michael F. Doyle + Louie Gohmert + Gregory W. Meeks + Ed Perlmutter + Christopher H. Smith + Fred Upton + Nydia M. Velázquez + Randy K. Weber, Sr. + Debbie Dingell + Neal P. Dunn + Francis Rooney + Ralph Norman + Jefferson Van Drew + Ron Wright + Charles F. Bass + David Dreier + Steven R. Rothman + Janice Hahn + Dan Benishek + J. Randy Forbes + Tim Murphy + Bob Corker + Michael E. Capuano + Bob Goodlatte + Leonard Lance + Ileana Ros-Lehtinen + Carol Shea-Porter + John J. Faso + Tom Marino + Sherrod Brown + John Barrasso + Susan M. Collins + John Cornyn + Marsha Blackburn + Jim Costa + Marcia L. Fudge + William R. Keating + David Loebsack + Blaine Luetkemeyer + Julia Brownley + Denny Heck + Mark DeSaulnier + John H. Rutherford + Ed Case + Rick Scott + Shelley Berkley + Brian P. Bilbray + Ann Marie Buerkle + Larry Kissell + Jean Schmidt + Jim DeMint + John F. Tierney + Kerry L. Bentivolio + John Fleming + Richard L. Hanna + Richard B. Nugent + Al Franken + Diane Black + Edward R. Royce + Colleen Hanabusa + Elijah E. Cummings + Roger F. Wicker + Rob Bishop + Vern Buchanan + Mike Crapo + Kenny Marchant + Jerry McNerney + Gwen Moore + Frank Pallone, Jr. + Kurt Schrader + Albio Sires + Mike Thompson + Tim Walberg + Deb Fischer + Rick W. Allen + John Kennedy + Jo Ann Emerson + Mark Udall + Timothy H. Bishop + Mike Johanns + Lynn A. Westmoreland + David G. Reichert + Chris Collins + Debbie Stabenow + Roy Blunt + John Boozman + Michael C. Burgess + Gerald E. Connolly + Sheila Jackson Lee + Patty Murray + Charles E. Schumer + Michael K. Simpson + Jackie Speier + Dina Titus + Joyce Beatty + Donald S. Beyer, Jr. + Ann Kirkpatrick + Sylvia R. Garcia + Carol D. Miller + Francisco "Quico" Canseco + Jerry F. Costello + William L. Owens + Nick J. Rahall II + William L. Enyart + John A. Boehner + Randy Neugebauer + Brad Ashford + Joe Barton + Jack Reed + Steve Cohen + Tom Cole + Steve King + Richard E. Neal + Paul Tonko + Peter J. Visclosky + Daniel Webster + Ron Wyden + Elizabeth Warren + Roger Williams + David Perdue + Kent Conrad + David Alan Curson + Tom Coburn + Rush Holt + Tom Latham + Gary G. Miller + Allyson Y. Schwartz + Ted Poe + Robert Pittenger + Tom Udall + Earl Blumenauer + K. Michael Conaway + Raúl M. Grijalva + Mike Kelly + John B. Larson + Bennie G. Thompson + Lois Frankel + Brian Babin + Al Lawson, Jr. + Kweisi Mfume + Olympia J. Snowe + W. Todd Akin + Joe Baca + Spencer Bachus + John Kline + John J. Duncan, Jr. + Gene Green + Stevan Pearce + Dana Rohrabacher + Lamar Smith + Thomas R. Carper + Jeanne Shaheen + Joe Manchin, III + Sanford D. Bishop, Jr. + G. K. Butterfield + Peter A. DeFazio + Eliot L. Engel + Al Green + Mazie K. Hirono + Zoe Lofgren + David B. McKinley + Jerrold Nadler + Bill Posey + Robert C. "Bobby" Scott + Peter Welch + Joe Wilson + John A. Yarmuth + Aumua Amata Coleman Radewagen + Jack Bergman + Mitt Romney + Jim Webb + Timothy V. Johnson + Dennis J. Kucinich + Daniel E. Lungren + Rodney Alexander + Tim Johnson + Paul C. Broun + Corrine Brown + Jeff Sessions + Rodney P. Frelinghuysen + Frank A. LoBiondo + Niki Tsongas + Richard Blumenthal + Lloyd Doggett + Marcy Kaptur + Barbara Lee + Carolyn B. Maloney + Edward J. Markey + C. A. Dutch Ruppersberger + Bobby L. Rush + Alma S. Adams + Tom O’Halleran + Charles A. Gonzalez + Wally Herger + Melvin L. Watt + Donna M. Christensen + George Miller + James P. Moran + Ron Barber + Robert A. Brady + John Garamendi + David P. Roe + David Scott + Bonnie Watson Coleman + James R. Baird + Elton Gallegly + Donald A. Manzullo + Silvestre Reyes + Carolyn McCarthy + Ander Crenshaw + Johnny Isakson + Richard J. Durbin + Michael B. Enzi + Emanuel Cleaver + Susan A. Davis + Peter T. King + Doris O. Matsui + Collin C. Peterson + Janice D. Schakowsky + Angus S. King, Jr. + Jeff Bingaman + Kay Bailey Hutchison + John F. Kerry + Saxby Chambliss + Eni F. H. Faleomavaega + Ed Pastor + Ed Whitfield + Daniel Coats + John L. Mica + Richard M. Nolan + Walter B. Jones + Benjamin L. Cardin + James E. Risch + Rosa L. DeLauro + Virginia Foxx + Kay Granger + F. James Sensenbrenner, Jr. + José E. Serrano + Paul Cook + Bob Filner + Joseph I. Lieberman + Gary L. Ackerman + Phil Gingrey + Jon Kyl + Bill Nelson + Mitch McConnell + Anna G. Eshoo + Frederica S. Wilson + Ben Nelson + Howard L. Berman + Sue Wilkins Myrick + Cliff Stearns + Robert L. Turner + Max Baucus + Doc Hastings + Gloria Negrete McLeod + Sam Farr + Michael M. Honda + Bernard Sanders + John R. Carter + Danny K. Davis + Lucille Roybal-Allard + Alan S. Lowenthal + Donna E. Shalala + Norman D. Dicks + Barney Frank + Thomas E. Petri + Barbara Boxer + Rubén Hinojosa + John Lewis + Lamar Alexander + James E. Clyburn + Patrick J. Leahy + Nancy Pelosi + David E. Price + Tom Harkin + Henry A. Waxman + Frank R. Wolf + Harry Reid + Joseph R. Pitts + Steny H. Hoyer + Dan Burton + Maurice D. Hinchey + Howard P. "Buck" McKeon + Lois Capps + Maxine Waters + Judy Biggert + Lynn C. Woolsey + John D. Rockefeller, IV + Thad Cochran + Nita M. Lowey + Eleanor Holmes Norton + Bill Pascrell, Jr. + Harold Rogers + John W. Olver + Barbara A. Mikulski + Jim McDermott + John McCain + Pat Roberts + Alcee L. Hastings + Grace F. Napolitano + Herb Kohl + Ron Paul + Eddie Bernice Johnson + Leonard L. Boswell + Jerry Lewis + Edolphus Towns + Carl Levin + Orrin G. Hatch + James M. Inhofe + Richard C. Shelby + Madeleine Z. Bordallo + Dianne Feinstein + Chuck Grassley + Don Young + Richard G. Lugar + Fortney Pete Stark + Howard Coble + Sander M. Levin + C. W. Bill Young + Charles B. Rangel + Sam Johnson + Dale E. Kildee + John Conyers, Jr. + Louise McIntosh Slaughter + Roscoe G. Bartlett + John D. Dingell + Daniel K. Inouye + Daniel K. Akaka + Frank R. Lautenberg + Ralph M. Hall diff --git a/test/output/usCountyChoropleth.html b/test/output/usCountyChoropleth.html index e45c5e89cb..346a4c528a 100644 --- a/test/output/usCountyChoropleth.html +++ b/test/output/usCountyChoropleth.html @@ -26,30 +26,39 @@ - 2 + + 2 - 3 + + 3 - 4 + + 4 - 5 + + 5 - 6 + + 6 - 7 + + 7 - 8 + + 8 - 9 + + 9 - Unemployment (%) + + Unemployment (%) - - Mohave - - - Tangipahoa - - - Lincoln - - - Polk - - - Cass - - - Lawrence - - - Schoharie - - - Wrangell - - - Haralson - - - Bleckley - - - Lawrence - - - Jennings - - - Lapeer - - - Chickasaw - - - Crawford - - - Minnehaha - - - Turner - - - Walker - - - Santa Isabel - - - Aurora - - - Brooks - - - Caguas - - - Cataño - - - Morovis - - - Chase - - - Florida - - - Conejos - - - Washington - - - Norton - - - Ford - - - Deaf Smith - - - Sumter - - - Marinette - - - San Benito - - - Meriwether - - - Black Hawk - - - Hancock - - - Red Lake - - - Nance - - - Lebanon - - - Hockley - - - Shackelford - - - Tom Green - - - Wise - - - Lake - - - Hyde - - - Cottle - - - Santa Cruz - - - Wapello - - - Cedar - - - Garfield - - - St. Clair - - - Okaloosa - - - Todd - - - Aroostook - - - Allegany - - - Lauderdale - - - Dickey - - - Meeker - - - Bennett - - - Summit - - - Seneca - - - Greenwood - - - Lane - - - Newaygo - - - Clay - - - Orleans - - - Nelson - - - Blaine - - - Taylor - - - Armstrong - - - Hutchinson - - - Irion - - - Waushara - - - Scott - - - Sawyer - - - Isabella - - - Stone - - - Calhoun - - - Thomas - - - Mitchell - - - Jackson - - - Howard - - - Sanilac - - - Jay - - - Renville - - - Gilliam - - - McDonald - - - Yoakum - - - Childress - - - Douglas - - - Kusilvak - - - Warren - - - Comanche - - - Beckham - - - Buffalo - - - Gillespie - - - Dickens - - - La Salle - - - Tucker - - - Shasta - - - Saline - - - Manistee - - - Garfield - - - Custer - - - Miner - - - Clark - - - Cross - - - Archuleta - - - Glades - - - Gregory - - - Hansford - - - Pierce - - - Coweta - - - Clarke - - - Johnson - - - Marion - - - Isanti - - - Antelope - - - Medina - - - Sequatchie - - - Potter - - - Falls - - - Griggs - - - Douglas - - - Hamilton - - - Wayne - - - Slope - - - Runnels - - - Coconino - - - Benewah - - - Barber - - - Rock - - - Washington - - - Liberty - - - Marshall - - - Wayne - - - Bristol Bay - - - DeSoto - - - Bartow - - - Marshall - - - Edwards - - - Ogemaw - - - Howard - - - Hancock - - - Scott - - - Bledsoe - - - Rockingham - - - Hale - - - Waynesboro - - - Natrona - - - San Jacinto - - - Waupaca - - - Harrison - - - Decatur - - - Acadia - - - Carver - - - Hamilton - - - Kandiyohi - - - Manitowoc - - - Butler - - - Jones - - - Franklin - - - Noble - - - Thomas - - - Clare - - - Crawford - - - Webster - - - Arthur - - - Polk - - - Codington - - - Duval - - - Moore - - - Martin - - - Knox - - - Jayuya - - - Limestone - - - Delaware - - - Seward - - - Zavala - - - Sierra - - - Winnebago - - - York - - - Caroline - - - Montmorency - - - Richland - - - Beaver - - - Cochran - - - Gladwin - - - Washington - - - Buchanan - - - Webster - - - Ford - - - Oscoda - - - Neshoba - - - Phelps - - - Cuming - - - Greenville - - - Fisher - - - Franklin - - - Defiance - - - Giles - - - Baylor - - - Panola - - - Adams - - - Boone - - - Jack - - - Aibonito - - - Chase - - - Coryell - - - Clinton - - - Woodson - - - DeKalb - - - Ringgold - - - Shelby - - - Fresno - - - Union - - - Marshall - - - Piatt - - - Adams - - - Richland - - - Chester - - - Branch - - - Randolph - - - Wallace - - - Wayne - - - Emporia - - - Lipscomb - - - Trousdale - - - San Juan - - - Mahaska - - - Boundary - - - Logan - - - Franklin - - - Bienville - - - Amador - - - El Dorado - - - Izard - - - Buena Vista - - - Danville - - - Galax - - - Harrisonburg - - - Martinsville - - - Fulton - - - Adair - - - Monterey - - - Warren - - - Yadkin - - - Gratiot - - - Lee - - - Neosho - - - Ionia - - - Kalamazoo - - - McLean - - - Cottonwood - - - Lake - - - Mason - - - Mecosta - - - Muskegon - - - Freeborn - - - Fayette - - - Effingham - - - Benton - - - Donley - - - Douglas - - - Kingfisher - - - Gibson - - - Benton - - - Bamberg - - - Atascosa - - - Hutchinson - - - Butte - - - Hoonah-Angoon - - - Hand - - - Kingsbury - - - Lewis - - - Lincoln - - - Madison - - - Charlottesville - - - Golden Valley - - - Converse - - - Washington - - - Taylor - - - Park - - - Murray - - - Waukesha - - - Pipestone - - - King George - - - Beaverhead - - - Wheatland - - - Christian - - - Cooper - - - Cloud - - - Richmond - - - Crockett - - - Hendricks - - - Ness - - - Kendall - - - Starke - - - Shelby - - - Laclede - - - Livingston - - - Otsego - - - Hitchcock - - - Roscommon - - - Barton - - - Briscoe - - - Washtenaw - - - Barry - - - Luna - - - Scott - - - Coos - - - Towner - - - Newton - - - Petersburg - - - Stanton - - - Wayne - - - Menominee - - - Goliad - - - Ransom - - - Gray - - - Venango - - - Hall - - - Stone - - - Greene - - - Daviess - - - Scotland - - - Brown - - - Gaines - - - Bell - - - Pend Oreille - - - Tift - - - Sutton - - - Botetourt - - - San Augustine - - - San Lorenzo - - - Vega Alta - - - Carlton - - - Dixie - - - Morgan - - - Northwest Arctic - - - Billings - - - Aitkin - - - Garfield - - - Anderson - - - King - - - Custer - - - Marion - - - Knox - - - Barrow - - - LaSalle - - - Coffee - - - Martin - - - Hamilton - - - Hardin - - - Custer - - - Calhoun - - - Ida - - - Rio Grande - - - Marion - - - Morgan - - - Poweshiek - - - Tazewell - - - Elbert - - - Polk - - - Shelby - - - Madison - - - Summit - - - Hardee - - - Van Wert - - - Warren - - - Uvalde - - - Madison - - - Guernsey - - - Wilson - - - Delaware - - - Geauga - - - Greer - - - Rice - - - Cleveland - - - Dooly - - - Schleicher - - - Watonwan - - - Adams - - - Alexander - - - Cedar - - - Swisher - - - Lewis and Clark - - - Pettis - - - Motley - - - Ravalli - - - San Bernardino - - - McDuffie - - - Haines - - - Marathon - - - Aleutians East - - - Kodiak Island - - - Lake and Peninsula - - - Valdez-Cordova - - - Davison - - - Grant - - - Pickaway - - - Portage - - - Grady - - - Maricao - - - Pocahontas - - - Rincón - - - Otter Tail - - - Fannin - - - Pennington - - - Christian - - - Wabash - - - Montrose - - - Pike - - - McHenry - - - Van Buren - - - Scott - - - Bibb - - - Cayey - - - Midland - - - Ellis - - - Bottineau - - - Manu'a - - - Western - - - Allen - - - Jackson - - - Henry - - - Boone - - - Tehama - - - Miami - - - Logan - - - Cherokee - - - Lyman - - - Mahnomen - - - Clark - - - Scott - - - Roseau - - - Pope - - - Luce - - - Benton - - - Van Buren - - - York - - - Douglas - - - Flathead - - - Lynn - - - Dent - - - Menard - - - Nolan - - - Shannon - - - Sterling - - - Otero - - - Garza - - - Teller - - - Sanders - - - Callahan - - - Stonewall - - - Grady - - - Franklin - - - Van Zandt - - - Gosper - - - Fillmore - - - Hunt - - - Madison - - - Carter - - - Rappahannock - - - Morgan - - - Greene - - - Yukon-Koyukuk - - - Greene - - - Drew - - - Grenada - - - Radford - - - Sullivan - - - McDowell - - - Onslow - - - Clinton - - - Bay - - - Guaynabo - - - Canóvanas - - - Corozal - - - King - - - Chelan - - - Flagler - - - Kittitas - - - Orange - - - Pulaski - - - Amite - - - Edmunds - - - Grundy - - - Pratt - - - Cerro Gordo - - - Saunders - - - Saline - - - Portage - - - Crawford - - - Hood - - - Lyon - - - Fall River - - - Petroleum - - - Clinton - - - Barnes - - - Lamoille - - - Butts - - - Wood - - - Wright - - - Mason - - - Gregg - - - Oktibbeha - - - Nevada - - - Dawes - - - Josephine - - - Saline - - - Hemphill - - - Lamar - - - Jefferson Davis - - - Licking - - - Castro - - - Antrim - - - Phillips - - - Grant - - - Broadwater - - - Buffalo - - - Esmeralda - - - Orange - - - Jefferson - - - LaGrange - - - Jones - - - Carroll - - - Stutsman - - - Greene - - - Baldwin - - - Jackson - - - Hancock - - - Graham - - - Allen - - - Pushmataha - - - Upton - - - Potter - - - Harlan - - - Emmet - - - Cavalier - - - Tuolumne - - - Trego - - - Jim Hogg - - - Humacao - - - Menominee - - - Martin - - - Lowndes - - - Franklin - - - Shelby - - - Creek - - - Lavaca - - - Green Lake - - - Dawson - - - St. Joseph - - - Jefferson - - - Mitchell - - - Southeast Fairbanks - - - Putnam - - - Montgomery - - - Bremer - - - Marion - - - Cabarrus - - - Midland - - - Kimble - - - Richland - - - Carson - - - Edmonson - - - Franklin - - - Valley - - - Louisa - - - Palo Pinto - - - Lamb - - - Walton - - - Greene - - - Darke - - - Beltrami - - - Osceola - - - Elk - - - Hamilton - - - St. Louis - - - Washington - - - Eastland - - - Kerr - - - Allegany - - - Lubbock - - - Salem - - - Hopewell - - - Henry - - - Leake - - - Torrance - - - Phillips - - - Yuma - - - O'Brien - - - Scott - - - Valley - - - Iredell - - - Fayette - - - Decatur - - - Baker - - - Winston - - - Washington - - - Arroyo - - - Benton - - - Santa Barbara - - - Trinity - - - Macoupin - - - Saginaw - - - Erath - - - Pasco - - - Stokes - - - Gem - - - Gilmer - - - Alfalfa - - - Washington - - - Evans - - - Henry - - - Chester - - - La Paz - - - Blaine - - - Lemhi - - - Gray - - - Montgomery - - - Upshur - - - Blanco - - - Geary - - - Carroll - - - Marshall - - - Guilford - - - Falls Church - - - Lexington - - - Hillsdale - - - Wichita - - - Dodge - - - De Witt - - - Andrews - - - Sanborn - - - Le Sueur - - - Rock - - - Steele - - - Jefferson - - - Pocahontas - - - Nobles - - - Prince of Wales-Hyder - - - Todd - - - Atkinson - - - Sitka - - - Carroll - - - St. Lucie - - - Davis - - - McDonough - - - Sandusky - - - Wayne - - - Jeff Davis - - - Sibley - - - Knox - - - St. Clair - - - Arenac - - - Jasper - - - Clay - - - Idaho - - - Rolette - - - Sheridan - - - Llano - - - Pueblo - - - Curry - - - Winston - - - Kearney - - - Barranquitas - - - Wetzel - - - Miller - - - Alamosa - - - Kiowa - - - Hettinger - - - Olmsted - - - Juncos - - - Crawford - - - Osage - - - Grundy - - - Sherman - - - Sabana Grande - - - Audubon - - - Hancock - - - Little River - - - Washington - - - Pulaski - - - Lonoke - - - Baca - - - Cassia - - - Chilton - - - Crisp - - - Lyon - - - Cumberland - - - Pawnee - - - Wheeler - - - Steele - - - York - - - Kalkaska - - - Rooks - - - Cumberland - - - Webster - - - Tippah - - - Coffee - - - Saline - - - Quitman - - - LaMoure - - - Ellsworth - - - Greene - - - Adair - - - Holmes - - - Conway - - - Pulaski - - - Comerío - - - Greeley - - - Crosby - - - Graves - - - Monroe - - - Bond - - - Montgomery - - - Smith - - - Edgar - - - Cambria - - - Linn - - - Renville - - - Todd - - - Marion - - - Lancaster - - - Cleburne - - - Ben Hill - - - Maui - - - Pulaski - - - McMullen - - - Linn - - - Roberts - - - Keokuk - - - Hocking - - - Chattahoochee - - - Musselshell - - - Heard - - - Cook - - - Sac - - - Person - - - North Slope - - - Maunabo - - - Huntington - - - Iron - - - Kent - - - Pulaski - - - Caldwell - - - Jefferson - - - Hawaii - - - Garfield - - - Clay - - - Woodbury - - - Pottawattamie - - - Blaine - - - Waldo - - - Suffolk - - - Franklin - - - Bay - - - Lincoln - - - Bolivar - - - Alpena - - - Gogebic - - - Somerset - - - Warren - - - Oswego - - - Redwood - - - Lucas - - - Muscatine - - - Cotton - - - Mills - - - Nassau - - - Wibaux - - - Pemiscot - - - Marion - - - Grant - - - Loudoun - - - Perkins - - - Comal - - - Zapata - - - Aransas - - - Orange - - - Winkler - - - Appomattox - - - Grant - - - Doddridge - - - Randolph - - - Osceola - - - Owsley - - - Vance - - - Gila - - - Searcy - - - Monroe - - - Washington - - - Newton - - - Sumter - - - Decatur - - - Fayette - - - Jasper - - - Jackson - - - East Carroll - - - Vermilion - - - Evangeline - - - DeKalb - - - Franklin - - - Johnson - - - Wheeler - - - Sierra - - - Lenoir - - - Cleveland - - - Kimball - - - Wagoner - - - Cleveland - - - Murray - - - Allegheny - - - Union - - - Hughes - - - Whitley - - - Transylvania - - - Craven - - - Jones - - - Norton - - - Meigs - - - Gallia - - - Greenbrier - - - St. Thomas - - - Poinsett - - - Stanislaus - - - Colusa - - - DeKalb - - - White - - - Floyd - - - Gooding - - - Ogle - - - Richland - - - Edgecombe - - - Sherman - - - Chambers - - - Alpine - - - Siskiyou - - - Montezuma - - - Murray - - - Oneida - - - Posey - - - Hardin - - - Cameron - - - Miami - - - Boise - - - Bonneville - - - Plymouth - - - Pointe Coupee - - - Dickinson - - - Jasper - - - Stevens - - - Jo Daviess - - - Fulton - - - Monroe - - - Lake - - - Lake - - - Newport - - - Herkimer - - - Union - - - Chambers - - - Okanogan - - - St. Clair - - - Kenosha - - - Juana Díaz - - - Marquette - - - Price - - - Loíza - - - Shoshone - - - Caldwell - - - Oliver - - - Richardson - - - Red Willow - - - Hardin - - - Lauderdale - - - Benton - - - Bureau - - - Grant - - - Missaukee - - - Montcalm - - - Wright - - - Texas - - - Madison - - - Lincoln - - - De Baca - - - Pitt - - - Morton - - - Huron - - - Okmulgee - - - Florence - - - Saluda - - - Breckinridge - - - Union - - - Wayne - - - Shelby - - - Jones - - - Loudon - - - Hill - - - Henrico - - - Carroll - - - Walsh - - - Langlade - - - Chippewa - - - St. Mary - - - Cabo Rojo - - - Columbia - - - Harney - - - Williamson - - - Daggett - - - Kinney - - - Morgan - - - Franklin - - - Arapahoe - - - Walker - - - Parke - - - Scott - - - Warren - - - Red River - - - Brown - - - Montgomery - - - Mississippi - - - Fulton - - - DeKalb - - - Scott - - - Del Norte - - - Stephenson - - - Crawford - - - Floyd - - - Liberty - - - Jerome - - - Wicomico - - - Baraga - - - Lincoln - - - Cumberland - - - Ohio - - - New York - - - St. Lawrence - - - Jefferson - - - Choctaw - - - Pike - - - Des Moines - - - Roosevelt - - - Anderson - - - Custer - - - Shelby - - - Hunterdon - - - Henry - - - Hampton - - - Phillips - - - Jeff Davis - - - Lincoln - - - Greene - - - Howard - - - Highland - - - King William - - - Bayfield - - - Vernon - - - Boone - - - Doniphan - - - Sherman - - - Mineral - - - Houston - - - Calhoun - - - Cherokee - - - Yellowstone - - - Hall - - - Brown - - - Valencia - - - San Miguel - - - Forsyth - - - Wayne - - - Bladen - - - Meagher - - - Rockcastle - - - Greenwood - - - Hancock - - - Casey - - - Jessamine - - - Polk - - - Mitchell - - - Currituck - - - Montgomery - - - Richmond - - - Franklin - - - Naranjito - - - Jefferson - - - Johnson - - - Meigs - - - Brule - - - Ellis - - - Clay - - - Amherst - - - Mineral - - - Emanuel - - - Mason - - - Story - - - Plymouth - - - Sedgwick - - - Henry - - - St. Charles - - - Colbert - - - Pima - - - Greenlee - - - Woodruff - - - Palm Beach - - - Glynn - - - Appanoose - - - Dubuque - - - Cumberland - - - Iberia - - - Lawrence - - - St. Mary's - - - East Baton Rouge - - - Grant - - - Oceana - - - Otoe - - - McHenry - - - Smith - - - Kane - - - Otero - - - Perry - - - Knox - - - Erie - - - Charleston - - - York - - - Jasper - - - Orange - - - Windham - - - Hidalgo - - - Cibola - - - Mercer - - - Marshall - - - Montgomery - - - Etowah - - - Franklin - - - Bethel - - - Pennington - - - Spink - - - Union - - - Beaufort - - - Cocke - - - Bucks - - - Bon Homme - - - Dickson - - - Nowata - - - Kaufman - - - Foard - - - Hormigueros - - - Sagadahoc - - - Collin - - - Comanche - - - Concho - - - Crane - - - Eddy - - - Phelps - - - Logan - - - Ray - - - Inyo - - - Armstrong - - - Lincoln - - - Haywood - - - Grainger - - - Cameron - - - Clay - - - Carbon - - - Chesterfield - - - Dorchester - - - Chariton - - - Franklin - - - Elk - - - Mathews - - - Miller - - - Custer - - - Powder River - - - Hopkins - - - Alger - - - Johnson - - - Douglas - - - Knott - - - Harvey - - - St. Louis - - - Bedford - - - Brown - - - Nevada - - - Pike - - - Petersburg - - - Pike - - - Jersey - - - Clarendon - - - Hawkins - - - Henderson - - - Darlington - - - Chester - - - Dillon - - - Clarion - - - Florence - - - Forest - - - Charlton - - - Rio Arriba - - - De Soto - - - Durham - - - McKinley - - - Carroll - - - New Castle - - - Cheyenne - - - Appling - - - Elmore - - - Dolores - - - Kittson - - - Jasper - - - Georgetown - - - Fremont - - - Cass - - - Windsor - - - McLean - - - Greene - - - Massac - - - Dorchester - - - Kootenai - - - Middlesex - - - Elkhart - - - Greeley - - - Morgan - - - Knox - - - Decatur - - - Lawrence - - - Barbour - - - Berkshire - - - Callaway - - - Lac qui Parle - - - Goochland - - - Sublette - - - Cache - - - Lincoln - - - Alachua - - - Madison - - - Gonzales - - - Holt - - - Johnston - - - Mercer - - - Winneshiek - - - Haywood - - - Garrett - - - Preston - - - Houghton - - - Tipton - - - Ingham - - - Sumner - - - Lewis - - - Jefferson - - - Washington - - - Klickitat - - - Ralls - - - Albany - - - Albemarle - - - Lafayette - - - Maries - - - Osage - - - Waseca - - - Williams - - - Prince Edward - - - Kent - - - Schuyler - - - Montgomery - - - McNairy - - - Webster - - - New Hanover - - - Iron - - - Livingston - - - San Joaquin - - - McCracken - - - Hampton - - - Colfax - - - St. Croix - - - Gallatin - - - Perry - - - Elmore - - - Box Butte - - - Bristol - - - Wabash - - - Harlan - - - Maury - - - Calcasieu - - - Chatham - - - Dimmit - - - Magoffin - - - Davis - - - Piute - - - Martin - - - Houston - - - Clark - - - Ozaukee - - - Jefferson - - - Sevier - - - Guayama - - - Eureka - - - Lincoln - - - Union - - - Belknap - - - Bradley - - - Hayes - - - Northumberland - - - Talbot - - - Clay - - - Polk - - - Pottawatomie - - - Baltimore - - - Androscoggin - - - Sullivan - - - Union - - - Jackson - - - Utah - - - Summers - - - Sanpete - - - Dodge - - - Grant - - - Fulton - - - Pierce - - - Judith Basin - - - Lancaster - - - Caroline - - - Platte - - - Washington - - - Mississippi - - - Northampton - - - Sabine - - - Metcalfe - - - Pinal - - - Navajo - - - Yuma - - - Chisago - - - Dyer - - - Nicholas - - - Faribault - - - Perry - - - Bowie - - - Crook - - - Lee - - - Goshen - - - Norfolk - - - Larue - - - Fremont - - - Polk - - - Cherry - - - Rockdale - - - Imperial - - - Bonner - - - Fountain - - - Coffee - - - Warren - - - Pike - - - Powell - - - Ottawa - - - Sumner - - - Richmond - - - Brewster - - - Johnson - - - Polk - - - St. Croix - - - Dallam - - - Juniata - - - Lake - - - Wyoming - - - Jackson - - - Lawrence - - - Mercer - - - Luzerne - - - Camas - - - Johnson - - - Lucas - - - Woods - - - Woodward - - - Lincoln - - - Mercer - - - Socorro - - - Tippecanoe - - - Trigg - - - Scotland - - - Franklin - - - Gallatin - - - Greene - - - Calaveras - - - McCormick - - - Pickens - - - Fluvanna - - - Sumter - - - Northumberland - - - Fleming - - - Anderson - - - Teton - - - Taos - - - Kosciusko - - - Sioux - - - Clay - - - Cass - - - Oxford - - - Bath - - - Davidson - - - Cumberland - - - Blue Earth - - - Isle of Wight - - - Sweetwater - - - Mineral - - - Manassas Park - - - Columbia - - - Vega Baja - - - Dewey - - - Allendale - - - Greene - - - Clay - - - Crittenden - - - Anson - - - Fentress - - - Fulton - - - Boyd - - - Abbeville - - - Fayette - - - Morrow - - - Blair - - - Nantucket - - - Williamsburg - - - Nicollet - - - Wayne - - - Burnet - - - Deer Lodge - - - Silver Bow - - - Yankton - - - Jackson - - - Overton - - - Emery - - - Refugio - - - Ochiltree - - - San Juan - - - Independence - - - Camden - - - Pembina - - - Jackson - - - Lincoln - - - Obion - - - Aiken - - - Benton - - - Lane - - - King and Queen - - - Scott - - - Matagorda - - - Throckmorton - - - Washburn - - - Garfield - - - Douglas - - - Bristol - - - Traill - - - Jefferson - - - Lawrence - - - Colonial Heights - - - Anderson - - - Carlisle - - - Blount - - - Carroll - - - Henry - - - Hampden - - - Carroll - - - Caldwell - - - Rutland - - - Jefferson - - - Tazewell - - - Clarke - - - Villalba - - - Lafayette - - - Wilson - - - Edwards - - - Ramsey - - - Madison - - - Atchison - - - Halifax - - - Arlington - - - Skagit - - - Fallon - - - Surry - - - Walla Walla - - - Cherokee - - - Stevens - - - Chautauqua - - - Gentry - - - Warren - - - Monroe - - - Medina - - - Buchanan - - - Carter - - - Grand Traverse - - - Tishomingo - - - Catron - - - Somerset - - - Tompkins - - - Onondaga - - - Horry - - - Hill - - - Albany - - - Fulton - - - Pepin - - - Perry - - - Fairbanks North Star - - - Glascock - - - Glasscock - - - Teton - - - Jefferson - - - Delta - - - Clayton - - - Orange - - - Suffolk - - - Jefferson - - - Linn - - - Rutherford - - - Warren - - - Beaver - - - Washington - - - Calhoun - - - Greene - - - Brooke - - - Dillingham - - - Maricopa - - - Pike - - - Ripley - - - Kingman - - - Mitchell - - - Hodgeman - - - Morris - - - Mille Lacs - - - Lee - - - Lafayette - - - Copiah - - - Perry - - - Grand Forks - - - Delaware - - - Kent - - - Iowa - - - Dodge - - - Mineral - - - Prairie - - - Graham - - - Grand - - - Saguache - - - Okeechobee - - - Gilmer - - - Ware - - - Audrain - - - Los Alamos - - - Fergus - - - Rock - - - Mountrail - - - Henderson - - - Providence - - - Campbell - - - Kenedy - - - Livingston - - - Cabell - - - Butte - - - Summit - - - Hart - - - Warren - - - Owen - - - Dubois - - - Rush - - - Benton - - - Laurel - - - Stafford - - - Vernon - - - Livingston - - - Mower - - - Lamar - - - Humphreys - - - Pierce - - - Wolfe - - - Caldwell - - - Meade - - - Boyle - - - Yancey - - - Dallas - - - Pike - - - Conecuh - - - Perry - - - Pickens - - - Hancock - - - Webster - - - Madison - - - Martin - - - Finney - - - Jefferson - - - White - - - Pulaski - - - Brown - - - Caldwell - - - Johnson - - - Bollinger - - - Carter - - - Lancaster - - - Somerset - - - Wyoming - - - Schuyler - - - Logan - - - Union - - - Indiana - - - Hart - - - Ohio - - - Walworth - - - Jefferson - - - Harrison - - - Swain - - - Wood - - - Hertford - - - Liberty - - - Jackson - - - Pawnee - - - Coffey - - - Lafayette - - - Grant - - - Rankin - - - Hinds - - - Cumberland - - - Wilkes - - - Auglaize - - - Pottawatomie - - - McIntosh - - - Yamhill - - - Lehigh - - - Taylor - - - Barren - - - Travis - - - Montgomery - - - Howard - - - Wise - - - Winchester - - - Richland - - - Simpson - - - Boone - - - Chouteau - - - Hamilton - - - Santa Fe - - - Sampson - - - Okfuskee - - - Garfield - - - Menifee - - - Mora - - - Madison - - - Merrick - - - Deschutes - - - Humboldt - - - Tioga - - - Butler - - - Meade - - - Lincoln - - - Bell - - - Owen - - - Pamlico - - - Washington - - - Clay - - - Sheridan - - - Toa Baja - - - San Germán - - - Pike - - - Gallatin - - - Moore - - - Robeson - - - Bastrop - - - Trinity - - - Surry - - - Divide - - - Río Grande - - - Colleton - - - DeKalb - - - McLennan - - - Carteret - - - McCulloch - - - Williams - - - Brazoria - - - Belmont - - - Highland - - - Wood - - - Calumet - - - Mifflin - - - Ellis - - - Jones - - - Stewart - - - Bailey - - - Ponce - - - Jackson - - - Laurens - - - Harding - - - Wirt - - - Outagamie - - - Grant - - - Clatsop - - - Schuylkill - - - Lycoming - - - White - - - Buffalo - - - Saipan - - - Lajas - - - San Sebastián - - - Texas - - - Columbia - - - Corson - - - Houston - - - San Saba - - - Charles City - - - Page - - - Tripp - - - Presidio - - - Iron - - - Nacogdoches - - - Washington - - - Box Elder - - - Cooke - - - Wilbarger - - - Leon - - - Karnes - - - Bland - - - Sussex - - - Lunenburg - - - Calhoun - - - Buchanan - - - Mecklenburg - - - Bourbon - - - Minidoka - - - Alleghany - - - Amelia - - - Gloucester - - - Shenandoah - - - Dickenson - - - Utuado - - - Barron - - - Aguada - - - Pacific - - - Logan - - - Madera - - - Kewaunee - - - Montgomery - - - Gunnison - - - Brown - - - Echols - - - Harnett - - - Tioga - - - Hoke - - - Perquimans - - - Humphreys - - - Randall - - - Costilla - - - Weld - - - Whitfield - - - Bracken - - - Tipton - - - Russell - - - Lyon - - - Clark - - - Granville - - - Hyde - - - Sharkey - - - Adjuntas - - - Baldwin - - - Grayson - - - Pontotoc - - - Boyd - - - Staunton - - - Cass - - - Jerauld - - - Cochise - - - Polk - - - Fairfield - - - Ventura - - - Orange - - - Hernando - - - Bryan - - - Kossuth - - - Stanton - - - Las Animas - - - Madison - - - Charlotte - - - Gibson - - - Scott - - - Klamath - - - DeWitt - - - Choctaw - - - Sumter - - - Carroll - - - Kern - - - Lee - - - Routt - - - Union - - - Comanche - - - Daviess - - - St. Bernard - - - Bannock - - - Rawlins - - - Thomas - - - Early - - - Teton - - - Cecil - - - St. Clair - - - Phillips - - - Contra Costa - - - New Haven - - - Warrick - - - Clark - - - Lake - - - Campbell - - - East Feliciana - - - Suwannee - - - West Feliciana - - - Knox - - - Wayne - - - DeSoto - - - Howard - - - Perry - - - Lincoln - - - Hubbard - - - Cherokee - - - Big Stone - - - Kent - - - Payette - - - Steuben - - - Levy - - - Clinch - - - Cass - - - Marshall - - - Kent - - - Perkins - - - Ocean - - - Vigo - - - Chemung - - - Switzerland - - - Wadena - - - Niobrara - - - Bates - - - Nuckolls - - - Jefferson - - - Bergen - - - Westchester - - - Niagara - - - Watauga - - - Chippewa - - - Kay - - - Pope - - - Monroe - - - Sandoval - - - Clark - - - Charlevoix - - - Lenawee - - - Wabasha - - - Clay - - - Lincoln - - - Hardeman - - - Koochiching - - - Norman - - - Clark - - - Becker - - - Harrison - - - Coahoma - - - Quay - - - Middlesex - - - Pendleton - - - Ashley - - - Sunflower - - - Tunica - - - Putnam - - - Schuyler - - - Ritchie - - - Tyler - - - Floyd - - - McCone - - - Shawnee - - - DeKalb - - - Moody - - - St. Helena - - - Iron - - - Ward - - - Wichita - - - Willacy - - - Richland - - - Clark - - - Marion - - - Wood - - - Harrison - - - Valley - - - Essex - - - Carter - - - Robertson - - - Chicot - - - Hamilton - - - Howard - - - Marion - - - Montgomery - - - Madison - - - Chippewa - - - Mackinac - - - Nassau - - - Taylor - - - Bradley - - - Madison - - - Holmes - - - Weakley - - - Goodhue - - - Greene - - - Randolph - - - Doña Ana - - - Union - - - Sully - - - Carroll - - - Roanoke - - - Louisa - - - Page - - - Kershaw - - - Power - - - Coos - - - Douglas - - - Crawford - - - Alleghany - - - Giles - - - Columbia - - - Aguas Buenas - - - Orocovis - - - Ramsey - - - Uintah - - - Franklin - - - Kalawao - - - Atchison - - - Windham - - - New London - - - Clackamas - - - Shelby - - - Columbiana - - - Kings - - - Mendocino - - - Douglas - - - Kendall - - - Boone - - - Logan - - - Oneida - - - Macon - - - Essex - - - Bath - - - Boone - - - Fayette - - - Kanawha - - - Ceiba - - - Ciales - - - Rio Blanco - - - Morgan - - - LaSalle - - - Moniteau - - - Crawford - - - Rowan - - - Williamson - - - Sargent - - - Guánica - - - Lewis - - - Nez Perce - - - Jewell - - - Marshall - - - Nemaha - - - Adair - - - Clay - - - Oconee - - - Crawford - - - Kearny - - - Culebra - - - Marion - - - Yalobusha - - - Furnas - - - Cowlitz - - - Limestone - - - Calhoun - - - Citrus - - - Issaquena - - - Harrison - - - Morton - - - Spartanburg - - - Ottawa - - - Treasure - - - Dixon - - - Burnett - - - Dane - - - Assumption - - - Wayne - - - Otsego - - - Garvin - - - Hamilton - - - Madison - - - Susquehanna - - - Franklin - - - Gadsden - - - Gulf - - - Jefferson - - - Pinellas - - - Kiowa - - - Franklin - - - Pawnee - - - Johnston - - - Harrison - - - Covington - - - Wahkiakum - - - Clay - - - Schoolcraft - - - Douglas - - - Macon - - - Claiborne - - - Sonoma - - - McClain - - - Gage - - - Morris - - - Oklahoma - - - Hopkins - - - Montgomery - - - Osage - - - Santa Rosa - - - Seminole - - - Baker - - - Dade - - - Dougherty - - - Mitchell - - - Seminole - - - Payne - - - Pickett - - - Green - - - Rockwall - - - St. John - - - Hudspeth - - - Roane - - - McCreary - - - Wayne - - - Grant - - - Concordia - - - Smith - - - Franklin - - - Tensas - - - Wilkinson - - - Claiborne - - - Clarke - - - Faulk - - - Lawrence - - - Forrest - - - Lewis - - - Pittsylvania - - - Hampshire - - - Yuba - - - Yazoo - - - Potter - - - Hidalgo - - - Northampton - - - Lewis - - - Schley - - - Clayton - - - Chowan - - - Marshall - - - Broome - - - Schenectady - - - Brazos - - - Culpeper - - - Burleson - - - Harrison - - - Delta - - - Washington - - - Montour - - - Crockett - - - Volusia - - - Steuben - - - Racine - - - Hot Spring - - - Humboldt - - - Crawford - - - Yellow Medicine - - - Henry - - - Bullock - - - Merced - - - James City - - - Jackson - - - Gates - - - La Crosse - - - Taylor - - - Pasquotank - - - Fauquier - - - Orange - - - Chenango - - - Lynchburg - - - Coal - - - Hughes - - - Lee - - - Campbell - - - Pontotoc - - - Washoe - - - Sullivan - - - Cumberland - - - Lewis - - - Jefferson Davis - - - Logan - - - Russell - - - Sharp - - - Tulare - - - Allen - - - Jefferson - - - Putnam - - - Rockland - - - Fairfield - - - Howell - - - Guam - - - Robertson - - - Sacramento - - - Haskell - - - Latimer - - - Hancock - - - Lafayette - - - Atlantic - - - Twin Falls - - - Mills - - - Clinton - - - Stark - - - Shelby - - - Polk - - - Russell - - - Douglas - - - Republic - - - Solano - - - Baxter - - - Norfolk - - - Lea - - - Madison - - - Loving - - - Broomfield - - - McCurtain - - - Ohio - - - Graham - - - Cherokee - - - Dakota - - - Worcester - - - Butler - - - Bossier - - - Lee - - - Multnomah - - - Brunswick - - - Putnam - - - Halifax - - - Butte - - - Denver - - - Morehouse - - - Poquoson - - - Portsmouth - - - Boulder - - - Orleans - - - Jackson - - - Clarke - - - Marengo - - - Hale - - - Lamar - - - Pickens - - - Nemaha - - - Chesterfield - - - Sabine - - - Benzie - - - Cass - - - Coosa - - - Larimer - - - Davidson - - - Centre - - - Austin - - - Grand Isle - - - Suffolk - - - Crowley - - - Custer - - - Ouachita - - - Reagan - - - Stephens - - - Reynolds - - - Reeves - - - El Paso - - - Washington - - - Craig - - - Walker - - - Frederick - - - Stillwater - - - Washington - - - Wilson - - - Clearwater - - - Lafourche - - - Emmet - - - Warren - - - Tinian - - - Arecibo - - - Monroe - - - Lake - - - Missoula - - - Gilpin - - - Huerfano - - - Mingo - - - Morgan - - - Washington - - - Shelby - - - Vermillion - - - Burlington - - - Fillmore - - - Tarrant - - - Cook - - - Northern Islands - - - Chesapeake - - - Shiawassee - - - Tuscola - - - Bowman - - - Golden Valley - - - Eau Claire - - - Douglas - - - Blackford - - - Wells - - - Calhoun - - - Kankakee - - - Vanderburgh - - - Adams - - - Tolland - - - Jefferson - - - Pearl River - - - St. James - - - Duchesne - - - Hays - - - Juab - - - Northampton - - - Crenshaw - - - Bear Lake - - - Montgomery - - - Dale - - - San Francisco - - - Ouray - - - Pulaski - - - Randolph - - - White - - - Ashland - - - Muskogee - - - Terrebonne - - - Lincoln - - - Huron - - - Worth - - - Randolph - - - Honolulu - - - Millard - - - Sevier - - - Tooele - - - Monroe - - - Burke - - - Lee - - - San Patricio - - - Mariposa - - - Nodaway - - - Clay - - - Ketchikan Gateway - - - Yakutat - - - Adams - - - Cheyenne - - - Union - - - Vermilion - - - Clallam - - - Grays Harbor - - - St. Johns - - - Jefferson - - - Marin - - - Dinwiddie - - - Menard - - - Moffat - - - Franklin - - - Sutter - - - Jefferson - - - Curry - - - Columbia - - - Leflore - - - Union - - - Adams - - - Cape May - - - Clark - - - Leavenworth - - - Powhatan - - - Lincoln - - - Mason - - - San Juan - - - Monroe - - - Pitkin - - - Lassen - - - Jefferson - - - Prowers - - - Latah - - - Osceola - - - Wright - - - Upson - - - Deuel - - - Oldham - - - Walton - - - Washington - - - Essex - - - Wayne - - - St. Louis - - - Livingston - - - Autauga - - - Barbour - - - Mobile - - - Stevens - - - Whatcom - - - Berrien - - - Uinta - - - Greensville - - - Pecos - - - Rock Island - - - Preble - - - Putnam - - - San Juan - - - Real - - - Powell - - - Wheeler - - - Riverside - - - Ottawa - - - Naguabo - - - Alcona - - - Washakie - - - Dallas - - - Guayanilla - - - Whitley - - - Fayette - - - Osborne - - - Añasco - - - Mayagüez - - - Eastern - - - Bennington - - - Douglas - - - Nueces - - - Orleans - - - Grant - - - Columbia - - - Hanover - - - Red River - - - Ross - - - Dodge - - - Gwinnett - - - Dawson - - - Wallowa - - - Johnson - - - Jefferson - - - Clark - - - Dunklin - - - Clinton - - - Rockbridge - - - Perry - - - Clay - - - Jefferson - - - Glacier - - - Chittenden - - - Sioux - - - Coleman - - - Rusk - - - Scioto - - - Juneau - - - Lee - - - St. Francis - - - Milwaukee - - - Jackson - - - Mercer - - - Ashe - - - Wilkin - - - McIntosh - - - Washington - - - Thurston - - - Pershing - - - Orange - - - Door - - - Plumas - - - Seneca - - - Effingham - - - Sheridan - - - McCook - - - Oconto - - - Denali - - - Hudson - - - Fremont - - - Monroe - - - Fairfield - - - Columbia - - - Lafayette - - - Kings - - - Morgan - - - Swift - - - New Madrid - - - Green - - - Lander - - - Storey - - - Bernalillo - - - Lanier - - - Weston - - - Cattaraugus - - - San Juan - - - Trujillo Alto - - - Dallas - - - Terrell - - - Franklin - - - Williamson - - - Trumbull - - - Woodford - - - La Plata - - - Tuscarawas - - - Marshall - - - Pine - - - Ouachita - - - Lorain - - - Buncombe - - - Craighead - - - Chaves - - - Sioux - - - Dallas - - - Burke - - - McDowell - - - Snyder - - - Telfair - - - Sarasota - - - Elbert - - - Lowndes - - - Talbot - - - Columbus - - - Hardin - - - Hall - - - Adams - - - Houston - - - Tyler - - - Gilchrist - - - Scott - - - Attala - - - Pike - - - Mellette - - - Chautauqua - - - Spotsylvania - - - Oregon - - - Monmouth - - - Lawrence - - - Marquette - - - Pierce - - - Kauai - - - Clearfield - - - Clearwater - - - Irwin - - - Crow Wing - - - Rosebud - - - Wayne - - - Hendry - - - Lincoln - - - Long - - - Victoria - - - Clermont - - - Roberts - - - Oglala Lakota - - - Nicholas - - - Isabela - - - Las Marías - - - Quebradillas - - - Lares - - - Luquillo - - - Peñuelas - - - Strafford - - - Faulkner - - - Ste. Genevieve - - - Sarpy - - - Stafford - - - Stark - - - Franklin - - - Ward - - - Marion - - - Dakota - - - Delaware - - - Itasca - - - Iosco - - - Rice - - - Wyandotte - - - Webb - - - Wharton - - - Monroe - - - Oconee - - - Peach - - - Quitman - - - Coshocton - - - Randolph - - - Las Piedras - - - Putnam - - - Wyoming - - - Sussex - - - Bibb - - - Itawamba - - - Lewis - - - Sullivan - - - Pierce - - - Queens - - - Caswell - - - Ontonagon - - - Ascension - - - Highlands - - - Henderson - - - Cass - - - Madison - - - Indian River - - - Sebastian - - - Iroquois - - - Stewart - - - Cuyahoga - - - Jasper - - - Forsyth - - - Owyhee - - - Santa Clara - - - Rapides - - - Monroe - - - Philadelphia - - - Rockingham - - - Rensselaer - - - Gaston - - - Stoddard - - - Garden - - - Pike - - - Warren - - - Labette - - - Clarke - - - Delaware - - - St. Joseph - - - Tyrrell - - - Hinsdale - - - Kleberg - - - Carroll - - - Malheur - - - Calvert - - - Floyd - - - Harris - - - Newport News - - - Matanuska-Susitna - - - Hempstead - - - Tate - - - Richmond - - - Sheridan - - - Ulster - - - Davie - - - Hardeman - - - Stanley - - - Grundy - - - Franklin - - - Placer - - - Johnson - - - Litchfield - - - Geneva - - - Houston - - - Grayson - - - Kit Carson - - - Monona - - - Newton - - - Taliaferro - - - Harmon - - - Navarro - - - Toombs - - - St. Francois - - - Harding - - - Sweet Grass - - - Marion - - - Rutherford - - - Snohomish - - - Platte - - - Hamilton - - - Hickman - - - Montague - - - Carbon - - - Dickinson - - - Livingston - - - Yell - - - Madison - - - Troup - - - Manatee - - - Accomack - - - Twiggs - - - Queen Anne's - - - Hampshire - - - Henderson - - - Mayes - - - Prince George - - - Bronx - - - Clark - - - Hardin - - - Frio - - - Garland - - - Dundy - - - Butler - - - Grand - - - New Kent - - - Marion - - - Pondera - - - Carson City - - - Union - - - Anchorage - - - Vilas - - - Choctaw - - - Thayer - - - Paulding - - - White Pine - - - Harrison - - - Fayette - - - Hancock - - - Catahoula - - - Pendleton - - - Wythe - - - Big Horn - - - Ziebach - - - Dukes - - - Jackson - - - Newton - - - Lamar - - - Cass - - - Floyd - - - Rush - - - San Luis Obispo - - - Reno - - - Calhoun - - - Kanabec - - - Clinton - - - Logan - - - Clinton - - - Allen - - - Shawano - - - Sequoyah - - - Cumberland - - - Cleburne - - - Macomb - - - Genesee - - - Boone - - - McKenzie - - - Patrick - - - Alexander - - - Sevier - - - George - - - Union - - - Carroll - - - Turner - - - San Mateo - - - Bulloch - - - Jackson - - - San Miguel - - - Starr - - - Lumpkin - - - Morris - - - Frontier - - - Dunn - - - Stephens - - - Spalding - - - Fulton - - - Chickasaw - - - Parmer - - - Patillas - - - Butler - - - Essex - - - Guthrie - - - Elko - - - Madison - - - Mono - - - San Diego - - - Loup - - - Scotts Bluff - - - Adams - - - Hardin - - - Marion - - - Towns - - - Boone - - - Van Buren - - - Val Verde - - - Wilkinson - - - Lee - - - Tattnall - - - Kennebec - - - Winnebago - - - Dickinson - - - Natchitoches - - - Barceloneta - - - Grant - - - Franklin - - - Marion - - - Southampton - - - Trempealeau - - - Napa - - - Stone - - - Sherburne - - - El Paso - - - Berkeley - - - Logan - - - Coke - - - Jackson - - - Camden - - - Avery - - - Aleutians West - - - Kenai Peninsula - - - Duval - - - Washington - - - Clear Creek - - - Ozark - - - Kiowa - - - Cameron - - - Taney - - - Canadian - - - Johnson - - - Lake - - - Charlotte - - - Greene - - - Wakulla - - - Presque Isle - - - Will - - - Vieques - - - Raleigh - - - Carroll - - - Nye - - - Fond du Lac - - - Lee - - - Saratoga - - - St. Landry - - - Atoka - - - Fulton - - - Pittsburg - - - Athens - - - Wilcox - - - Fayette - - - Blount - - - Gordon - - - St. John the Baptist - - - Lackawanna - - - Roane - - - Gurabo - - - Campbell - - - Yauco - - - West Baton Rouge - - - Putnam - - - Taylor - - - Bingham - - - Ashland - - - Winona - - - Rockingham - - - Daniels - - - Upshur - - - Aguadilla - - - Carolina - - - Hatillo - - - Waller - - - Yabucoa - - - Spencer - - - Cheboygan - - - Dutchess - - - Park - - - Allen - - - Newton - - - Iberville - - - Wayne - - - Tillman - - - Cayuga - - - Rabun - - - Crittenden - - - Jackson - - - Bayamón - - - Cidra - - - Lawrence - - - Spencer - - - Thurston - - - Brookings - - - Grundy - - - Bee - - - Charles - - - Sullivan - - - Williamsburg - - - Titus - - - Camp - - - Moore - - - Bryan - - - Grimes - - - Leon - - - Clay - - - Holt - - - Erie - - - Washington - - - Haakon - - - Le Flore - - - Wayne - - - Prairie - - - Escambia - - - Laurens - - - Butler - - - Wasco - - - Cedar - - - Hillsborough - - - Screven - - - Burt - - - Somerset - - - Worcester - - - Burke - - - Porter - - - Henry - - - Cortland - - - Ada - - - Stark - - - Kidder - - - Smyth - - - Warren - - - Robertson - - - Nome - - - Scurry - - - Jim Wells - - - Jefferson - - - Cannon - - - Cass - - - Moca - - - Lincoln - - - Lincoln - - - Randolph - - - Washington - - - District of Columbia - - - Middlesex - - - Franklin - - - Alameda - - - Alexandria - - - Lincoln - - - Pender - - - Hartford - - - Lake - - - Platte - - - Haskell - - - Ector - - - Hickory - - - Brunswick - - - Floyd - - - Fairfax - - - Morrill - - - Walworth - - - Candler - - - Macon - - - Gove - - - Greene - - - Washington - - - Penobscot - - - Adams - - - Jackson - - - Colquitt - - - Washington - - - Sussex - - - Wabaunsee - - - Marshall - - - Morgan - - - Muhlenberg - - - Simpson - - - Catawba - - - Noble - - - Columbia - - - Jasper - - - Crawford - - - Beadle - - - Henry - - - Fayette - - - Fayette - - - Rains - - - Mercer - - - Eddy - - - Hanson - - - Miami - - - Parker - - - Young - - - Polk - - - Beauregard - - - Rich - - - Yakima - - - Ottawa - - - Calhoun - - - Colfax - - - Keya Paha - - - Hot Springs - - - Ballard - - - Angelina - - - Berkeley - - - Hamlin - - - Edgefield - - - Live Oak - - - Pope - - - Morgan - - - Hood River - - - Polk - - - Dawson - - - Monongalia - - - Haskell - - - Terry - - - Archer - - - Worth - - - Adair - - - Park - - - Orangeburg - - - Lake - - - Greenup - - - Habersham - - - Vinton - - - Wyandot - - - Big Horn - - - Franklin - - - Manassas - - - McMinn - - - McPherson - - - Seminole - - - Henderson - - - Addison - - - Cheyenne - - - Montgomery - - - Bosque - - - Wayne - - - Newberry - - - Hartley - - - Rusk - - - Prentiss - - - Cherokee - - - Meade - - - Collingsworth - - - Nottoway - - - Perry - - - Madison - - - Warren - - - McLeod - - - Somervell - - - Champaign - - - Miami-Dade - - - Jenkins - - - Dewey - - - Love - - - Bacon - - - Piscataquis - - - Lake - - - Colorado - - - Leslie - - - Yolo - - - Bradford - - - Mecklenburg - - - McLean - - - Washington - - - Clay - - - Freestone - - - Anne Arundel - - - McKean - - - Knox - - - Palo Alto - - - Macon - - - Noxubee - - - Lawrence - - - Lincoln - - - Harper - - - Tama - - - Lowndes - - - Dade - - - Borden - - - Buena Vista - - - Decatur - - - Canyon - - - Walthall - - - Cheshire - - - Linn - - - Roger Mills - - - Sauk - - - Avoyelles - - - Lawrence - - - Nash - - - Wheeler - - - Carter - - - Madison - - - Prince William - - - Camden - - - Foster - - - Russell - - - Delta - - - Washington - - - Guadalupe - - - Dearborn - - - Kenton - - - Lincoln - - - Benton - - - Lyon - - - Clark - - - Stanly - - - Bedford - - - Buckingham - - - Marion - - - Andrew - - - Tuscaloosa - - - Toa Alta - - - Hamblen - - - Benton - - - McIntosh - - - Culberson - - - Richmond - - - Calloway - - - Merrimack - - - Galveston - - - Banner - - - Grant - - - Salem - - - Tillamook - - - Washington - - - Lake of the Woods - - - Adams - - - Lake - - - Wilkes - - - Howard - - - Berks - - - Jackson - - - Manatí - - - Braxton - - - Mason - - - Berrien - - - Champaign - - - Augusta - - - Arkansas - - - Crawford - - - Daviess - - - Dare - - - Dawson - - - Lampasas - - - Taylor - - - Catoosa - - - Cobb - - - St. Martin - - - Tallahatchie - - - Dallas - - - Wilson - - - Benson - - - Lexington - - - Edwards - - - Chattooga - - - Harford - - - Marlboro - - - Riley - - - Allegan - - - Cole - - - Tulsa - - - Guadalupe - - - Caledonia - - - Jefferson - - - Adams - - - Lincoln - - - Island - - - Knox - - - Lyon - - - Elliott - - - Garrard - - - Letcher - - - Trimble - - - Monroe - - - Madison - - - Clinton - - - Broward - - - Seward - - - Cherokee - - - Desha - - - Caribou - - - Duplin - - - Barton - - - Washita - - - Eagle - - - Mahoning - - - Macon - - - Mercer - - - Fairfax - - - Oneida - - - Union - - - Barnwell - - - Wasatch - - - Leelanau - - - Hancock - - - Westmoreland - - - Tallapoosa - - - Cook - - - Keweenaw - - - Kemper - - - Paulding - - - Unicoi - - - Montgomery - - - Brooks - - - Logan - - - Morrow - - - Muskingum - - - Chatham - - - Clay - - - Sedgwick - - - Polk - - - Fannin - - - Hickman - - - Jackson - - - Muscogee - - - Whiteside - - - Brevard - - - Worth - - - Brantley - - - Caddo - - - Lincoln - - - Monroe - - - Monroe - - - Cherokee - - - Forest - - - Fayette - - - Genesee - - - Washington - - - Martin - - - Cimarron - - - Marion - - - Covington - - - Los Angeles - - - Hamilton - - - Collier - - - Montgomery - - - White - - - Barry - - - Oakland - - - Allamakee - - - Washington - - - Blaine - - - Lancaster - - - Baker - - - Winn - - - Marshall - - - Essex - - - Randolph - - - Toole - - - Franklin - - - Eaton - - - Sangamon - - - Barnstable - - - Sheridan - - - Roosevelt - - - Grant - - - York - - - Putnam - - - Stephens - - - Banks - - - Jasper - - - McPherson - - - Morrison - - - Wake - - - Washington - - - Clinton - - - Warren - - - Monroe - - - Lee - - - Baltimore - - - Hamilton - - - Frederick - - - Lauderdale - - - Delaware - - - Talladega - - - Calhoun - - - Chaffee - - - Moultrie - - - Panola - - - Granite - - - Montgomery - - - Huntingdon - - - Fort Bend - - - Crook - - - Bertie - - - Juneau - - - Marshall - - - Milam - - - Wexford - - - Rowan - - - Woodford - - - Harper - - - Winnebago - - - Christian - - - Alamance - - - Estill - - - Westmoreland - - - Saline - - - Day - - - Bexar - - - Bedford - - - Brown - - - Umatilla - - - Morgan - - - Roanoke - - - Fredericksburg - - - Spokane - - - Pleasants - - - Camuy - - - Beaver - - - Claiborne - - - Apache - - - Harris - - - Liberty - - - Hancock - - - Ashtabula - - - Glenn - - - Craig - - - Johnson - - - St. Charles - - - Cowley - - - West Carroll - - - Emmons - - - Ripley - - - Santa Cruz - - - Humboldt - - - McPherson - - - Whitman - - - Ferry - - - Terrell - - - Oglethorpe - - - Carbon - - - Laramie - - - Bartholomew - - - Grant - - - Erie - - - Mercer - - - Clay - - - Montgomery - - - Montgomery - - - Hennepin - - - Webster - - - LaPorte - - - Bourbon - - - Union - - - Virginia Beach - - - Brown - - - Fremont - - - Jones - - - Webster - - - Camden - - - Johnson - - - Mesa - - - Cascade - - - Butler - - - Dunn - - - Salt Lake - - - Denton - - - Charles Mix - - - Nelson - - - Coamo - - - Wells - - - Dorado - - - Peoria - - - Gloucester - - - Anoka - - - Brown - - - Major - - - Deuel - - - Skagway - - - Sullivan - - - Bristol - - - Knox - - - Carbon - - - Dauphin - - - Covington - - - Iowa - - - Van Buren - - - Bandera - - - Holmes - - - Sherman - - - Henry - - - Union - - - Hardy - - - Caddo - - - Jackson - - - Modoc - - - Alcorn - - - Bent - - - Monroe - - - Bullitt - - - Noble - - - Anderson - - - Nelson - - - Weber - - - Kane - - - Miller - - - Richland - - - Putnam - - - Jackson - - - Beaufort - - - Yates - - - Macon - - - Maverick - - - Traverse - - - Churchill - - - Campbell - - - Skamania - - - Wilcox - - - Fajardo - - - Rhea - - - Breathitt - - - Vernon - - - Escambia - - - Marion - - - Asotin - - - Butler - - - Cape Girardeau - - - Lee - - - Cullman - - - Coles - - - Carroll - - - Plaquemines - - - Hooker - - - Burleigh - - - Monroe - - - Cheatham - - - Bradford - - - Oldham - - - Newton - - - Grafton - - - Sheboygan - - - Smith - - - St. Tammany - - - Prince George's - - - Stearns - - - Middlesex - - - Franklin - - - Perry - - - Gasconade - - - Union - - - Jefferson - - - Rogers - - - Calhoun - - - Jackson - - - Rota - - - Salinas - - - Jackson - - - Kitsap - - - Hillsborough - - - DuPage - - - Passaic - - - Grayson - - - Treutlen - - - Webster - - - Keith - - - Adams - - - Ontario - - - Mason - - - Yavapai - + Mohave + Tangipahoa + Lincoln + Polk + Cass + Lawrence + Schoharie + Wrangell + Haralson + Bleckley + Lawrence + Jennings + Lapeer + Chickasaw + Crawford + Minnehaha + Turner + Walker + Santa Isabel + Aurora + Brooks + Caguas + Cataño + Morovis + Chase + Florida + Conejos + Washington + Norton + Ford + Deaf Smith + Sumter + Marinette + San Benito + Meriwether + Black Hawk + Hancock + Red Lake + Nance + Lebanon + Hockley + Shackelford + Tom Green + Wise + Lake + Hyde + Cottle + Santa Cruz + Wapello + Cedar + Garfield + St. Clair + Okaloosa + Todd + Aroostook + Allegany + Lauderdale + Dickey + Meeker + Bennett + Summit + Seneca + Greenwood + Lane + Newaygo + Clay + Orleans + Nelson + Blaine + Taylor + Armstrong + Hutchinson + Irion + Waushara + Scott + Sawyer + Isabella + Stone + Calhoun + Thomas + Mitchell + Jackson + Howard + Sanilac + Jay + Renville + Gilliam + McDonald + Yoakum + Childress + Douglas + Kusilvak + Warren + Comanche + Beckham + Buffalo + Gillespie + Dickens + La Salle + Tucker + Shasta + Saline + Manistee + Garfield + Custer + Miner + Clark + Cross + Archuleta + Glades + Gregory + Hansford + Pierce + Coweta + Clarke + Johnson + Marion + Isanti + Antelope + Medina + Sequatchie + Potter + Falls + Griggs + Douglas + Hamilton + Wayne + Slope + Runnels + Coconino + Benewah + Barber + Rock + Washington + Liberty + Marshall + Wayne + Bristol Bay + DeSoto + Bartow + Marshall + Edwards + Ogemaw + Howard + Hancock + Scott + Bledsoe + Rockingham + Hale + Waynesboro + Natrona + San Jacinto + Waupaca + Harrison + Decatur + Acadia + Carver + Hamilton + Kandiyohi + Manitowoc + Butler + Jones + Franklin + Noble + Thomas + Clare + Crawford + Webster + Arthur + Polk + Codington + Duval + Moore + Martin + Knox + Jayuya + Limestone + Delaware + Seward + Zavala + Sierra + Winnebago + York + Caroline + Montmorency + Richland + Beaver + Cochran + Gladwin + Washington + Buchanan + Webster + Ford + Oscoda + Neshoba + Phelps + Cuming + Greenville + Fisher + Franklin + Defiance + Giles + Baylor + Panola + Adams + Boone + Jack + Aibonito + Chase + Coryell + Clinton + Woodson + DeKalb + Ringgold + Shelby + Fresno + Union + Marshall + Piatt + Adams + Richland + Chester + Branch + Randolph + Wallace + Wayne + Emporia + Lipscomb + Trousdale + San Juan + Mahaska + Boundary + Logan + Franklin + Bienville + Amador + El Dorado + Izard + Buena Vista + Danville + Galax + Harrisonburg + Martinsville + Fulton + Adair + Monterey + Warren + Yadkin + Gratiot + Lee + Neosho + Ionia + Kalamazoo + McLean + Cottonwood + Lake + Mason + Mecosta + Muskegon + Freeborn + Fayette + Effingham + Benton + Donley + Douglas + Kingfisher + Gibson + Benton + Bamberg + Atascosa + Hutchinson + Butte + Hoonah-Angoon + Hand + Kingsbury + Lewis + Lincoln + Madison + Charlottesville + Golden Valley + Converse + Washington + Taylor + Park + Murray + Waukesha + Pipestone + King George + Beaverhead + Wheatland + Christian + Cooper + Cloud + Richmond + Crockett + Hendricks + Ness + Kendall + Starke + Shelby + Laclede + Livingston + Otsego + Hitchcock + Roscommon + Barton + Briscoe + Washtenaw + Barry + Luna + Scott + Coos + Towner + Newton + Petersburg + Stanton + Wayne + Menominee + Goliad + Ransom + Gray + Venango + Hall + Stone + Greene + Daviess + Scotland + Brown + Gaines + Bell + Pend Oreille + Tift + Sutton + Botetourt + San Augustine + San Lorenzo + Vega Alta + Carlton + Dixie + Morgan + Northwest Arctic + Billings + Aitkin + Garfield + Anderson + King + Custer + Marion + Knox + Barrow + LaSalle + Coffee + Martin + Hamilton + Hardin + Custer + Calhoun + Ida + Rio Grande + Marion + Morgan + Poweshiek + Tazewell + Elbert + Polk + Shelby + Madison + Summit + Hardee + Van Wert + Warren + Uvalde + Madison + Guernsey + Wilson + Delaware + Geauga + Greer + Rice + Cleveland + Dooly + Schleicher + Watonwan + Adams + Alexander + Cedar + Swisher + Lewis and Clark + Pettis + Motley + Ravalli + San Bernardino + McDuffie + Haines + Marathon + Aleutians East + Kodiak Island + Lake and Peninsula + Valdez-Cordova + Davison + Grant + Pickaway + Portage + Grady + Maricao + Pocahontas + Rincón + Otter Tail + Fannin + Pennington + Christian + Wabash + Montrose + Pike + McHenry + Van Buren + Scott + Bibb + Cayey + Midland + Ellis + Bottineau + Manu'a + Western + Allen + Jackson + Henry + Boone + Tehama + Miami + Logan + Cherokee + Lyman + Mahnomen + Clark + Scott + Roseau + Pope + Luce + Benton + Van Buren + York + Douglas + Flathead + Lynn + Dent + Menard + Nolan + Shannon + Sterling + Otero + Garza + Teller + Sanders + Callahan + Stonewall + Grady + Franklin + Van Zandt + Gosper + Fillmore + Hunt + Madison + Carter + Rappahannock + Morgan + Greene + Yukon-Koyukuk + Greene + Drew + Grenada + Radford + Sullivan + McDowell + Onslow + Clinton + Bay + Guaynabo + Canóvanas + Corozal + King + Chelan + Flagler + Kittitas + Orange + Pulaski + Amite + Edmunds + Grundy + Pratt + Cerro Gordo + Saunders + Saline + Portage + Crawford + Hood + Lyon + Fall River + Petroleum + Clinton + Barnes + Lamoille + Butts + Wood + Wright + Mason + Gregg + Oktibbeha + Nevada + Dawes + Josephine + Saline + Hemphill + Lamar + Jefferson Davis + Licking + Castro + Antrim + Phillips + Grant + Broadwater + Buffalo + Esmeralda + Orange + Jefferson + LaGrange + Jones + Carroll + Stutsman + Greene + Baldwin + Jackson + Hancock + Graham + Allen + Pushmataha + Upton + Potter + Harlan + Emmet + Cavalier + Tuolumne + Trego + Jim Hogg + Humacao + Menominee + Martin + Lowndes + Franklin + Shelby + Creek + Lavaca + Green Lake + Dawson + St. Joseph + Jefferson + Mitchell + Southeast Fairbanks + Putnam + Montgomery + Bremer + Marion + Cabarrus + Midland + Kimble + Richland + Carson + Edmonson + Franklin + Valley + Louisa + Palo Pinto + Lamb + Walton + Greene + Darke + Beltrami + Osceola + Elk + Hamilton + St. Louis + Washington + Eastland + Kerr + Allegany + Lubbock + Salem + Hopewell + Henry + Leake + Torrance + Phillips + Yuma + O'Brien + Scott + Valley + Iredell + Fayette + Decatur + Baker + Winston + Washington + Arroyo + Benton + Santa Barbara + Trinity + Macoupin + Saginaw + Erath + Pasco + Stokes + Gem + Gilmer + Alfalfa + Washington + Evans + Henry + Chester + La Paz + Blaine + Lemhi + Gray + Montgomery + Upshur + Blanco + Geary + Carroll + Marshall + Guilford + Falls Church + Lexington + Hillsdale + Wichita + Dodge + De Witt + Andrews + Sanborn + Le Sueur + Rock + Steele + Jefferson + Pocahontas + Nobles + Prince of Wales-Hyder + Todd + Atkinson + Sitka + Carroll + St. Lucie + Davis + McDonough + Sandusky + Wayne + Jeff Davis + Sibley + Knox + St. Clair + Arenac + Jasper + Clay + Idaho + Rolette + Sheridan + Llano + Pueblo + Curry + Winston + Kearney + Barranquitas + Wetzel + Miller + Alamosa + Kiowa + Hettinger + Olmsted + Juncos + Crawford + Osage + Grundy + Sherman + Sabana Grande + Audubon + Hancock + Little River + Washington + Pulaski + Lonoke + Baca + Cassia + Chilton + Crisp + Lyon + Cumberland + Pawnee + Wheeler + Steele + York + Kalkaska + Rooks + Cumberland + Webster + Tippah + Coffee + Saline + Quitman + LaMoure + Ellsworth + Greene + Adair + Holmes + Conway + Pulaski + Comerío + Greeley + Crosby + Graves + Monroe + Bond + Montgomery + Smith + Edgar + Cambria + Linn + Renville + Todd + Marion + Lancaster + Cleburne + Ben Hill + Maui + Pulaski + McMullen + Linn + Roberts + Keokuk + Hocking + Chattahoochee + Musselshell + Heard + Cook + Sac + Person + North Slope + Maunabo + Huntington + Iron + Kent + Pulaski + Caldwell + Jefferson + Hawaii + Garfield + Clay + Woodbury + Pottawattamie + Blaine + Waldo + Suffolk + Franklin + Bay + Lincoln + Bolivar + Alpena + Gogebic + Somerset + Warren + Oswego + Redwood + Lucas + Muscatine + Cotton + Mills + Nassau + Wibaux + Pemiscot + Marion + Grant + Loudoun + Perkins + Comal + Zapata + Aransas + Orange + Winkler + Appomattox + Grant + Doddridge + Randolph + Osceola + Owsley + Vance + Gila + Searcy + Monroe + Washington + Newton + Sumter + Decatur + Fayette + Jasper + Jackson + East Carroll + Vermilion + Evangeline + DeKalb + Franklin + Johnson + Wheeler + Sierra + Lenoir + Cleveland + Kimball + Wagoner + Cleveland + Murray + Allegheny + Union + Hughes + Whitley + Transylvania + Craven + Jones + Norton + Meigs + Gallia + Greenbrier + St. Thomas + Poinsett + Stanislaus + Colusa + DeKalb + White + Floyd + Gooding + Ogle + Richland + Edgecombe + Sherman + Chambers + Alpine + Siskiyou + Montezuma + Murray + Oneida + Posey + Hardin + Cameron + Miami + Boise + Bonneville + Plymouth + Pointe Coupee + Dickinson + Jasper + Stevens + Jo Daviess + Fulton + Monroe + Lake + Lake + Newport + Herkimer + Union + Chambers + Okanogan + St. Clair + Kenosha + Juana Díaz + Marquette + Price + Loíza + Shoshone + Caldwell + Oliver + Richardson + Red Willow + Hardin + Lauderdale + Benton + Bureau + Grant + Missaukee + Montcalm + Wright + Texas + Madison + Lincoln + De Baca + Pitt + Morton + Huron + Okmulgee + Florence + Saluda + Breckinridge + Union + Wayne + Shelby + Jones + Loudon + Hill + Henrico + Carroll + Walsh + Langlade + Chippewa + St. Mary + Cabo Rojo + Columbia + Harney + Williamson + Daggett + Kinney + Morgan + Franklin + Arapahoe + Walker + Parke + Scott + Warren + Red River + Brown + Montgomery + Mississippi + Fulton + DeKalb + Scott + Del Norte + Stephenson + Crawford + Floyd + Liberty + Jerome + Wicomico + Baraga + Lincoln + Cumberland + Ohio + New York + St. Lawrence + Jefferson + Choctaw + Pike + Des Moines + Roosevelt + Anderson + Custer + Shelby + Hunterdon + Henry + Hampton + Phillips + Jeff Davis + Lincoln + Greene + Howard + Highland + King William + Bayfield + Vernon + Boone + Doniphan + Sherman + Mineral + Houston + Calhoun + Cherokee + Yellowstone + Hall + Brown + Valencia + San Miguel + Forsyth + Wayne + Bladen + Meagher + Rockcastle + Greenwood + Hancock + Casey + Jessamine + Polk + Mitchell + Currituck + Montgomery + Richmond + Franklin + Naranjito + Jefferson + Johnson + Meigs + Brule + Ellis + Clay + Amherst + Mineral + Emanuel + Mason + Story + Plymouth + Sedgwick + Henry + St. Charles + Colbert + Pima + Greenlee + Woodruff + Palm Beach + Glynn + Appanoose + Dubuque + Cumberland + Iberia + Lawrence + St. Mary's + East Baton Rouge + Grant + Oceana + Otoe + McHenry + Smith + Kane + Otero + Perry + Knox + Erie + Charleston + York + Jasper + Orange + Windham + Hidalgo + Cibola + Mercer + Marshall + Montgomery + Etowah + Franklin + Bethel + Pennington + Spink + Union + Beaufort + Cocke + Bucks + Bon Homme + Dickson + Nowata + Kaufman + Foard + Hormigueros + Sagadahoc + Collin + Comanche + Concho + Crane + Eddy + Phelps + Logan + Ray + Inyo + Armstrong + Lincoln + Haywood + Grainger + Cameron + Clay + Carbon + Chesterfield + Dorchester + Chariton + Franklin + Elk + Mathews + Miller + Custer + Powder River + Hopkins + Alger + Johnson + Douglas + Knott + Harvey + St. Louis + Bedford + Brown + Nevada + Pike + Petersburg + Pike + Jersey + Clarendon + Hawkins + Henderson + Darlington + Chester + Dillon + Clarion + Florence + Forest + Charlton + Rio Arriba + De Soto + Durham + McKinley + Carroll + New Castle + Cheyenne + Appling + Elmore + Dolores + Kittson + Jasper + Georgetown + Fremont + Cass + Windsor + McLean + Greene + Massac + Dorchester + Kootenai + Middlesex + Elkhart + Greeley + Morgan + Knox + Decatur + Lawrence + Barbour + Berkshire + Callaway + Lac qui Parle + Goochland + Sublette + Cache + Lincoln + Alachua + Madison + Gonzales + Holt + Johnston + Mercer + Winneshiek + Haywood + Garrett + Preston + Houghton + Tipton + Ingham + Sumner + Lewis + Jefferson + Washington + Klickitat + Ralls + Albany + Albemarle + Lafayette + Maries + Osage + Waseca + Williams + Prince Edward + Kent + Schuyler + Montgomery + McNairy + Webster + New Hanover + Iron + Livingston + San Joaquin + McCracken + Hampton + Colfax + St. Croix + Gallatin + Perry + Elmore + Box Butte + Bristol + Wabash + Harlan + Maury + Calcasieu + Chatham + Dimmit + Magoffin + Davis + Piute + Martin + Houston + Clark + Ozaukee + Jefferson + Sevier + Guayama + Eureka + Lincoln + Union + Belknap + Bradley + Hayes + Northumberland + Talbot + Clay + Polk + Pottawatomie + Baltimore + Androscoggin + Sullivan + Union + Jackson + Utah + Summers + Sanpete + Dodge + Grant + Fulton + Pierce + Judith Basin + Lancaster + Caroline + Platte + Washington + Mississippi + Northampton + Sabine + Metcalfe + Pinal + Navajo + Yuma + Chisago + Dyer + Nicholas + Faribault + Perry + Bowie + Crook + Lee + Goshen + Norfolk + Larue + Fremont + Polk + Cherry + Rockdale + Imperial + Bonner + Fountain + Coffee + Warren + Pike + Powell + Ottawa + Sumner + Richmond + Brewster + Johnson + Polk + St. Croix + Dallam + Juniata + Lake + Wyoming + Jackson + Lawrence + Mercer + Luzerne + Camas + Johnson + Lucas + Woods + Woodward + Lincoln + Mercer + Socorro + Tippecanoe + Trigg + Scotland + Franklin + Gallatin + Greene + Calaveras + McCormick + Pickens + Fluvanna + Sumter + Northumberland + Fleming + Anderson + Teton + Taos + Kosciusko + Sioux + Clay + Cass + Oxford + Bath + Davidson + Cumberland + Blue Earth + Isle of Wight + Sweetwater + Mineral + Manassas Park + Columbia + Vega Baja + Dewey + Allendale + Greene + Clay + Crittenden + Anson + Fentress + Fulton + Boyd + Abbeville + Fayette + Morrow + Blair + Nantucket + Williamsburg + Nicollet + Wayne + Burnet + Deer Lodge + Silver Bow + Yankton + Jackson + Overton + Emery + Refugio + Ochiltree + San Juan + Independence + Camden + Pembina + Jackson + Lincoln + Obion + Aiken + Benton + Lane + King and Queen + Scott + Matagorda + Throckmorton + Washburn + Garfield + Douglas + Bristol + Traill + Jefferson + Lawrence + Colonial Heights + Anderson + Carlisle + Blount + Carroll + Henry + Hampden + Carroll + Caldwell + Rutland + Jefferson + Tazewell + Clarke + Villalba + Lafayette + Wilson + Edwards + Ramsey + Madison + Atchison + Halifax + Arlington + Skagit + Fallon + Surry + Walla Walla + Cherokee + Stevens + Chautauqua + Gentry + Warren + Monroe + Medina + Buchanan + Carter + Grand Traverse + Tishomingo + Catron + Somerset + Tompkins + Onondaga + Horry + Hill + Albany + Fulton + Pepin + Perry + Fairbanks North Star + Glascock + Glasscock + Teton + Jefferson + Delta + Clayton + Orange + Suffolk + Jefferson + Linn + Rutherford + Warren + Beaver + Washington + Calhoun + Greene + Brooke + Dillingham + Maricopa + Pike + Ripley + Kingman + Mitchell + Hodgeman + Morris + Mille Lacs + Lee + Lafayette + Copiah + Perry + Grand Forks + Delaware + Kent + Iowa + Dodge + Mineral + Prairie + Graham + Grand + Saguache + Okeechobee + Gilmer + Ware + Audrain + Los Alamos + Fergus + Rock + Mountrail + Henderson + Providence + Campbell + Kenedy + Livingston + Cabell + Butte + Summit + Hart + Warren + Owen + Dubois + Rush + Benton + Laurel + Stafford + Vernon + Livingston + Mower + Lamar + Humphreys + Pierce + Wolfe + Caldwell + Meade + Boyle + Yancey + Dallas + Pike + Conecuh + Perry + Pickens + Hancock + Webster + Madison + Martin + Finney + Jefferson + White + Pulaski + Brown + Caldwell + Johnson + Bollinger + Carter + Lancaster + Somerset + Wyoming + Schuyler + Logan + Union + Indiana + Hart + Ohio + Walworth + Jefferson + Harrison + Swain + Wood + Hertford + Liberty + Jackson + Pawnee + Coffey + Lafayette + Grant + Rankin + Hinds + Cumberland + Wilkes + Auglaize + Pottawatomie + McIntosh + Yamhill + Lehigh + Taylor + Barren + Travis + Montgomery + Howard + Wise + Winchester + Richland + Simpson + Boone + Chouteau + Hamilton + Santa Fe + Sampson + Okfuskee + Garfield + Menifee + Mora + Madison + Merrick + Deschutes + Humboldt + Tioga + Butler + Meade + Lincoln + Bell + Owen + Pamlico + Washington + Clay + Sheridan + Toa Baja + San Germán + Pike + Gallatin + Moore + Robeson + Bastrop + Trinity + Surry + Divide + Río Grande + Colleton + DeKalb + McLennan + Carteret + McCulloch + Williams + Brazoria + Belmont + Highland + Wood + Calumet + Mifflin + Ellis + Jones + Stewart + Bailey + Ponce + Jackson + Laurens + Harding + Wirt + Outagamie + Grant + Clatsop + Schuylkill + Lycoming + White + Buffalo + Saipan + Lajas + San Sebastián + Texas + Columbia + Corson + Houston + San Saba + Charles City + Page + Tripp + Presidio + Iron + Nacogdoches + Washington + Box Elder + Cooke + Wilbarger + Leon + Karnes + Bland + Sussex + Lunenburg + Calhoun + Buchanan + Mecklenburg + Bourbon + Minidoka + Alleghany + Amelia + Gloucester + Shenandoah + Dickenson + Utuado + Barron + Aguada + Pacific + Logan + Madera + Kewaunee + Montgomery + Gunnison + Brown + Echols + Harnett + Tioga + Hoke + Perquimans + Humphreys + Randall + Costilla + Weld + Whitfield + Bracken + Tipton + Russell + Lyon + Clark + Granville + Hyde + Sharkey + Adjuntas + Baldwin + Grayson + Pontotoc + Boyd + Staunton + Cass + Jerauld + Cochise + Polk + Fairfield + Ventura + Orange + Hernando + Bryan + Kossuth + Stanton + Las Animas + Madison + Charlotte + Gibson + Scott + Klamath + DeWitt + Choctaw + Sumter + Carroll + Kern + Lee + Routt + Union + Comanche + Daviess + St. Bernard + Bannock + Rawlins + Thomas + Early + Teton + Cecil + St. Clair + Phillips + Contra Costa + New Haven + Warrick + Clark + Lake + Campbell + East Feliciana + Suwannee + West Feliciana + Knox + Wayne + DeSoto + Howard + Perry + Lincoln + Hubbard + Cherokee + Big Stone + Kent + Payette + Steuben + Levy + Clinch + Cass + Marshall + Kent + Perkins + Ocean + Vigo + Chemung + Switzerland + Wadena + Niobrara + Bates + Nuckolls + Jefferson + Bergen + Westchester + Niagara + Watauga + Chippewa + Kay + Pope + Monroe + Sandoval + Clark + Charlevoix + Lenawee + Wabasha + Clay + Lincoln + Hardeman + Koochiching + Norman + Clark + Becker + Harrison + Coahoma + Quay + Middlesex + Pendleton + Ashley + Sunflower + Tunica + Putnam + Schuyler + Ritchie + Tyler + Floyd + McCone + Shawnee + DeKalb + Moody + St. Helena + Iron + Ward + Wichita + Willacy + Richland + Clark + Marion + Wood + Harrison + Valley + Essex + Carter + Robertson + Chicot + Hamilton + Howard + Marion + Montgomery + Madison + Chippewa + Mackinac + Nassau + Taylor + Bradley + Madison + Holmes + Weakley + Goodhue + Greene + Randolph + Doña Ana + Union + Sully + Carroll + Roanoke + Louisa + Page + Kershaw + Power + Coos + Douglas + Crawford + Alleghany + Giles + Columbia + Aguas Buenas + Orocovis + Ramsey + Uintah + Franklin + Kalawao + Atchison + Windham + New London + Clackamas + Shelby + Columbiana + Kings + Mendocino + Douglas + Kendall + Boone + Logan + Oneida + Macon + Essex + Bath + Boone + Fayette + Kanawha + Ceiba + Ciales + Rio Blanco + Morgan + LaSalle + Moniteau + Crawford + Rowan + Williamson + Sargent + Guánica + Lewis + Nez Perce + Jewell + Marshall + Nemaha + Adair + Clay + Oconee + Crawford + Kearny + Culebra + Marion + Yalobusha + Furnas + Cowlitz + Limestone + Calhoun + Citrus + Issaquena + Harrison + Morton + Spartanburg + Ottawa + Treasure + Dixon + Burnett + Dane + Assumption + Wayne + Otsego + Garvin + Hamilton + Madison + Susquehanna + Franklin + Gadsden + Gulf + Jefferson + Pinellas + Kiowa + Franklin + Pawnee + Johnston + Harrison + Covington + Wahkiakum + Clay + Schoolcraft + Douglas + Macon + Claiborne + Sonoma + McClain + Gage + Morris + Oklahoma + Hopkins + Montgomery + Osage + Santa Rosa + Seminole + Baker + Dade + Dougherty + Mitchell + Seminole + Payne + Pickett + Green + Rockwall + St. John + Hudspeth + Roane + McCreary + Wayne + Grant + Concordia + Smith + Franklin + Tensas + Wilkinson + Claiborne + Clarke + Faulk + Lawrence + Forrest + Lewis + Pittsylvania + Hampshire + Yuba + Yazoo + Potter + Hidalgo + Northampton + Lewis + Schley + Clayton + Chowan + Marshall + Broome + Schenectady + Brazos + Culpeper + Burleson + Harrison + Delta + Washington + Montour + Crockett + Volusia + Steuben + Racine + Hot Spring + Humboldt + Crawford + Yellow Medicine + Henry + Bullock + Merced + James City + Jackson + Gates + La Crosse + Taylor + Pasquotank + Fauquier + Orange + Chenango + Lynchburg + Coal + Hughes + Lee + Campbell + Pontotoc + Washoe + Sullivan + Cumberland + Lewis + Jefferson Davis + Logan + Russell + Sharp + Tulare + Allen + Jefferson + Putnam + Rockland + Fairfield + Howell + Guam + Robertson + Sacramento + Haskell + Latimer + Hancock + Lafayette + Atlantic + Twin Falls + Mills + Clinton + Stark + Shelby + Polk + Russell + Douglas + Republic + Solano + Baxter + Norfolk + Lea + Madison + Loving + Broomfield + McCurtain + Ohio + Graham + Cherokee + Dakota + Worcester + Butler + Bossier + Lee + Multnomah + Brunswick + Putnam + Halifax + Butte + Denver + Morehouse + Poquoson + Portsmouth + Boulder + Orleans + Jackson + Clarke + Marengo + Hale + Lamar + Pickens + Nemaha + Chesterfield + Sabine + Benzie + Cass + Coosa + Larimer + Davidson + Centre + Austin + Grand Isle + Suffolk + Crowley + Custer + Ouachita + Reagan + Stephens + Reynolds + Reeves + El Paso + Washington + Craig + Walker + Frederick + Stillwater + Washington + Wilson + Clearwater + Lafourche + Emmet + Warren + Tinian + Arecibo + Monroe + Lake + Missoula + Gilpin + Huerfano + Mingo + Morgan + Washington + Shelby + Vermillion + Burlington + Fillmore + Tarrant + Cook + Northern Islands + Chesapeake + Shiawassee + Tuscola + Bowman + Golden Valley + Eau Claire + Douglas + Blackford + Wells + Calhoun + Kankakee + Vanderburgh + Adams + Tolland + Jefferson + Pearl River + St. James + Duchesne + Hays + Juab + Northampton + Crenshaw + Bear Lake + Montgomery + Dale + San Francisco + Ouray + Pulaski + Randolph + White + Ashland + Muskogee + Terrebonne + Lincoln + Huron + Worth + Randolph + Honolulu + Millard + Sevier + Tooele + Monroe + Burke + Lee + San Patricio + Mariposa + Nodaway + Clay + Ketchikan Gateway + Yakutat + Adams + Cheyenne + Union + Vermilion + Clallam + Grays Harbor + St. Johns + Jefferson + Marin + Dinwiddie + Menard + Moffat + Franklin + Sutter + Jefferson + Curry + Columbia + Leflore + Union + Adams + Cape May + Clark + Leavenworth + Powhatan + Lincoln + Mason + San Juan + Monroe + Pitkin + Lassen + Jefferson + Prowers + Latah + Osceola + Wright + Upson + Deuel + Oldham + Walton + Washington + Essex + Wayne + St. Louis + Livingston + Autauga + Barbour + Mobile + Stevens + Whatcom + Berrien + Uinta + Greensville + Pecos + Rock Island + Preble + Putnam + San Juan + Real + Powell + Wheeler + Riverside + Ottawa + Naguabo + Alcona + Washakie + Dallas + Guayanilla + Whitley + Fayette + Osborne + Añasco + Mayagüez + Eastern + Bennington + Douglas + Nueces + Orleans + Grant + Columbia + Hanover + Red River + Ross + Dodge + Gwinnett + Dawson + Wallowa + Johnson + Jefferson + Clark + Dunklin + Clinton + Rockbridge + Perry + Clay + Jefferson + Glacier + Chittenden + Sioux + Coleman + Rusk + Scioto + Juneau + Lee + St. Francis + Milwaukee + Jackson + Mercer + Ashe + Wilkin + McIntosh + Washington + Thurston + Pershing + Orange + Door + Plumas + Seneca + Effingham + Sheridan + McCook + Oconto + Denali + Hudson + Fremont + Monroe + Fairfield + Columbia + Lafayette + Kings + Morgan + Swift + New Madrid + Green + Lander + Storey + Bernalillo + Lanier + Weston + Cattaraugus + San Juan + Trujillo Alto + Dallas + Terrell + Franklin + Williamson + Trumbull + Woodford + La Plata + Tuscarawas + Marshall + Pine + Ouachita + Lorain + Buncombe + Craighead + Chaves + Sioux + Dallas + Burke + McDowell + Snyder + Telfair + Sarasota + Elbert + Lowndes + Talbot + Columbus + Hardin + Hall + Adams + Houston + Tyler + Gilchrist + Scott + Attala + Pike + Mellette + Chautauqua + Spotsylvania + Oregon + Monmouth + Lawrence + Marquette + Pierce + Kauai + Clearfield + Clearwater + Irwin + Crow Wing + Rosebud + Wayne + Hendry + Lincoln + Long + Victoria + Clermont + Roberts + Oglala Lakota + Nicholas + Isabela + Las Marías + Quebradillas + Lares + Luquillo + Peñuelas + Strafford + Faulkner + Ste. Genevieve + Sarpy + Stafford + Stark + Franklin + Ward + Marion + Dakota + Delaware + Itasca + Iosco + Rice + Wyandotte + Webb + Wharton + Monroe + Oconee + Peach + Quitman + Coshocton + Randolph + Las Piedras + Putnam + Wyoming + Sussex + Bibb + Itawamba + Lewis + Sullivan + Pierce + Queens + Caswell + Ontonagon + Ascension + Highlands + Henderson + Cass + Madison + Indian River + Sebastian + Iroquois + Stewart + Cuyahoga + Jasper + Forsyth + Owyhee + Santa Clara + Rapides + Monroe + Philadelphia + Rockingham + Rensselaer + Gaston + Stoddard + Garden + Pike + Warren + Labette + Clarke + Delaware + St. Joseph + Tyrrell + Hinsdale + Kleberg + Carroll + Malheur + Calvert + Floyd + Harris + Newport News + Matanuska-Susitna + Hempstead + Tate + Richmond + Sheridan + Ulster + Davie + Hardeman + Stanley + Grundy + Franklin + Placer + Johnson + Litchfield + Geneva + Houston + Grayson + Kit Carson + Monona + Newton + Taliaferro + Harmon + Navarro + Toombs + St. Francois + Harding + Sweet Grass + Marion + Rutherford + Snohomish + Platte + Hamilton + Hickman + Montague + Carbon + Dickinson + Livingston + Yell + Madison + Troup + Manatee + Accomack + Twiggs + Queen Anne's + Hampshire + Henderson + Mayes + Prince George + Bronx + Clark + Hardin + Frio + Garland + Dundy + Butler + Grand + New Kent + Marion + Pondera + Carson City + Union + Anchorage + Vilas + Choctaw + Thayer + Paulding + White Pine + Harrison + Fayette + Hancock + Catahoula + Pendleton + Wythe + Big Horn + Ziebach + Dukes + Jackson + Newton + Lamar + Cass + Floyd + Rush + San Luis Obispo + Reno + Calhoun + Kanabec + Clinton + Logan + Clinton + Allen + Shawano + Sequoyah + Cumberland + Cleburne + Macomb + Genesee + Boone + McKenzie + Patrick + Alexander + Sevier + George + Union + Carroll + Turner + San Mateo + Bulloch + Jackson + San Miguel + Starr + Lumpkin + Morris + Frontier + Dunn + Stephens + Spalding + Fulton + Chickasaw + Parmer + Patillas + Butler + Essex + Guthrie + Elko + Madison + Mono + San Diego + Loup + Scotts Bluff + Adams + Hardin + Marion + Towns + Boone + Van Buren + Val Verde + Wilkinson + Lee + Tattnall + Kennebec + Winnebago + Dickinson + Natchitoches + Barceloneta + Grant + Franklin + Marion + Southampton + Trempealeau + Napa + Stone + Sherburne + El Paso + Berkeley + Logan + Coke + Jackson + Camden + Avery + Aleutians West + Kenai Peninsula + Duval + Washington + Clear Creek + Ozark + Kiowa + Cameron + Taney + Canadian + Johnson + Lake + Charlotte + Greene + Wakulla + Presque Isle + Will + Vieques + Raleigh + Carroll + Nye + Fond du Lac + Lee + Saratoga + St. Landry + Atoka + Fulton + Pittsburg + Athens + Wilcox + Fayette + Blount + Gordon + St. John the Baptist + Lackawanna + Roane + Gurabo + Campbell + Yauco + West Baton Rouge + Putnam + Taylor + Bingham + Ashland + Winona + Rockingham + Daniels + Upshur + Aguadilla + Carolina + Hatillo + Waller + Yabucoa + Spencer + Cheboygan + Dutchess + Park + Allen + Newton + Iberville + Wayne + Tillman + Cayuga + Rabun + Crittenden + Jackson + Bayamón + Cidra + Lawrence + Spencer + Thurston + Brookings + Grundy + Bee + Charles + Sullivan + Williamsburg + Titus + Camp + Moore + Bryan + Grimes + Leon + Clay + Holt + Erie + Washington + Haakon + Le Flore + Wayne + Prairie + Escambia + Laurens + Butler + Wasco + Cedar + Hillsborough + Screven + Burt + Somerset + Worcester + Burke + Porter + Henry + Cortland + Ada + Stark + Kidder + Smyth + Warren + Robertson + Nome + Scurry + Jim Wells + Jefferson + Cannon + Cass + Moca + Lincoln + Lincoln + Randolph + Washington + District of Columbia + Middlesex + Franklin + Alameda + Alexandria + Lincoln + Pender + Hartford + Lake + Platte + Haskell + Ector + Hickory + Brunswick + Floyd + Fairfax + Morrill + Walworth + Candler + Macon + Gove + Greene + Washington + Penobscot + Adams + Jackson + Colquitt + Washington + Sussex + Wabaunsee + Marshall + Morgan + Muhlenberg + Simpson + Catawba + Noble + Columbia + Jasper + Crawford + Beadle + Henry + Fayette + Fayette + Rains + Mercer + Eddy + Hanson + Miami + Parker + Young + Polk + Beauregard + Rich + Yakima + Ottawa + Calhoun + Colfax + Keya Paha + Hot Springs + Ballard + Angelina + Berkeley + Hamlin + Edgefield + Live Oak + Pope + Morgan + Hood River + Polk + Dawson + Monongalia + Haskell + Terry + Archer + Worth + Adair + Park + Orangeburg + Lake + Greenup + Habersham + Vinton + Wyandot + Big Horn + Franklin + Manassas + McMinn + McPherson + Seminole + Henderson + Addison + Cheyenne + Montgomery + Bosque + Wayne + Newberry + Hartley + Rusk + Prentiss + Cherokee + Meade + Collingsworth + Nottoway + Perry + Madison + Warren + McLeod + Somervell + Champaign + Miami-Dade + Jenkins + Dewey + Love + Bacon + Piscataquis + Lake + Colorado + Leslie + Yolo + Bradford + Mecklenburg + McLean + Washington + Clay + Freestone + Anne Arundel + McKean + Knox + Palo Alto + Macon + Noxubee + Lawrence + Lincoln + Harper + Tama + Lowndes + Dade + Borden + Buena Vista + Decatur + Canyon + Walthall + Cheshire + Linn + Roger Mills + Sauk + Avoyelles + Lawrence + Nash + Wheeler + Carter + Madison + Prince William + Camden + Foster + Russell + Delta + Washington + Guadalupe + Dearborn + Kenton + Lincoln + Benton + Lyon + Clark + Stanly + Bedford + Buckingham + Marion + Andrew + Tuscaloosa + Toa Alta + Hamblen + Benton + McIntosh + Culberson + Richmond + Calloway + Merrimack + Galveston + Banner + Grant + Salem + Tillamook + Washington + Lake of the Woods + Adams + Lake + Wilkes + Howard + Berks + Jackson + Manatí + Braxton + Mason + Berrien + Champaign + Augusta + Arkansas + Crawford + Daviess + Dare + Dawson + Lampasas + Taylor + Catoosa + Cobb + St. Martin + Tallahatchie + Dallas + Wilson + Benson + Lexington + Edwards + Chattooga + Harford + Marlboro + Riley + Allegan + Cole + Tulsa + Guadalupe + Caledonia + Jefferson + Adams + Lincoln + Island + Knox + Lyon + Elliott + Garrard + Letcher + Trimble + Monroe + Madison + Clinton + Broward + Seward + Cherokee + Desha + Caribou + Duplin + Barton + Washita + Eagle + Mahoning + Macon + Mercer + Fairfax + Oneida + Union + Barnwell + Wasatch + Leelanau + Hancock + Westmoreland + Tallapoosa + Cook + Keweenaw + Kemper + Paulding + Unicoi + Montgomery + Brooks + Logan + Morrow + Muskingum + Chatham + Clay + Sedgwick + Polk + Fannin + Hickman + Jackson + Muscogee + Whiteside + Brevard + Worth + Brantley + Caddo + Lincoln + Monroe + Monroe + Cherokee + Forest + Fayette + Genesee + Washington + Martin + Cimarron + Marion + Covington + Los Angeles + Hamilton + Collier + Montgomery + White + Barry + Oakland + Allamakee + Washington + Blaine + Lancaster + Baker + Winn + Marshall + Essex + Randolph + Toole + Franklin + Eaton + Sangamon + Barnstable + Sheridan + Roosevelt + Grant + York + Putnam + Stephens + Banks + Jasper + McPherson + Morrison + Wake + Washington + Clinton + Warren + Monroe + Lee + Baltimore + Hamilton + Frederick + Lauderdale + Delaware + Talladega + Calhoun + Chaffee + Moultrie + Panola + Granite + Montgomery + Huntingdon + Fort Bend + Crook + Bertie + Juneau + Marshall + Milam + Wexford + Rowan + Woodford + Harper + Winnebago + Christian + Alamance + Estill + Westmoreland + Saline + Day + Bexar + Bedford + Brown + Umatilla + Morgan + Roanoke + Fredericksburg + Spokane + Pleasants + Camuy + Beaver + Claiborne + Apache + Harris + Liberty + Hancock + Ashtabula + Glenn + Craig + Johnson + St. Charles + Cowley + West Carroll + Emmons + Ripley + Santa Cruz + Humboldt + McPherson + Whitman + Ferry + Terrell + Oglethorpe + Carbon + Laramie + Bartholomew + Grant + Erie + Mercer + Clay + Montgomery + Montgomery + Hennepin + Webster + LaPorte + Bourbon + Union + Virginia Beach + Brown + Fremont + Jones + Webster + Camden + Johnson + Mesa + Cascade + Butler + Dunn + Salt Lake + Denton + Charles Mix + Nelson + Coamo + Wells + Dorado + Peoria + Gloucester + Anoka + Brown + Major + Deuel + Skagway + Sullivan + Bristol + Knox + Carbon + Dauphin + Covington + Iowa + Van Buren + Bandera + Holmes + Sherman + Henry + Union + Hardy + Caddo + Jackson + Modoc + Alcorn + Bent + Monroe + Bullitt + Noble + Anderson + Nelson + Weber + Kane + Miller + Richland + Putnam + Jackson + Beaufort + Yates + Macon + Maverick + Traverse + Churchill + Campbell + Skamania + Wilcox + Fajardo + Rhea + Breathitt + Vernon + Escambia + Marion + Asotin + Butler + Cape Girardeau + Lee + Cullman + Coles + Carroll + Plaquemines + Hooker + Burleigh + Monroe + Cheatham + Bradford + Oldham + Newton + Grafton + Sheboygan + Smith + St. Tammany + Prince George's + Stearns + Middlesex + Franklin + Perry + Gasconade + Union + Jefferson + Rogers + Calhoun + Jackson + Rota + Salinas + Jackson + Kitsap + Hillsborough + DuPage + Passaic + Grayson + Treutlen + Webster + Keith + Adams + Ontario + Mason + Yavapai diff --git a/test/output/usPopulationStateAge.svg b/test/output/usPopulationStateAge.svg index 14615c67e9..cdb2455f48 100644 --- a/test/output/usPopulationStateAge.svg +++ b/test/output/usPopulationStateAge.svg @@ -13,89 +13,83 @@ white-space: pre; } - - - - <10 - - - - 10-19 - - - - 20-29 - - - - 30-39 - - - - 40-49 - - - - 50-59 - - - - 60-69 - - - - 70-79 - - - - ≥80 - Age + + + + + + + + + + - - - - 0 - - - - 2 - - - - 4 - - - - 6 - - - - 8 - - - - 10 - - - - 12 - - - - 14 - - - - 16 - - - - 18 - - - - 20 - Percent (%) → + + + + + + + + + + + + + <10 + 10-19 + 20-29 + 30-39 + 40-49 + 50-59 + 60-69 + 70-79 + ≥80 + + + Age + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 0 + 2 + 4 + 6 + 8 + 10 + 12 + 14 + 16 + 18 + 20 + + + Percent (%) → diff --git a/test/output/usPopulationStateAgeDots.svg b/test/output/usPopulationStateAgeDots.svg index d08a543926..2525e76f90 100644 --- a/test/output/usPopulationStateAgeDots.svg +++ b/test/output/usPopulationStateAgeDots.svg @@ -13,51 +13,47 @@ white-space: pre; } - - - - 0 - - - - 2 - - - - 4 - - - - 6 - - - - 8 - - - - 10 - - - - 12 - - - - 14 - - - - 16 - - - - 18 - - - - 20 - Percent (%) → + + + + + + + + + + + + + + + + + + + + + + + + + + + + 0 + 2 + 4 + 6 + 8 + 10 + 12 + 14 + 16 + 18 + 20 + + + Percent (%) → @@ -586,5 +582,58 @@ - ALAKAZARCACOCTDEDCFLGAHIIDILINIAKSKYLAMEMDMAMIMNMSMOMTNENVNHNJNMNYNCNDOHOKORPARISCSDTNTXUTVTVAWAWVWIWYPR + + AL + AK + AZ + AR + CA + CO + CT + DE + DC + FL + GA + HI + ID + IL + IN + IA + KS + KY + LA + ME + MD + MA + MI + MN + MS + MO + MT + NE + NV + NH + NJ + NM + NY + NC + ND + OH + OK + OR + PA + RI + SC + SD + TN + TX + UT + VT + VA + WA + WV + WI + WY + PR + \ No newline at end of file diff --git a/test/output/usPresidentFavorabilityDots.svg b/test/output/usPresidentFavorabilityDots.svg index 73356d1bf3..bc0459f214 100644 --- a/test/output/usPresidentFavorabilityDots.svg +++ b/test/output/usPresidentFavorabilityDots.svg @@ -13,228 +13,127 @@ white-space: pre; } - - - - −30 - - - - −20 - - - - −10 - - - - +0 - - - - +10 - - - - +20 - - - - +30 - - - - +40 - - - - +50 - - - - +60 - - - - +70 - Net favorability (%) + + + + + + + + + + + + + + + + + + + + + + + + + + + + −30 + −20 + −10 + +0 + +10 + +20 + +30 + +40 + +50 + +60 + +70 + + + Net favorability (%) + + + + + + + + + + + + + + + + + 1800 + 1820 + 1840 + 1860 + 1880 + 1900 + 1920 + 1940 + 1960 + 1980 + 2000 + 2020 - - - 1800 - - - 1820 - - - 1840 - - - 1860 - - - 1880 - - - 1900 - - - 1920 - - - 1940 - - - 1960 - - - 1980 - - - 2000 - - - 2020 - Date of first inauguration + + Date of first inauguration - - George Washington - - - John Adams - - - Thomas Jefferson - - - James Madison - - - James Monroe - - - John Quincy Adams - - - Andrew Jackson - - - Martin Van Buren - - - William Henry Harrison - - - John Tyler - - - James K. Polk - - - Zachary Taylor - - - Millard Fillmore - - - Franklin Pierce - - - James Buchanan - - - Abraham Lincoln - - - Andrew Johnson - - - Ulysses S. Grant - - - Rutherford B. Hayes - - - James A. Garfield - - - Chester A. Arthur - - - Grover Cleveland - - - Benjamin Harrison - - - William McKinley - - - Theodore Roosevelt - - - William Howard Taft - - - Woodrow Wilson - - - Warren G. Harding - - - Calvin Coolidge - - - Herbert Hoover - - - Franklin D. Roosevelt - - - Harry S. Truman - - - Dwight D. Eisenhower - - - John F. Kennedy - - - Lyndon B. Johnson - - - Richard Nixon - - - Gerald Ford - - - Jimmy Carter - - - Ronald Reagan - - - George H. W. Bush - - - Bill Clinton - - - George W. Bush - - - Barack Obama - - - Donald Trump - - - Joe Biden - + George Washington + John Adams + Thomas Jefferson + James Madison + James Monroe + John Quincy Adams + Andrew Jackson + Martin Van Buren + William Henry Harrison + John Tyler + James K. Polk + Zachary Taylor + Millard Fillmore + Franklin Pierce + James Buchanan + Abraham Lincoln + Andrew Johnson + Ulysses S. Grant + Rutherford B. Hayes + James A. Garfield + Chester A. Arthur + Grover Cleveland + Benjamin Harrison + William McKinley + Theodore Roosevelt + William Howard Taft + Woodrow Wilson + Warren G. Harding + Calvin Coolidge + Herbert Hoover + Franklin D. Roosevelt + Harry S. Truman + Dwight D. Eisenhower + John F. Kennedy + Lyndon B. Johnson + Richard Nixon + Gerald Ford + Jimmy Carter + Ronald Reagan + George H. W. Bush + Bill Clinton + George W. Bush + Barack Obama + Donald Trump + Joe Biden \ No newline at end of file diff --git a/test/output/usPresidentGallery.svg b/test/output/usPresidentGallery.svg index 1e67c39f84..fcb356b1c0 100644 --- a/test/output/usPresidentGallery.svg +++ b/test/output/usPresidentGallery.svg @@ -13,316 +13,129 @@ white-space: pre; } - - - 1800 - - - 1820 - - - 1840 - - - 1860 - - - 1880 - - - 1900 - - - 1920 - - - 1940 - - - 1960 - - - 1980 - - - 2000 - - - 2020 - First Inauguration Date → + + + + + + + + + + + + + + + + 1800 + 1820 + 1840 + 1860 + 1880 + 1900 + 1920 + 1940 + 1960 + 1980 + 2000 + 2020 + + + First Inauguration Date → - - Millard Fillmore - - - James K. Polk - - - Grover Cleveland - - - Herbert Hoover - - - Richard Nixon - - - John Tyler - - - Ulysses S. Grant - - - Chester A. Arthur - - - Ronald Reagan - - - James Buchanan - - - Theodore Roosevelt - - - Thomas Jefferson - - - Calvin Coolidge - - - Lyndon B. Johnson - - - William Henry Harrison - - - Andrew Johnson - - - Joe Biden - - - Jimmy Carter - - - Andrew Jackson - - - Franklin Pierce - - - James A. Garfield - - - Bill Clinton - - - Woodrow Wilson - - - William McKinley - - - Barack Obama - - - Dwight D. Eisenhower - - - John Adams - - - James Monroe - - - Martin Van Buren - - - Abraham Lincoln - - - Benjamin Harrison - - - George W. Bush - - - Warren G. Harding - - - Harry S. Truman - - - George Washington - - - James Madison - - - John Quincy Adams - - - Zachary Taylor - - - Rutherford B. Hayes - - - William Howard Taft - - - Franklin D. Roosevelt - - - John F. Kennedy - - - Gerald Ford - - - George H. W. Bush - - - Donald Trump - + Millard Fillmore + James K. Polk + Grover Cleveland + Herbert Hoover + Richard Nixon + John Tyler + Ulysses S. Grant + Chester A. Arthur + Ronald Reagan + James Buchanan + Theodore Roosevelt + Thomas Jefferson + Calvin Coolidge + Lyndon B. Johnson + William Henry Harrison + Andrew Johnson + Joe Biden + Jimmy Carter + Andrew Jackson + Franklin Pierce + James A. Garfield + Bill Clinton + Woodrow Wilson + William McKinley + Barack Obama + Dwight D. Eisenhower + John Adams + James Monroe + Martin Van Buren + Abraham Lincoln + Benjamin Harrison + George W. Bush + Warren G. Harding + Harry S. Truman + George Washington + James Madison + John Quincy Adams + Zachary Taylor + Rutherford B. Hayes + William Howard Taft + Franklin D. Roosevelt + John F. Kennedy + Gerald Ford + George H. W. Bush + Donald Trump - - Millard Fillmore - - - James K. Polk - - - Grover Cleveland - - - Herbert Hoover - - - Richard Nixon - - - John Tyler - - - Ulysses S. Grant - - - Chester A. Arthur - - - Ronald Reagan - - - James Buchanan - - - Theodore Roosevelt - - - Thomas Jefferson - - - Calvin Coolidge - - - Lyndon B. Johnson - - - William Henry Harrison - - - Andrew Johnson - - - Joe Biden - - - Jimmy Carter - - - Andrew Jackson - - - Franklin Pierce - - - James A. Garfield - - - Bill Clinton - - - Woodrow Wilson - - - William McKinley - - - Barack Obama - - - Dwight D. Eisenhower - - - John Adams - - - James Monroe - - - Martin Van Buren - - - Abraham Lincoln - - - Benjamin Harrison - - - George W. Bush - - - Warren G. Harding - - - Harry S. Truman - - - George Washington - - - James Madison - - - John Quincy Adams - - - Zachary Taylor - - - Rutherford B. Hayes - - - William Howard Taft - - - Franklin D. Roosevelt - - - John F. Kennedy - - - Gerald Ford - - - George H. W. Bush - - - Donald Trump - + Millard Fillmore + James K. Polk + Grover Cleveland + Herbert Hoover + Richard Nixon + John Tyler + Ulysses S. Grant + Chester A. Arthur + Ronald Reagan + James Buchanan + Theodore Roosevelt + Thomas Jefferson + Calvin Coolidge + Lyndon B. Johnson + William Henry Harrison + Andrew Johnson + Joe Biden + Jimmy Carter + Andrew Jackson + Franklin Pierce + James A. Garfield + Bill Clinton + Woodrow Wilson + William McKinley + Barack Obama + Dwight D. Eisenhower + John Adams + James Monroe + Martin Van Buren + Abraham Lincoln + Benjamin Harrison + George W. Bush + Warren G. Harding + Harry S. Truman + George Washington + James Madison + John Quincy Adams + Zachary Taylor + Rutherford B. Hayes + William Howard Taft + Franklin D. Roosevelt + John F. Kennedy + Gerald Ford + George H. W. Bush + Donald Trump \ No newline at end of file diff --git a/test/output/usPresidentialElection2020.svg b/test/output/usPresidentialElection2020.svg index 2f4141f117..55e4498892 100644 --- a/test/output/usPresidentialElection2020.svg +++ b/test/output/usPresidentialElection2020.svg @@ -13,16011 +13,9657 @@ white-space: pre; } - - - - - - - - - - - - - - - - 100 - - - - 200 - - - - 300 - - - - - - - - - - - - - - - - - - - - - - - - - - - - 1k - - - - 2k - - - - 3k - - - - - - - - - - - - - - - - - - - - - - - - - - - - 10k - - - - 20k - - - - 30k - - - - - - - - - - - - - - - - - - - - - - - - - - - - 100k - - - - 200k - - - - 300k - - - - - - - - - - - - - - - - - - - - - - - - - - - - 1M - - - - 2M - - - - 3M - - - - - ↑ Total number of votes + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - −80 - - - - −60 - - - - −40 - - - - −20 - - - - +0 - - - - +20 - - - - +40 - - - - +60 - - - - +80 - ← Biden · Vote margin (%) · Trump → + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 100 + 200 + 300 + + + + + + + 1k + 2k + 3k + + + + + + + 10k + 20k + 30k + + + + + + + 100k + 200k + 300k + + + + + + + 1M + 2M + 3M + + + + ↑ Total number of votes + + + + + + + + + + + + + + + + + + + + + + + + + −80 + −60 + −40 + −20 + +0 + +20 + +40 + +60 + +80 + + + ← Biden · Vote margin (%) · Trump → - - ED 1, Alaska + <circle cx="488.8705694699327" cy="358.38898977936" r="3" fill="rgb(242, 239, 237)"><title>ED 1, Alaska 3,429 votes for Trump - 3,401 votes for Biden - - - ED 10, Alaska + 3,401 votes for Biden + ED 10, Alaska 7,813 votes for Trump - 2,680 votes for Biden - - - ED 11, Alaska + 2,680 votes for Biden + ED 11, Alaska 6,968 votes for Trump - 3,084 votes for Biden - - - ED 12, Alaska + 3,084 votes for Biden + ED 12, Alaska 7,707 votes for Trump - 2,887 votes for Biden - - - ED 13, Alaska + 2,887 votes for Biden + ED 13, Alaska 4,557 votes for Trump - 2,607 votes for Biden - - - ED 14, Alaska + 2,607 votes for Biden + ED 14, Alaska 6,632 votes for Trump - 4,211 votes for Biden - - - ED 15, Alaska + 4,211 votes for Biden + ED 15, Alaska 2,602 votes for Trump - 2,542 votes for Biden - - - ED 16, Alaska + 2,542 votes for Biden + ED 16, Alaska 4,189 votes for Biden - 3,460 votes for Trump - - - ED 17, Alaska + 3,460 votes for Trump + ED 17, Alaska 3,982 votes for Biden - 2,693 votes for Trump - - - ED 18, Alaska + 2,693 votes for Trump + ED 18, Alaska 4,567 votes for Biden - 2,678 votes for Trump - - - ED 19, Alaska + 2,678 votes for Trump + ED 19, Alaska 3,056 votes for Biden - 1,928 votes for Trump - - - ED 2, Alaska + 1,928 votes for Trump + ED 2, Alaska 3,596 votes for Trump - 2,073 votes for Biden - - - ED 20, Alaska + 2,073 votes for Biden + ED 20, Alaska 4,727 votes for Biden - 2,277 votes for Trump - - - ED 21, Alaska + 2,277 votes for Trump + ED 21, Alaska 5,343 votes for Biden - 3,632 votes for Trump - - - ED 22, Alaska + 3,632 votes for Trump + ED 22, Alaska 4,585 votes for Trump - 4,490 votes for Biden - - - ED 23, Alaska + 4,490 votes for Biden + ED 23, Alaska 3,723 votes for Biden - 3,543 votes for Trump - - - ED 24, Alaska + 3,543 votes for Trump + ED 24, Alaska 5,309 votes for Trump - 4,676 votes for Biden - - - ED 25, Alaska + 4,676 votes for Biden + ED 25, Alaska 4,530 votes for Biden - 4,323 votes for Trump - - - ED 26, Alaska + 4,323 votes for Trump + ED 26, Alaska 5,162 votes for Trump - 4,510 votes for Biden - - - ED 27, Alaska + 4,510 votes for Biden + ED 27, Alaska 4,791 votes for Biden - 4,267 votes for Trump - - - ED 28, Alaska + 4,267 votes for Trump + ED 28, Alaska 6,225 votes for Biden - 6,099 votes for Trump - - - ED 29, Alaska + 6,099 votes for Trump + ED 29, Alaska 7,450 votes for Trump - 2,983 votes for Biden - - - ED 3, Alaska + 2,983 votes for Biden + ED 3, Alaska 6,028 votes for Trump - 1,879 votes for Biden - - - ED 30, Alaska + 1,879 votes for Biden + ED 30, Alaska 7,181 votes for Trump - 2,635 votes for Biden - - - ED 31, Alaska + 2,635 votes for Biden + ED 31, Alaska 6,956 votes for Trump - 5,032 votes for Biden - - - ED 32, Alaska + 5,032 votes for Biden + ED 32, Alaska 4,427 votes for Trump - 3,495 votes for Biden - - - ED 33, Alaska + 3,495 votes for Biden + ED 33, Alaska 7,534 votes for Biden - 3,057 votes for Trump - - - ED 34, Alaska + 3,057 votes for Trump + ED 34, Alaska 5,759 votes for Biden - 4,541 votes for Trump - - - ED 35, Alaska + 4,541 votes for Trump + ED 35, Alaska 5,008 votes for Biden - 4,767 votes for Trump - - - ED 36, Alaska + 4,767 votes for Trump + ED 36, Alaska 5,111 votes for Trump - 3,792 votes for Biden - - - ED 37, Alaska + 3,792 votes for Biden + ED 37, Alaska 1,492 votes for Trump - 1,486 votes for Biden - - - ED 38, Alaska + 1,486 votes for Biden + ED 38, Alaska 3,065 votes for Biden - 1,646 votes for Trump - - - ED 39, Alaska + 1,646 votes for Trump + ED 39, Alaska 3,379 votes for Biden - 1,748 votes for Trump - - - ED 4, Alaska + 1,748 votes for Trump + ED 4, Alaska 5,769 votes for Biden - 4,660 votes for Trump - - - ED 40, Alaska + 4,660 votes for Trump + ED 40, Alaska 1,951 votes for Biden - 1,708 votes for Trump - - - ED 5, Alaska + 1,708 votes for Trump + ED 5, Alaska 4,135 votes for Biden - 4,040 votes for Trump - - - ED 6, Alaska + 4,040 votes for Trump + ED 6, Alaska 5,695 votes for Trump - 3,224 votes for Biden - - - ED 7, Alaska + 3,224 votes for Biden + ED 7, Alaska 6,860 votes for Trump - 2,173 votes for Biden - - - ED 8, Alaska + 2,173 votes for Biden + ED 8, Alaska 7,446 votes for Trump - 1,931 votes for Biden - - - ED 9, Alaska + 1,931 votes for Biden + ED 9, Alaska 7,696 votes for Trump - 2,738 votes for Biden - - - Anderson, Texas + 2,738 votes for Biden + Anderson, Texas 15,062 votes for Trump - 3,934 votes for Biden - - - Andrews, Texas + 3,934 votes for Biden + Andrews, Texas 4,937 votes for Trump - 849 votes for Biden - - - Angelina, Texas + 849 votes for Biden + Angelina, Texas 25,070 votes for Trump - 9,136 votes for Biden - - - Aransas, Texas + 9,136 votes for Biden + Aransas, Texas 9,210 votes for Trump - 2,896 votes for Biden - - - Archer, Texas + 2,896 votes for Biden + Archer, Texas 4,300 votes for Trump - 446 votes for Biden - - - Armstrong, Texas + 446 votes for Biden + Armstrong, Texas 1,035 votes for Trump - 75 votes for Biden - - - Atascosa, Texas + 75 votes for Biden + Atascosa, Texas 12,020 votes for Trump - 5,865 votes for Biden - - - Austin, Texas + 5,865 votes for Biden + Austin, Texas 11,282 votes for Trump - 2,931 votes for Biden - - - Bailey, Texas + 2,931 votes for Biden + Bailey, Texas 1,430 votes for Trump - 407 votes for Biden - - - Bandera, Texas + 407 votes for Biden + Bandera, Texas 10,050 votes for Trump - 2,503 votes for Biden - - - Bastrop, Texas + 2,503 votes for Biden + Bastrop, Texas 20,486 votes for Trump - 15,452 votes for Biden - - - Baylor, Texas + 15,452 votes for Biden + Baylor, Texas 1,478 votes for Trump - 179 votes for Biden - - - Bee, Texas + 179 votes for Biden + Bee, Texas 5,999 votes for Trump - 3,280 votes for Biden - - - Bell, Texas + 3,280 votes for Biden + Bell, Texas 67,113 votes for Trump - 56,032 votes for Biden - - - Bexar, Texas + 56,032 votes for Biden + Bexar, Texas 440,823 votes for Biden - 303,871 votes for Trump - - - Blanco, Texas + 303,871 votes for Trump + Blanco, Texas 5,429 votes for Trump - 1,905 votes for Biden - - - Borden, Texas + 1,905 votes for Biden + Borden, Texas 395 votes for Trump - 16 votes for Biden - - - Bosque, Texas + 16 votes for Biden + Bosque, Texas 7,446 votes for Trump - 1,552 votes for Biden - - - Bowie, Texas + 1,552 votes for Biden + Bowie, Texas 27,053 votes for Trump - 10,692 votes for Biden - - - Brazoria, Texas + 10,692 votes for Biden + Brazoria, Texas 89,939 votes for Trump - 61,780 votes for Biden - - - Brazos, Texas + 61,780 votes for Biden + Brazos, Texas 47,456 votes for Trump - 35,242 votes for Biden - - - Brewster, Texas + 35,242 votes for Biden + Brewster, Texas 2,451 votes for Trump - 2,251 votes for Biden - - - Briscoe, Texas + 2,251 votes for Biden + Briscoe, Texas 639 votes for Trump - 77 votes for Biden - - - Brooks, Texas + 77 votes for Biden + Brooks, Texas 1,470 votes for Biden - 998 votes for Trump - - - Brown, Texas + 998 votes for Trump + Brown, Texas 13,681 votes for Trump - 2,103 votes for Biden - - - Burleson, Texas + 2,103 votes for Biden + Burleson, Texas 6,740 votes for Trump - 1,786 votes for Biden - - - Burnet, Texas + 1,786 votes for Biden + Burnet, Texas 18,721 votes for Trump - 5,615 votes for Biden - - - Caldwell, Texas + 5,615 votes for Biden + Caldwell, Texas 7,975 votes for Trump - 6,536 votes for Biden - - - Calhoun, Texas + 6,536 votes for Biden + Calhoun, Texas 5,640 votes for Trump - 2,146 votes for Biden - - - Callahan, Texas + 2,146 votes for Biden + Callahan, Texas 6,006 votes for Trump - 734 votes for Biden - - - Cameron, Texas + 734 votes for Biden + Cameron, Texas 63,732 votes for Biden - 48,834 votes for Trump - - - Camp, Texas + 48,834 votes for Trump + Camp, Texas 3,626 votes for Trump - 1,392 votes for Biden - - - Carson, Texas + 1,392 votes for Biden + Carson, Texas 2,747 votes for Trump - 289 votes for Biden - - - Cass, Texas + 289 votes for Biden + Cass, Texas 10,979 votes for Trump - 2,777 votes for Biden - - - Castro, Texas + 2,777 votes for Biden + Castro, Texas 1,601 votes for Trump - 466 votes for Biden - - - Chambers, Texas + 466 votes for Biden + Chambers, Texas 17,343 votes for Trump - 3,997 votes for Biden - - - Cherokee, Texas + 3,997 votes for Biden + Cherokee, Texas 15,065 votes for Trump - 4,196 votes for Biden - - - Childress, Texas + 4,196 votes for Biden + Childress, Texas 1,928 votes for Trump - 305 votes for Biden - - - Clay, Texas + 305 votes for Biden + Clay, Texas 5,064 votes for Trump - 614 votes for Biden - - - Cochran, Texas + 614 votes for Biden + Cochran, Texas 806 votes for Trump - 176 votes for Biden - - - Coke, Texas + 176 votes for Biden + Coke, Texas 1,565 votes for Trump - 215 votes for Biden - - - Coleman, Texas + 215 votes for Biden + Coleman, Texas 3,640 votes for Trump - 451 votes for Biden - - - Collin, Texas + 451 votes for Biden + Collin, Texas 252,318 votes for Trump - 230,945 votes for Biden - - - Collingsworth, Texas + 230,945 votes for Biden + Collingsworth, Texas 1,048 votes for Trump - 155 votes for Biden - - - Colorado, Texas + 155 votes for Biden + Colorado, Texas 7,440 votes for Trump - 2,403 votes for Biden - - - Comal, Texas + 2,403 votes for Biden + Comal, Texas 62,260 votes for Trump - 24,369 votes for Biden - - - Comanche, Texas + 24,369 votes for Biden + Comanche, Texas 5,177 votes for Trump - 852 votes for Biden - - - Concho, Texas + 852 votes for Biden + Concho, Texas 1,058 votes for Trump - 197 votes for Biden - - - Cooke, Texas + 197 votes for Biden + Cooke, Texas 15,579 votes for Trump - 3,205 votes for Biden - - - Coryell, Texas + 3,205 votes for Biden + Coryell, Texas 15,397 votes for Trump - 7,542 votes for Biden - - - Cottle, Texas + 7,542 votes for Biden + Cottle, Texas 543 votes for Trump - 113 votes for Biden - - - Crane, Texas + 113 votes for Biden + Crane, Texas 1,247 votes for Trump - 241 votes for Biden - - - Crockett, Texas + 241 votes for Biden + Crockett, Texas 1,219 votes for Trump - 344 votes for Biden - - - Crosby, Texas + 344 votes for Biden + Crosby, Texas 1,396 votes for Trump - 527 votes for Biden - - - Culberson, Texas + 527 votes for Biden + Culberson, Texas 438 votes for Biden - 415 votes for Trump - - - Dallam, Texas + 415 votes for Trump + Dallam, Texas 1,386 votes for Trump - 196 votes for Biden - - - Dallas, Texas + 196 votes for Biden + Dallas, Texas 598,576 votes for Biden - 307,076 votes for Trump - - - Dawson, Texas + 307,076 votes for Trump + Dawson, Texas 2,951 votes for Trump - 808 votes for Biden - - - De Witt, Texas + 808 votes for Biden + De Witt, Texas 6,567 votes for Trump - 1,494 votes for Biden - - - Deaf Smith, Texas + 1,494 votes for Biden + Deaf Smith, Texas 3,293 votes for Trump - 1,263 votes for Biden - - - Delta, Texas + 1,263 votes for Biden + Delta, Texas 2,157 votes for Trump - 403 votes for Biden - - - Denton, Texas + 403 votes for Biden + Denton, Texas 222,480 votes for Trump - 188,695 votes for Biden - - - Dickens, Texas + 188,695 votes for Biden + Dickens, Texas 850 votes for Trump - 130 votes for Biden - - - Dimmit, Texas + 130 votes for Biden + Dimmit, Texas 2,264 votes for Biden - 1,384 votes for Trump - - - Donley, Texas + 1,384 votes for Trump + Donley, Texas 1,438 votes for Trump - 198 votes for Biden - - - Duval, Texas + 198 votes for Biden + Duval, Texas 2,573 votes for Biden - 2,442 votes for Trump - - - Eastland, Texas + 2,442 votes for Trump + Eastland, Texas 7,216 votes for Trump - 982 votes for Biden - - - Ector, Texas + 982 votes for Biden + Ector, Texas 32,586 votes for Trump - 11,310 votes for Biden - - - Edwards, Texas + 11,310 votes for Biden + Edwards, Texas 893 votes for Trump - 166 votes for Biden - - - El Paso, Texas + 166 votes for Biden + El Paso, Texas 168,801 votes for Biden - 81,235 votes for Trump - - - Ellis, Texas + 81,235 votes for Trump + Ellis, Texas 56,651 votes for Trump - 27,513 votes for Biden - - - Erath, Texas + 27,513 votes for Biden + Erath, Texas 13,669 votes for Trump - 2,914 votes for Biden - - - Falls, Texas + 2,914 votes for Biden + Falls, Texas 4,177 votes for Trump - 1,899 votes for Biden - - - Fannin, Texas + 1,899 votes for Biden + Fannin, Texas 12,150 votes for Trump - 2,638 votes for Biden - - - Fayette, Texas + 2,638 votes for Biden + Fayette, Texas 10,163 votes for Trump - 2,650 votes for Biden - - - Fisher, Texas + 2,650 votes for Biden + Fisher, Texas 1,448 votes for Trump - 352 votes for Biden - - - Floyd, Texas + 352 votes for Biden + Floyd, Texas 1,581 votes for Trump - 437 votes for Biden - - - Foard, Texas + 437 votes for Biden + Foard, Texas 445 votes for Trump - 99 votes for Biden - - - Fort Bend, Texas + 99 votes for Biden + Fort Bend, Texas 195,191 votes for Biden - 157,595 votes for Trump - - - Franklin, Texas + 157,595 votes for Trump + Franklin, Texas 4,153 votes for Trump - 803 votes for Biden - - - Freestone, Texas + 803 votes for Biden + Freestone, Texas 6,966 votes for Trump - 1,629 votes for Biden - - - Frio, Texas + 1,629 votes for Biden + Frio, Texas 2,812 votes for Trump - 2,421 votes for Biden - - - Gaines, Texas + 2,421 votes for Biden + Gaines, Texas 5,323 votes for Trump - 572 votes for Biden - - - Galveston, Texas + 572 votes for Biden + Galveston, Texas 93,306 votes for Trump - 58,247 votes for Biden - - - Garza, Texas + 58,247 votes for Biden + Garza, Texas 1,411 votes for Trump - 231 votes for Biden - - - Gillespie, Texas + 231 votes for Biden + Gillespie, Texas 12,495 votes for Trump - 3,163 votes for Biden - - - Glasscock, Texas + 3,163 votes for Biden + Glasscock, Texas 611 votes for Trump - 39 votes for Biden - - - Goliad, Texas + 39 votes for Biden + Goliad, Texas 3,081 votes for Trump - 872 votes for Biden - - - Gonzales, Texas + 872 votes for Biden + Gonzales, Texas 5,568 votes for Trump - 1,894 votes for Biden - - - Gray, Texas + 1,894 votes for Biden + Gray, Texas 6,812 votes for Trump - 820 votes for Biden - - - Grayson, Texas + 820 votes for Biden + Grayson, Texas 43,776 votes for Trump - 14,223 votes for Biden - - - Gregg, Texas + 14,223 votes for Biden + Gregg, Texas 32,352 votes for Trump - 14,657 votes for Biden - - - Grimes, Texas + 14,657 votes for Biden + Grimes, Texas 9,419 votes for Trump - 2,831 votes for Biden - - - Guadalupe, Texas + 2,831 votes for Biden + Guadalupe, Texas 47,423 votes for Trump - 28,706 votes for Biden - - - Hale, Texas + 28,706 votes for Biden + Hale, Texas 7,162 votes for Trump - 2,271 votes for Biden - - - Hall, Texas + 2,271 votes for Biden + Hall, Texas 992 votes for Trump - 167 votes for Biden - - - Hamilton, Texas + 167 votes for Biden + Hamilton, Texas 3,613 votes for Trump - 641 votes for Biden - - - Hansford, Texas + 641 votes for Biden + Hansford, Texas 1,848 votes for Trump - 166 votes for Biden - - - Hardeman, Texas + 166 votes for Biden + Hardeman, Texas 1,330 votes for Trump - 241 votes for Biden - - - Hardin, Texas + 241 votes for Biden + Hardin, Texas 23,806 votes for Trump - 3,449 votes for Biden - - - Harris, Texas + 3,449 votes for Biden + Harris, Texas 918,193 votes for Biden - 700,630 votes for Trump - - - Harrison, Texas + 700,630 votes for Trump + Harrison, Texas 21,318 votes for Trump - 7,812 votes for Biden - - - Hartley, Texas + 7,812 votes for Biden + Hartley, Texas 1,866 votes for Trump - 195 votes for Biden - - - Haskell, Texas + 195 votes for Biden + Haskell, Texas 1,837 votes for Trump - 353 votes for Biden - - - Hays, Texas + 353 votes for Biden + Hays, Texas 59,213 votes for Biden - 47,427 votes for Trump - - - Hemphill, Texas + 47,427 votes for Trump + Hemphill, Texas 1,486 votes for Trump - 206 votes for Biden - - - Henderson, Texas + 206 votes for Biden + Henderson, Texas 28,816 votes for Trump - 7,048 votes for Biden - - - Hidalgo, Texas + 7,048 votes for Biden + Hidalgo, Texas 128,199 votes for Biden - 90,527 votes for Trump - - - Hill, Texas + 90,527 votes for Trump + Hill, Texas 11,869 votes for Trump - 2,829 votes for Biden - - - Hockley, Texas + 2,829 votes for Biden + Hockley, Texas 6,534 votes for Trump - 1,481 votes for Biden - - - Hood, Texas + 1,481 votes for Biden + Hood, Texas 26,487 votes for Trump - 5,641 votes for Biden - - - Hopkins, Texas + 5,641 votes for Biden + Hopkins, Texas 12,713 votes for Trump - 3,043 votes for Biden - - - Houston, Texas + 3,043 votes for Biden + Houston, Texas 7,050 votes for Trump - 2,312 votes for Biden - - - Howard, Texas + 2,312 votes for Biden + Howard, Texas 7,899 votes for Trump - 2,017 votes for Biden - - - Hudspeth, Texas + 2,017 votes for Biden + Hudspeth, Texas 771 votes for Trump - 371 votes for Biden - - - Hunt, Texas + 371 votes for Biden + Hunt, Texas 29,135 votes for Trump - 8,879 votes for Biden - - - Hutchinson, Texas + 8,879 votes for Biden + Hutchinson, Texas 7,659 votes for Trump - 957 votes for Biden - - - Irion, Texas + 957 votes for Biden + Irion, Texas 759 votes for Trump - 120 votes for Biden - - - Jack, Texas + 120 votes for Biden + Jack, Texas 3,415 votes for Trump - 331 votes for Biden - - - Jackson, Texas + 331 votes for Biden + Jackson, Texas 5,116 votes for Trump - 1,018 votes for Biden - - - Jasper, Texas + 1,018 votes for Biden + Jasper, Texas 12,453 votes for Trump - 2,906 votes for Biden - - - Jeff Davis, Texas + 2,906 votes for Biden + Jeff Davis, Texas 783 votes for Trump - 501 votes for Biden - - - Jefferson, Texas + 501 votes for Biden + Jefferson, Texas 47,535 votes for Trump - 46,022 votes for Biden - - - Jim Hogg, Texas + 46,022 votes for Biden + Jim Hogg, Texas 1,197 votes for Biden - 831 votes for Trump - - - Jim Wells, Texas + 831 votes for Trump + Jim Wells, Texas 7,389 votes for Trump - 6,025 votes for Biden - - - Johnson, Texas + 6,025 votes for Biden + Johnson, Texas 54,523 votes for Trump - 16,418 votes for Biden - - - Jones, Texas + 16,418 votes for Biden + Jones, Texas 5,621 votes for Trump - 989 votes for Biden - - - Karnes, Texas + 989 votes for Biden + Karnes, Texas 3,959 votes for Trump - 1,220 votes for Biden - - - Kaufman, Texas + 1,220 votes for Biden + Kaufman, Texas 37,474 votes for Trump - 18,290 votes for Biden - - - Kendall, Texas + 18,290 votes for Biden + Kendall, Texas 20,064 votes for Trump - 6,008 votes for Biden - - - Kenedy, Texas + 6,008 votes for Biden + Kenedy, Texas 127 votes for Trump - 65 votes for Biden - - - Kent, Texas + 65 votes for Biden + Kent, Texas 411 votes for Trump - 47 votes for Biden - - - Kerr, Texas + 47 votes for Biden + Kerr, Texas 20,858 votes for Trump - 6,510 votes for Biden - - - Kimble, Texas + 6,510 votes for Biden + Kimble, Texas 1,987 votes for Trump - 284 votes for Biden - - - King, Texas + 284 votes for Biden + King, Texas 151 votes for Trump - 8 votes for Biden - - - Kinney, Texas + 8 votes for Biden + Kinney, Texas 1,144 votes for Trump - 446 votes for Biden - - - Kleberg, Texas + 446 votes for Biden + Kleberg, Texas 5,557 votes for Trump - 5,359 votes for Biden - - - Knox, Texas + 5,359 votes for Biden + Knox, Texas 1,180 votes for Trump - 265 votes for Biden - - - La Salle, Texas + 265 votes for Biden + La Salle, Texas 1,335 votes for Trump - 1,052 votes for Biden - - - La Vaca, Texas + 1,052 votes for Biden + La Vaca, Texas 8,802 votes for Trump - 1,333 votes for Biden - - - Lamar, Texas + 1,333 votes for Biden + Lamar, Texas 16,698 votes for Trump - 4,420 votes for Biden - - - Lamb, Texas + 4,420 votes for Biden + Lamb, Texas 3,513 votes for Trump - 835 votes for Biden - - - Lampasas, Texas + 835 votes for Biden + Lampasas, Texas 8,070 votes for Trump - 2,134 votes for Biden - - - Lee, Texas + 2,134 votes for Biden + Lee, Texas 6,248 votes for Trump - 1,745 votes for Biden - - - Leon, Texas + 1,745 votes for Biden + Leon, Texas 7,522 votes for Trump - 1,072 votes for Biden - - - Liberty, Texas + 1,072 votes for Biden + Liberty, Texas 23,288 votes for Trump - 5,779 votes for Biden - - - Limestone, Texas + 5,779 votes for Biden + Limestone, Texas 6,786 votes for Trump - 2,213 votes for Biden - - - Lipscomb, Texas + 2,213 votes for Biden + Lipscomb, Texas 1,203 votes for Trump - 131 votes for Biden - - - Live Oak, Texas + 131 votes for Biden + Live Oak, Texas 4,198 votes for Trump - 819 votes for Biden - - - Llano, Texas + 819 votes for Biden + Llano, Texas 9,996 votes for Trump - 3,167 votes for Biden - - - Loving, Texas + 3,167 votes for Biden + Loving, Texas 60 votes for Trump - 4 votes for Biden - - - Lubbock, Texas + 4 votes for Biden + Lubbock, Texas 78,560 votes for Trump - 39,757 votes for Biden - - - Lynn, Texas + 39,757 votes for Biden + Lynn, Texas 1,853 votes for Trump - 428 votes for Biden - - - Madison, Texas + 428 votes for Biden + Madison, Texas 4,165 votes for Trump - 1,084 votes for Biden - - - Marion, Texas + 1,084 votes for Biden + Marion, Texas 3,459 votes for Trump - 1,331 votes for Biden - - - Martin, Texas + 1,331 votes for Biden + Martin, Texas 1,857 votes for Trump - 288 votes for Biden - - - Mason, Texas + 288 votes for Biden + Mason, Texas 2,108 votes for Trump - 566 votes for Biden - - - Matagorda, Texas + 566 votes for Biden + Matagorda, Texas 9,836 votes for Trump - 3,726 votes for Biden - - - Maverick, Texas + 3,726 votes for Biden + Maverick, Texas 8,324 votes for Biden - 6,881 votes for Trump - - - McCulloch, Texas + 6,881 votes for Trump + McCulloch, Texas 2,898 votes for Trump - 490 votes for Biden - - - McLennan, Texas + 490 votes for Biden + McLennan, Texas 59,432 votes for Trump - 36,550 votes for Biden - - - McMullen, Texas + 36,550 votes for Biden + McMullen, Texas 460 votes for Trump - 53 votes for Biden - - - Medina, Texas + 53 votes for Biden + Medina, Texas 15,599 votes for Trump - 6,731 votes for Biden - - - Menard, Texas + 6,731 votes for Biden + Menard, Texas 819 votes for Trump - 196 votes for Biden - - - Midland, Texas + 196 votes for Biden + Midland, Texas 45,463 votes for Trump - 12,258 votes for Biden - - - Milam, Texas + 12,258 votes for Biden + Milam, Texas 7,950 votes for Trump - 2,475 votes for Biden - - - Mills, Texas + 2,475 votes for Biden + Mills, Texas 2,214 votes for Trump - 271 votes for Biden - - - Mitchell, Texas + 271 votes for Biden + Mitchell, Texas 2,169 votes for Trump - 397 votes for Biden - - - Montague, Texas + 397 votes for Biden + Montague, Texas 8,613 votes for Trump - 1,097 votes for Biden - - - Montgomery, Texas + 1,097 votes for Biden + Montgomery, Texas 193,224 votes for Trump - 74,255 votes for Biden - - - Moore, Texas + 74,255 votes for Biden + Moore, Texas 4,356 votes for Trump - 1,059 votes for Biden - - - Morris, Texas + 1,059 votes for Biden + Morris, Texas 3,841 votes for Trump - 1,664 votes for Biden - - - Motley, Texas + 1,664 votes for Biden + Motley, Texas 604 votes for Trump - 46 votes for Biden - - - Nacogdoches, Texas + 46 votes for Biden + Nacogdoches, Texas 17,359 votes for Trump - 8,989 votes for Biden - - - Navarro, Texas + 8,989 votes for Biden + Navarro, Texas 13,787 votes for Trump - 5,097 votes for Biden - - - Newton, Texas + 5,097 votes for Biden + Newton, Texas 4,882 votes for Trump - 1,175 votes for Biden - - - Nolan, Texas + 1,175 votes for Biden + Nolan, Texas 4,127 votes for Trump - 1,161 votes for Biden - - - Nueces, Texas + 1,161 votes for Biden + Nueces, Texas 64,467 votes for Trump - 60,749 votes for Biden - - - Ochiltree, Texas + 60,749 votes for Biden + Ochiltree, Texas 2,811 votes for Trump - 302 votes for Biden - - - Oldham, Texas + 302 votes for Biden + Oldham, Texas 917 votes for Trump - 81 votes for Biden - - - Orange, Texas + 81 votes for Biden + Orange, Texas 29,170 votes for Trump - 6,354 votes for Biden - - - Palo Pinto, Texas + 6,354 votes for Biden + Palo Pinto, Texas 10,170 votes for Trump - 2,177 votes for Biden - - - Panola, Texas + 2,177 votes for Biden + Panola, Texas 9,322 votes for Trump - 2,057 votes for Biden - - - Parker, Texas + 2,057 votes for Biden + Parker, Texas 61,584 votes for Trump - 12,789 votes for Biden - - - Parmer, Texas + 12,789 votes for Biden + Parmer, Texas 2,133 votes for Trump - 488 votes for Biden - - - Pecos, Texas + 488 votes for Biden + Pecos, Texas 3,213 votes for Trump - 1,378 votes for Biden - - - Polk, Texas + 1,378 votes for Biden + Polk, Texas 18,496 votes for Trump - 5,353 votes for Biden - - - Potter, Texas + 5,353 votes for Biden + Potter, Texas 22,732 votes for Trump - 9,867 votes for Biden - - - Presidio, Texas + 9,867 votes for Biden + Presidio, Texas 1,463 votes for Biden - 721 votes for Trump - - - Rains, Texas + 721 votes for Trump + Rains, Texas 5,147 votes for Trump - 841 votes for Biden - - - Randall, Texas + 841 votes for Biden + Randall, Texas 50,597 votes for Trump - 12,750 votes for Biden - - - Reagan, Texas + 12,750 votes for Biden + Reagan, Texas 942 votes for Trump - 172 votes for Biden - - - Real, Texas + 172 votes for Biden + Real, Texas 1,643 votes for Trump - 320 votes for Biden - - - Red River, Texas + 320 votes for Biden + Red River, Texas 4,513 votes for Trump - 1,244 votes for Biden - - - Reeves, Texas + 1,244 votes for Biden + Reeves, Texas 2,249 votes for Trump - 1,394 votes for Biden - - - Refugio, Texas + 1,394 votes for Biden + Refugio, Texas 2,210 votes for Trump - 1,108 votes for Biden - - - Roberts, Texas + 1,108 votes for Biden + Roberts, Texas 529 votes for Trump - 17 votes for Biden - - - Robertson, Texas + 17 votes for Biden + Robertson, Texas 5,631 votes for Trump - 2,359 votes for Biden - - - Rockwall, Texas + 2,359 votes for Biden + Rockwall, Texas 38,842 votes for Trump - 18,149 votes for Biden - - - Runnels, Texas + 18,149 votes for Biden + Runnels, Texas 3,682 votes for Trump - 531 votes for Biden - - - Rusk, Texas + 531 votes for Biden + Rusk, Texas 16,511 votes for Trump - 4,624 votes for Biden - - - Sabine, Texas + 4,624 votes for Biden + Sabine, Texas 4,767 votes for Trump - 662 votes for Biden - - - San Augustine, Texas + 662 votes for Biden + San Augustine, Texas 3,005 votes for Trump - 979 votes for Biden - - - San Jacinto, Texas + 979 votes for Biden + San Jacinto, Texas 10,154 votes for Trump - 2,332 votes for Biden - - - San Patricio, Texas + 2,332 votes for Biden + San Patricio, Texas 16,495 votes for Trump - 8,971 votes for Biden - - - San Saba, Texas + 8,971 votes for Biden + San Saba, Texas 2,308 votes for Trump - 287 votes for Biden - - - Schleicher, Texas + 287 votes for Biden + Schleicher, Texas 939 votes for Trump - 211 votes for Biden - - - Scurry, Texas + 211 votes for Biden + Scurry, Texas 4,978 votes for Trump - 818 votes for Biden - - - Shackelford, Texas + 818 votes for Biden + Shackelford, Texas 1,484 votes for Trump - 130 votes for Biden - - - Shelby, Texas + 130 votes for Biden + Shelby, Texas 7,962 votes for Trump - 2,058 votes for Biden - - - Sherman, Texas + 2,058 votes for Biden + Sherman, Texas 885 votes for Trump - 91 votes for Biden - - - Smith, Texas + 91 votes for Biden + Smith, Texas 68,546 votes for Trump - 29,343 votes for Biden - - - Somervell, Texas + 29,343 votes for Biden + Somervell, Texas 4,099 votes for Trump - 768 votes for Biden - - - Starr, Texas + 768 votes for Biden + Starr, Texas 9,099 votes for Biden - 8,224 votes for Trump - - - Stephens, Texas + 8,224 votes for Trump + Stephens, Texas 3,385 votes for Trump - 396 votes for Biden - - - Sterling, Texas + 396 votes for Biden + Sterling, Texas 584 votes for Trump - 51 votes for Biden - - - Stonewall, Texas + 51 votes for Biden + Stonewall, Texas 615 votes for Trump - 116 votes for Biden - - - Sutton, Texas + 116 votes for Biden + Sutton, Texas 1,222 votes for Trump - 322 votes for Biden - - - Swisher, Texas + 322 votes for Biden + Swisher, Texas 1,842 votes for Trump - 478 votes for Biden - - - Tarrant, Texas + 478 votes for Biden + Tarrant, Texas 411,567 votes for Biden - 409,741 votes for Trump - - - Taylor, Texas + 409,741 votes for Trump + Taylor, Texas 39,439 votes for Trump - 14,489 votes for Biden - - - Terrell, Texas + 14,489 votes for Biden + Terrell, Texas 334 votes for Trump - 119 votes for Biden - - - Terry, Texas + 119 votes for Biden + Terry, Texas 2,809 votes for Trump - 757 votes for Biden - - - Throckmorton, Texas + 757 votes for Biden + Throckmorton, Texas 806 votes for Trump - 82 votes for Biden - - - Titus, Texas + 82 votes for Biden + Titus, Texas 7,563 votes for Trump - 2,852 votes for Biden - - - Tom Green, Texas + 2,852 votes for Biden + Tom Green, Texas 32,129 votes for Trump - 12,106 votes for Biden - - - Travis, Texas + 12,106 votes for Biden + Travis, Texas 435,860 votes for Biden - 161,337 votes for Trump - - - Trinity, Texas + 161,337 votes for Trump + Trinity, Texas 5,579 votes for Trump - 1,323 votes for Biden - - - Tyler, Texas + 1,323 votes for Biden + Tyler, Texas 8,095 votes for Trump - 1,390 votes for Biden - - - Upshur, Texas + 1,390 votes for Biden + Upshur, Texas 15,775 votes for Trump - 2,869 votes for Biden - - - Upton, Texas + 2,869 votes for Biden + Upton, Texas 1,176 votes for Trump - 169 votes for Biden - - - Uvalde, Texas + 169 votes for Biden + Uvalde, Texas 6,160 votes for Trump - 4,066 votes for Biden - - - Val Verde, Texas + 4,066 votes for Biden + Val Verde, Texas 7,839 votes for Trump - 6,401 votes for Biden - - - Van Zandt, Texas + 6,401 votes for Biden + Van Zandt, Texas 22,126 votes for Trump - 3,419 votes for Biden - - - Victoria, Texas + 3,419 votes for Biden + Victoria, Texas 23,347 votes for Trump - 10,371 votes for Biden - - - Walker, Texas + 10,371 votes for Biden + Walker, Texas 15,368 votes for Trump - 7,875 votes for Biden - - - Waller, Texas + 7,875 votes for Biden + Waller, Texas 14,206 votes for Trump - 8,130 votes for Biden - - - Ward, Texas + 8,130 votes for Biden + Ward, Texas 3,238 votes for Trump - 761 votes for Biden - - - Washington, Texas + 761 votes for Biden + Washington, Texas 12,949 votes for Trump - 4,254 votes for Biden - - - Webb, Texas + 4,254 votes for Biden + Webb, Texas 41,820 votes for Biden - 25,898 votes for Trump - - - Wharton, Texas + 25,898 votes for Trump + Wharton, Texas 11,892 votes for Trump - 4,671 votes for Biden - - - Wheeler, Texas + 4,671 votes for Biden + Wheeler, Texas 2,158 votes for Trump - 168 votes for Biden - - - Wichita, Texas + 168 votes for Biden + Wichita, Texas 31,930 votes for Trump - 13,024 votes for Biden - - - Wilbarger, Texas + 13,024 votes for Biden + Wilbarger, Texas 3,520 votes for Trump - 954 votes for Biden - - - Willacy, Texas + 954 votes for Biden + Willacy, Texas 3,097 votes for Biden - 2,437 votes for Trump - - - Williamson, Texas + 2,437 votes for Trump + Williamson, Texas 142,457 votes for Biden - 138,649 votes for Trump - - - Wilson, Texas + 138,649 votes for Trump + Wilson, Texas 18,457 votes for Trump - 6,350 votes for Biden - - - Winkler, Texas + 6,350 votes for Biden + Winkler, Texas 1,753 votes for Trump - 358 votes for Biden - - - Wise, Texas + 358 votes for Biden + Wise, Texas 26,986 votes for Trump - 4,953 votes for Biden - - - Wood, Texas + 4,953 votes for Biden + Wood, Texas 18,962 votes for Trump - 3,487 votes for Biden - - - Yoakum, Texas + 3,487 votes for Biden + Yoakum, Texas 2,172 votes for Trump - 419 votes for Biden - - - Young, Texas + 419 votes for Biden + Young, Texas 7,112 votes for Trump - 1,036 votes for Biden - - - Zapata, Texas + 1,036 votes for Biden + Zapata, Texas 2,032 votes for Trump - 1,820 votes for Biden - - - Zavala, Texas + 1,820 votes for Biden + Zavala, Texas 2,864 votes for Biden - 1,490 votes for Trump - - - Aitkin, Minnesota + 1,490 votes for Trump + Aitkin, Minnesota 6,258 votes for Trump - 3,607 votes for Biden - - - Anoka, Minnesota + 3,607 votes for Biden + Anoka, Minnesota 104,903 votes for Trump - 100,892 votes for Biden - - - Becker, Minnesota + 100,892 votes for Biden + Becker, Minnesota 12,452 votes for Trump - 6,592 votes for Biden - - - Beltrami, Minnesota + 6,592 votes for Biden + Beltrami, Minnesota 12,188 votes for Trump - 11,426 votes for Biden - - - Benton, Minnesota + 11,426 votes for Biden + Benton, Minnesota 14,382 votes for Trump - 7,281 votes for Biden - - - Big Stone, Minnesota + 7,281 votes for Biden + Big Stone, Minnesota 1,862 votes for Trump - 1,052 votes for Biden - - - Blue Earth, Minnesota + 1,052 votes for Biden + Blue Earth, Minnesota 18,330 votes for Biden - 16,731 votes for Trump - - - Brown, Minnesota + 16,731 votes for Trump + Brown, Minnesota 9,550 votes for Trump - 4,750 votes for Biden - - - Carlton, Minnesota + 4,750 votes for Biden + Carlton, Minnesota 10,094 votes for Biden - 9,787 votes for Trump - - - Carver, Minnesota + 9,787 votes for Trump + Carver, Minnesota 34,012 votes for Trump - 30,770 votes for Biden - - - Cass, Minnesota + 30,770 votes for Biden + Cass, Minnesota 11,621 votes for Trump - 6,342 votes for Biden - - - Chippewa, Minnesota + 6,342 votes for Biden + Chippewa, Minnesota 4,250 votes for Trump - 2,226 votes for Biden - - - Chisago, Minnesota + 2,226 votes for Biden + Chisago, Minnesota 21,915 votes for Trump - 11,803 votes for Biden - - - Clay, Minnesota + 11,803 votes for Biden + Clay, Minnesota 16,345 votes for Biden - 15,031 votes for Trump - - - Clearwater, Minnesota + 15,031 votes for Trump + Clearwater, Minnesota 3,371 votes for Trump - 1,258 votes for Biden - - - Cook, Minnesota + 1,258 votes for Biden + Cook, Minnesota 2,496 votes for Biden - 1,203 votes for Trump - - - Cottonwood, Minnesota + 1,203 votes for Trump + Cottonwood, Minnesota 4,165 votes for Trump - 1,834 votes for Biden - - - Crow Wing, Minnesota + 1,834 votes for Biden + Crow Wing, Minnesota 25,676 votes for Trump - 13,726 votes for Biden - - - Dakota, Minnesota + 13,726 votes for Biden + Dakota, Minnesota 145,510 votes for Biden - 109,183 votes for Trump - - - Dodge, Minnesota + 109,183 votes for Trump + Dodge, Minnesota 7,774 votes for Trump - 4,074 votes for Biden - - - Douglas, Minnesota + 4,074 votes for Biden + Douglas, Minnesota 15,799 votes for Trump - 7,868 votes for Biden - - - Faribault, Minnesota + 7,868 votes for Biden + Faribault, Minnesota 5,191 votes for Trump - 2,531 votes for Biden - - - Fillmore, Minnesota + 2,531 votes for Biden + Fillmore, Minnesota 7,301 votes for Trump - 4,551 votes for Biden - - - Freeborn, Minnesota + 4,551 votes for Biden + Freeborn, Minnesota 9,578 votes for Trump - 6,889 votes for Biden - - - Goodhue, Minnesota + 6,889 votes for Biden + Goodhue, Minnesota 16,052 votes for Trump - 11,805 votes for Biden - - - Grant, Minnesota + 11,805 votes for Biden + Grant, Minnesota 2,269 votes for Trump - 1,300 votes for Biden - - - Hennepin, Minnesota + 1,300 votes for Biden + Hennepin, Minnesota 532,608 votes for Biden - 205,966 votes for Trump - - - Houston, Minnesota + 205,966 votes for Trump + Houston, Minnesota 6,334 votes for Trump - 4,851 votes for Biden - - - Hubbard, Minnesota + 4,851 votes for Biden + Hubbard, Minnesota 8,202 votes for Trump - 4,462 votes for Biden - - - Isanti, Minnesota + 4,462 votes for Biden + Isanti, Minnesota 16,491 votes for Trump - 7,138 votes for Biden - - - Itasca, Minnesota + 7,138 votes for Biden + Itasca, Minnesota 15,239 votes for Trump - 10,787 votes for Biden - - - Jackson, Minnesota + 10,787 votes for Biden + Jackson, Minnesota 3,948 votes for Trump - 1,745 votes for Biden - - - Kanabec, Minnesota + 1,745 votes for Biden + Kanabec, Minnesota 6,278 votes for Trump - 2,774 votes for Biden - - - Kandiyohi, Minnesota + 2,774 votes for Biden + Kandiyohi, Minnesota 14,437 votes for Trump - 8,440 votes for Biden - - - Kittson, Minnesota + 8,440 votes for Biden + Kittson, Minnesota 1,546 votes for Trump - 1,006 votes for Biden - - - Koochiching, Minnesota + 1,006 votes for Biden + Koochiching, Minnesota 4,131 votes for Trump - 2,657 votes for Biden - - - Lac Qui Parle, Minnesota + 2,657 votes for Biden + Lac Qui Parle, Minnesota 2,527 votes for Trump - 1,445 votes for Biden - - - Lake, Minnesota + 1,445 votes for Biden + Lake, Minnesota 3,646 votes for Biden - 3,392 votes for Trump - - - Lake of the Woods, Minnesota + 3,392 votes for Trump + Lake of the Woods, Minnesota 1,704 votes for Trump - 671 votes for Biden - - - Le Sueur, Minnesota + 671 votes for Biden + Le Sueur, Minnesota 10,775 votes for Trump - 5,671 votes for Biden - - - Lincoln, Minnesota + 5,671 votes for Biden + Lincoln, Minnesota 2,120 votes for Trump - 937 votes for Biden - - - Lyon, Minnesota + 937 votes for Biden + Lyon, Minnesota 7,979 votes for Trump - 4,630 votes for Biden - - - Mahnomen, Minnesota + 4,630 votes for Biden + Mahnomen, Minnesota 1,143 votes for Trump - 1,112 votes for Biden - - - Marshall, Minnesota + 1,112 votes for Biden + Marshall, Minnesota 3,721 votes for Trump - 1,295 votes for Biden - - - Martin, Minnesota + 1,295 votes for Biden + Martin, Minnesota 7,476 votes for Trump - 3,304 votes for Biden - - - McLeod, Minnesota + 3,304 votes for Biden + McLeod, Minnesota 13,986 votes for Trump - 6,413 votes for Biden - - - Meeker, Minnesota + 6,413 votes for Biden + Meeker, Minnesota 9,358 votes for Trump - 3,867 votes for Biden - - - Mille Lacs, Minnesota + 3,867 votes for Biden + Mille Lacs, Minnesota 9,953 votes for Trump - 4,403 votes for Biden - - - Morrison, Minnesota + 4,403 votes for Biden + Morrison, Minnesota 14,819 votes for Trump - 4,367 votes for Biden - - - Mower, Minnesota + 4,367 votes for Biden + Mower, Minnesota 10,067 votes for Trump - 8,997 votes for Biden - - - Murray, Minnesota + 8,997 votes for Biden + Murray, Minnesota 3,363 votes for Trump - 1,449 votes for Biden - - - Nicollet, Minnesota + 1,449 votes for Biden + Nicollet, Minnesota 9,622 votes for Biden - 9,018 votes for Trump - - - Nobles, Minnesota + 9,018 votes for Trump + Nobles, Minnesota 5,598 votes for Trump - 2,928 votes for Biden - - - Norman, Minnesota + 2,928 votes for Biden + Norman, Minnesota 1,954 votes for Trump - 1,404 votes for Biden - - - Olmsted, Minnesota + 1,404 votes for Biden + Olmsted, Minnesota 49,492 votes for Biden - 39,692 votes for Trump - - - Otter Tail, Minnesota + 39,692 votes for Trump + Otter Tail, Minnesota 23,794 votes for Trump - 11,940 votes for Biden - - - Pennington, Minnesota + 11,940 votes for Biden + Pennington, Minnesota 4,532 votes for Trump - 2,568 votes for Biden - - - Pine, Minnesota + 2,568 votes for Biden + Pine, Minnesota 10,256 votes for Trump - 5,416 votes for Biden - - - Pipestone, Minnesota + 5,416 votes for Biden + Pipestone, Minnesota 3,553 votes for Trump - 1,306 votes for Biden - - - Polk, Minnesota + 1,306 votes for Biden + Polk, Minnesota 9,857 votes for Trump - 5,435 votes for Biden - - - Pope, Minnesota + 5,435 votes for Biden + Pope, Minnesota 4,413 votes for Trump - 2,478 votes for Biden - - - Ramsey, Minnesota + 2,478 votes for Biden + Ramsey, Minnesota 211,362 votes for Biden - 77,324 votes for Trump - - - Red Lake, Minnesota + 77,324 votes for Trump + Red Lake, Minnesota 1,450 votes for Trump - 689 votes for Biden - - - Redwood, Minnesota + 689 votes for Biden + Redwood, Minnesota 5,775 votes for Trump - 2,358 votes for Biden - - - Renville, Minnesota + 2,358 votes for Biden + Renville, Minnesota 5,465 votes for Trump - 2,497 votes for Biden - - - Rice, Minnesota + 2,497 votes for Biden + Rice, Minnesota 17,463 votes for Trump - 17,402 votes for Biden - - - Rock, Minnesota + 17,402 votes for Biden + Rock, Minnesota 3,580 votes for Trump - 1,554 votes for Biden - - - Roseau, Minnesota + 1,554 votes for Biden + Roseau, Minnesota 6,065 votes for Trump - 2,188 votes for Biden - - - Scott, Minnesota + 2,188 votes for Biden + Scott, Minnesota 45,871 votes for Trump - 40,037 votes for Biden - - - Sherburne, Minnesota + 40,037 votes for Biden + Sherburne, Minnesota 36,221 votes for Trump - 18,065 votes for Biden - - - Sibley, Minnesota + 18,065 votes for Biden + Sibley, Minnesota 5,864 votes for Trump - 2,417 votes for Biden - - - St. Louis, Minnesota + 2,417 votes for Biden + St. Louis, Minnesota 67,836 votes for Biden - 49,214 votes for Trump - - - Stearns, Minnesota + 49,214 votes for Trump + Stearns, Minnesota 50,960 votes for Trump - 31,883 votes for Biden - - - Steele, Minnesota + 31,883 votes for Biden + Steele, Minnesota 12,656 votes for Trump - 7,917 votes for Biden - - - Stevens, Minnesota + 7,917 votes for Biden + Stevens, Minnesota 3,044 votes for Trump - 1,921 votes for Biden - - - Swift, Minnesota + 1,921 votes for Biden + Swift, Minnesota 3,316 votes for Trump - 1,784 votes for Biden - - - Todd, Minnesota + 1,784 votes for Biden + Todd, Minnesota 9,755 votes for Trump - 3,286 votes for Biden - - - Traverse, Minnesota + 3,286 votes for Biden + Traverse, Minnesota 1,173 votes for Trump - 662 votes for Biden - - - Wabasha, Minnesota + 662 votes for Biden + Wabasha, Minnesota 8,153 votes for Trump - 4,696 votes for Biden - - - Wadena, Minnesota + 4,696 votes for Biden + Wadena, Minnesota 5,520 votes for Trump - 2,023 votes for Biden - - - Waseca, Minnesota + 2,023 votes for Biden + Waseca, Minnesota 6,624 votes for Trump - 3,496 votes for Biden - - - Washington, Minnesota + 3,496 votes for Biden + Washington, Minnesota 89,164 votes for Biden - 73,764 votes for Trump - - - Watonwan, Minnesota + 73,764 votes for Trump + Watonwan, Minnesota 3,103 votes for Trump - 1,987 votes for Biden - - - Wilkin, Minnesota + 1,987 votes for Biden + Wilkin, Minnesota 2,333 votes for Trump - 1,027 votes for Biden - - - Winona, Minnesota + 1,027 votes for Biden + Winona, Minnesota 13,333 votes for Biden - 13,227 votes for Trump - - - Wright, Minnesota + 13,227 votes for Trump + Wright, Minnesota 51,970 votes for Trump - 28,427 votes for Biden - - - Yellow Medicine, Minnesota + 28,427 votes for Biden + Yellow Medicine, Minnesota 3,734 votes for Trump - 1,685 votes for Biden - - - Alcona, Michigan + 1,685 votes for Biden + Alcona, Michigan 4,848 votes for Trump - 2,142 votes for Biden - - - Alger, Michigan + 2,142 votes for Biden + Alger, Michigan 3,014 votes for Trump - 2,053 votes for Biden - - - Allegan, Michigan + 2,053 votes for Biden + Allegan, Michigan 41,381 votes for Trump - 24,447 votes for Biden - - - Alpena, Michigan + 24,447 votes for Biden + Alpena, Michigan 10,686 votes for Trump - 6,000 votes for Biden - - - Antrim, Michigan + 6,000 votes for Biden + Antrim, Michigan 9,783 votes for Trump - 7,289 votes for Biden - - - Arenac, Michigan + 7,289 votes for Biden + Arenac, Michigan 5,928 votes for Trump - 2,774 votes for Biden - - - Baraga, Michigan + 2,774 votes for Biden + Baraga, Michigan 2,512 votes for Trump - 1,478 votes for Biden - - - Barry, Michigan + 1,478 votes for Biden + Barry, Michigan 23,473 votes for Trump - 11,804 votes for Biden - - - Bay, Michigan + 11,804 votes for Biden + Bay, Michigan 33,347 votes for Trump - 26,653 votes for Biden - - - Benzie, Michigan + 26,653 votes for Biden + Benzie, Michigan 6,601 votes for Trump - 5,480 votes for Biden - - - Berrien, Michigan + 5,480 votes for Biden + Berrien, Michigan 43,519 votes for Trump - 37,438 votes for Biden - - - Branch, Michigan + 37,438 votes for Biden + Branch, Michigan 14,067 votes for Trump - 6,161 votes for Biden - - - Calhoun, Michigan + 6,161 votes for Biden + Calhoun, Michigan 35,900 votes for Trump - 28,417 votes for Biden - - - Cass, Michigan + 28,417 votes for Biden + Cass, Michigan 16,686 votes for Trump - 9,122 votes for Biden - - - Charlevoix, Michigan + 9,122 votes for Biden + Charlevoix, Michigan 9,841 votes for Trump - 6,939 votes for Biden - - - Cheboygan, Michigan + 6,939 votes for Biden + Cheboygan, Michigan 10,186 votes for Trump - 5,437 votes for Biden - - - Chippewa, Michigan + 5,437 votes for Biden + Chippewa, Michigan 10,682 votes for Trump - 6,651 votes for Biden - - - Clare, Michigan + 6,651 votes for Biden + Clare, Michigan 10,860 votes for Trump - 5,200 votes for Biden - - - Clinton, Michigan + 5,200 votes for Biden + Clinton, Michigan 25,098 votes for Trump - 21,968 votes for Biden - - - Crawford, Michigan + 21,968 votes for Biden + Crawford, Michigan 5,087 votes for Trump - 2,672 votes for Biden - - - Delta, Michigan + 2,672 votes for Biden + Delta, Michigan 13,206 votes for Trump - 7,605 votes for Biden - - - Dickinson, Michigan + 7,605 votes for Biden + Dickinson, Michigan 9,617 votes for Trump - 4,744 votes for Biden - - - Eaton, Michigan + 4,744 votes for Biden + Eaton, Michigan 31,797 votes for Trump - 31,297 votes for Biden - - - Emmet, Michigan + 31,297 votes for Biden + Emmet, Michigan 12,135 votes for Trump - 9,662 votes for Biden - - - Genesee, Michigan + 9,662 votes for Biden + Genesee, Michigan 120,082 votes for Biden - 99,199 votes for Trump - - - Gladwin, Michigan + 99,199 votes for Trump + Gladwin, Michigan 9,893 votes for Trump - 4,524 votes for Biden - - - Gogebic, Michigan + 4,524 votes for Biden + Gogebic, Michigan 4,600 votes for Trump - 3,573 votes for Biden - - - Grand Traverse, Michigan + 3,573 votes for Biden + Grand Traverse, Michigan 30,502 votes for Trump - 28,683 votes for Biden - - - Gratiot, Michigan + 28,683 votes for Biden + Gratiot, Michigan 12,102 votes for Trump - 6,693 votes for Biden - - - Hillsdale, Michigan + 6,693 votes for Biden + Hillsdale, Michigan 17,037 votes for Trump - 5,883 votes for Biden - - - Houghton, Michigan + 5,883 votes for Biden + Houghton, Michigan 10,380 votes for Trump - 7,755 votes for Biden - - - Huron, Michigan + 7,755 votes for Biden + Huron, Michigan 11,949 votes for Trump - 5,349 votes for Biden - - - Ingham, Michigan + 5,349 votes for Biden + Ingham, Michigan 94,221 votes for Biden - 47,640 votes for Trump - - - Ionia, Michigan + 47,640 votes for Trump + Ionia, Michigan 20,657 votes for Trump - 10,901 votes for Biden - - - Iosco, Michigan + 10,901 votes for Biden + Iosco, Michigan 9,760 votes for Trump - 5,371 votes for Biden - - - Iron, Michigan + 5,371 votes for Biden + Iron, Michigan 4,216 votes for Trump - 2,493 votes for Biden - - - Isabella, Michigan + 2,493 votes for Biden + Isabella, Michigan 14,815 votes for Trump - 14,072 votes for Biden - - - Jackson, Michigan + 14,072 votes for Biden + Jackson, Michigan 47,381 votes for Trump - 32,004 votes for Biden - - - Kalamazoo, Michigan + 32,004 votes for Biden + Kalamazoo, Michigan 83,686 votes for Biden - 56,823 votes for Trump - - - Kalkaska, Michigan + 56,823 votes for Trump + Kalkaska, Michigan 7,436 votes for Trump - 3,003 votes for Biden - - - Kent, Michigan + 3,003 votes for Biden + Kent, Michigan 187,915 votes for Biden - 165,741 votes for Trump - - - Keweenaw, Michigan + 165,741 votes for Trump + Keweenaw, Michigan 862 votes for Trump - 672 votes for Biden - - - Lake, Michigan + 672 votes for Biden + Lake, Michigan 3,946 votes for Trump - 2,288 votes for Biden - - - Lapeer, Michigan + 2,288 votes for Biden + Lapeer, Michigan 35,480 votes for Trump - 16,368 votes for Biden - - - Leelanau, Michigan + 16,368 votes for Biden + Leelanau, Michigan 8,793 votes for Biden - 7,915 votes for Trump - - - Lenawee, Michigan + 7,915 votes for Trump + Lenawee, Michigan 31,539 votes for Trump - 20,916 votes for Biden - - - Livingston, Michigan + 20,916 votes for Biden + Livingston, Michigan 76,982 votes for Trump - 48,220 votes for Biden - - - Luce, Michigan + 48,220 votes for Biden + Luce, Michigan 2,109 votes for Trump - 842 votes for Biden - - - Mackinac, Michigan + 842 votes for Biden + Mackinac, Michigan 4,304 votes for Trump - 2,632 votes for Biden - - - Macomb, Michigan + 2,632 votes for Biden + Macomb, Michigan 264,535 votes for Trump - 225,561 votes for Biden - - - Manistee, Michigan + 225,561 votes for Biden + Manistee, Michigan 8,321 votes for Trump - 6,107 votes for Biden - - - Marquette, Michigan + 6,107 votes for Biden + Marquette, Michigan 20,465 votes for Biden - 16,288 votes for Trump - - - Mason, Michigan + 16,288 votes for Trump + Mason, Michigan 10,207 votes for Trump - 6,802 votes for Biden - - - Mecosta, Michigan + 6,802 votes for Biden + Mecosta, Michigan 13,265 votes for Trump - 7,373 votes for Biden - - - Menominee, Michigan + 7,373 votes for Biden + Menominee, Michigan 8,120 votes for Trump - 4,314 votes for Biden - - - Midland, Michigan + 4,314 votes for Biden + Midland, Michigan 27,675 votes for Trump - 20,493 votes for Biden - - - Missaukee, Michigan + 20,493 votes for Biden + Missaukee, Michigan 6,648 votes for Trump - 1,967 votes for Biden - - - Monroe, Michigan + 1,967 votes for Biden + Monroe, Michigan 52,710 votes for Trump - 32,975 votes for Biden - - - Montcalm, Michigan + 32,975 votes for Biden + Montcalm, Michigan 21,815 votes for Trump - 9,703 votes for Biden - - - Montmorency, Michigan + 9,703 votes for Biden + Montmorency, Michigan 4,171 votes for Trump - 1,628 votes for Biden - - - Muskegon, Michigan + 1,628 votes for Biden + Muskegon, Michigan 45,508 votes for Biden - 44,544 votes for Trump - - - Newaygo, Michigan + 44,544 votes for Trump + Newaygo, Michigan 18,864 votes for Trump - 7,874 votes for Biden - - - Oakland, Michigan + 7,874 votes for Biden + Oakland, Michigan 433,982 votes for Biden - 325,916 votes for Trump - - - Oceana, Michigan + 325,916 votes for Trump + Oceana, Michigan 8,892 votes for Trump - 4,944 votes for Biden - - - Ogemaw, Michigan + 4,944 votes for Biden + Ogemaw, Michigan 8,253 votes for Trump - 3,475 votes for Biden - - - Ontonagon, Michigan + 3,475 votes for Biden + Ontonagon, Michigan 2,358 votes for Trump - 1,391 votes for Biden - - - Osceola, Michigan + 1,391 votes for Biden + Osceola, Michigan 8,928 votes for Trump - 3,214 votes for Biden - - - Oscoda, Michigan + 3,214 votes for Biden + Oscoda, Michigan 3,466 votes for Trump - 1,342 votes for Biden - - - Otsego, Michigan + 1,342 votes for Biden + Otsego, Michigan 9,779 votes for Trump - 4,743 votes for Biden - - - Ottawa, Michigan + 4,743 votes for Biden + Ottawa, Michigan 100,913 votes for Trump - 64,705 votes for Biden - - - Presque Isle, Michigan + 64,705 votes for Biden + Presque Isle, Michigan 5,343 votes for Trump - 2,912 votes for Biden - - - Roscommon, Michigan + 2,912 votes for Biden + Roscommon, Michigan 9,670 votes for Trump - 5,166 votes for Biden - - - Saginaw, Michigan + 5,166 votes for Biden + Saginaw, Michigan 51,088 votes for Biden - 50,785 votes for Trump - - - Sanilac, Michigan + 50,785 votes for Trump + Sanilac, Michigan 16,194 votes for Trump - 5,966 votes for Biden - - - Schoolcraft, Michigan + 5,966 votes for Biden + Schoolcraft, Michigan 3,090 votes for Trump - 1,589 votes for Biden - - - Shiawassee, Michigan + 1,589 votes for Biden + Shiawassee, Michigan 23,154 votes for Trump - 15,371 votes for Biden - - - St. Clair, Michigan + 15,371 votes for Biden + St. Clair, Michigan 59,186 votes for Trump - 31,363 votes for Biden - - - St. Joseph, Michigan + 31,363 votes for Biden + St. Joseph, Michigan 18,128 votes for Trump - 9,262 votes for Biden - - - Tuscola, Michigan + 9,262 votes for Biden + Tuscola, Michigan 20,310 votes for Trump - 8,713 votes for Biden - - - Van Buren, Michigan + 8,713 votes for Biden + Van Buren, Michigan 21,591 votes for Trump - 16,803 votes for Biden - - - Washtenaw, Michigan + 16,803 votes for Biden + Washtenaw, Michigan 157,130 votes for Biden - 56,241 votes for Trump - - - Wayne, Michigan + 56,241 votes for Trump + Wayne, Michigan 597,170 votes for Biden - 264,553 votes for Trump - - - Wexford, Michigan + 264,553 votes for Trump + Wexford, Michigan 12,102 votes for Trump - 5,838 votes for Biden - - - Barbour, West Virginia + 5,838 votes for Biden + Barbour, West Virginia 5,116 votes for Trump - 1,457 votes for Biden - - - Berkeley, West Virginia + 1,457 votes for Biden + Berkeley, West Virginia 33,279 votes for Trump - 17,186 votes for Biden - - - Boone, West Virginia + 17,186 votes for Biden + Boone, West Virginia 6,816 votes for Trump - 2,041 votes for Biden - - - Braxton, West Virginia + 2,041 votes for Biden + Braxton, West Virginia 4,120 votes for Trump - 1,457 votes for Biden - - - Brooke, West Virginia + 1,457 votes for Biden + Brooke, West Virginia 7,545 votes for Trump - 2,947 votes for Biden - - - Cabell, West Virginia + 2,947 votes for Biden + Cabell, West Virginia 21,721 votes for Trump - 14,994 votes for Biden - - - Calhoun, West Virginia + 14,994 votes for Biden + Calhoun, West Virginia 2,364 votes for Trump - 568 votes for Biden - - - Clay, West Virginia + 568 votes for Biden + Clay, West Virginia 2,679 votes for Trump - 641 votes for Biden - - - Doddridge, West Virginia + 641 votes for Biden + Doddridge, West Virginia 2,619 votes for Trump - 435 votes for Biden - - - Fayette, West Virginia + 435 votes for Biden + Fayette, West Virginia 11,580 votes for Trump - 5,063 votes for Biden - - - Gilmer, West Virginia + 5,063 votes for Biden + Gilmer, West Virginia 2,012 votes for Trump - 599 votes for Biden - - - Grant, West Virginia + 599 votes for Biden + Grant, West Virginia 4,871 votes for Trump - 607 votes for Biden - - - Greenbrier, West Virginia + 607 votes for Biden + Greenbrier, West Virginia 10,925 votes for Trump - 4,655 votes for Biden - - - Hampshire, West Virginia + 4,655 votes for Biden + Hampshire, West Virginia 8,033 votes for Trump - 1,939 votes for Biden - - - Hancock, West Virginia + 1,939 votes for Biden + Hancock, West Virginia 9,806 votes for Trump - 3,790 votes for Biden - - - Hardy, West Virginia + 3,790 votes for Biden + Hardy, West Virginia 4,859 votes for Trump - 1,381 votes for Biden - - - Harrison, West Virginia + 1,381 votes for Biden + Harrison, West Virginia 20,683 votes for Trump - 9,215 votes for Biden - - - Jackson, West Virginia + 9,215 votes for Biden + Jackson, West Virginia 10,093 votes for Trump - 3,207 votes for Biden - - - Jefferson, West Virginia + 3,207 votes for Biden + Jefferson, West Virginia 15,033 votes for Trump - 12,127 votes for Biden - - - Kanawha, West Virginia + 12,127 votes for Biden + Kanawha, West Virginia 46,398 votes for Trump - 34,344 votes for Biden - - - Lewis, West Virginia + 34,344 votes for Biden + Lewis, West Virginia 5,782 votes for Trump - 1,538 votes for Biden - - - Lincoln, West Virginia + 1,538 votes for Biden + Lincoln, West Virginia 6,012 votes for Trump - 1,711 votes for Biden - - - Logan, West Virginia + 1,711 votes for Biden + Logan, West Virginia 10,534 votes for Trump - 2,333 votes for Biden - - - Marion, West Virginia + 2,333 votes for Biden + Marion, West Virginia 16,300 votes for Trump - 8,901 votes for Biden - - - Marshall, West Virginia + 8,901 votes for Biden + Marshall, West Virginia 10,435 votes for Trump - 3,455 votes for Biden - - - Mason, West Virginia + 3,455 votes for Biden + Mason, West Virginia 8,422 votes for Trump - 2,511 votes for Biden - - - McDowell, West Virginia + 2,511 votes for Biden + McDowell, West Virginia 5,148 votes for Trump - 1,333 votes for Biden - - - Mercer, West Virginia + 1,333 votes for Biden + Mercer, West Virginia 19,237 votes for Trump - 5,556 votes for Biden - - - Mineral, West Virginia + 5,556 votes for Biden + Mineral, West Virginia 10,040 votes for Trump - 2,660 votes for Biden - - - Mingo, West Virginia + 2,660 votes for Biden + Mingo, West Virginia 8,521 votes for Trump - 1,385 votes for Biden - - - Monongalia, West Virginia + 1,385 votes for Biden + Monongalia, West Virginia 20,803 votes for Trump - 20,282 votes for Biden - - - Monroe, West Virginia + 20,282 votes for Biden + Monroe, West Virginia 5,068 votes for Trump - 1,345 votes for Biden - - - Morgan, West Virginia + 1,345 votes for Biden + Morgan, West Virginia 6,537 votes for Trump - 1,998 votes for Biden - - - Nicholas, West Virginia + 1,998 votes for Biden + Nicholas, West Virginia 8,279 votes for Trump - 2,226 votes for Biden - - - Ohio, West Virginia + 2,226 votes for Biden + Ohio, West Virginia 12,354 votes for Trump - 7,223 votes for Biden - - - Pendleton, West Virginia + 7,223 votes for Biden + Pendleton, West Virginia 2,782 votes for Trump - 820 votes for Biden - - - Pleasants, West Virginia + 820 votes for Biden + Pleasants, West Virginia 2,742 votes for Trump - 699 votes for Biden - - - Pocahontas, West Virginia + 699 votes for Biden + Pocahontas, West Virginia 2,895 votes for Trump - 1,047 votes for Biden - - - Preston, West Virginia + 1,047 votes for Biden + Preston, West Virginia 11,190 votes for Trump - 3,163 votes for Biden - - - Putnam, West Virginia + 3,163 votes for Biden + Putnam, West Virginia 20,034 votes for Trump - 7,878 votes for Biden - - - Raleigh, West Virginia + 7,878 votes for Biden + Raleigh, West Virginia 24,673 votes for Trump - 7,982 votes for Biden - - - Randolph, West Virginia + 7,982 votes for Biden + Randolph, West Virginia 8,673 votes for Trump - 3,362 votes for Biden - - - Ritchie, West Virginia + 3,362 votes for Biden + Ritchie, West Virginia 3,649 votes for Trump - 586 votes for Biden - - - Roane, West Virginia + 586 votes for Biden + Roane, West Virginia 4,213 votes for Trump - 1,455 votes for Biden - - - Summers, West Virginia + 1,455 votes for Biden + Summers, West Virginia 4,074 votes for Trump - 1,448 votes for Biden - - - Taylor, West Virginia + 1,448 votes for Biden + Taylor, West Virginia 5,477 votes for Trump - 1,796 votes for Biden - - - Tucker, West Virginia + 1,796 votes for Biden + Tucker, West Virginia 2,841 votes for Trump - 938 votes for Biden - - - Tyler, West Virginia + 938 votes for Biden + Tyler, West Virginia 3,226 votes for Trump - 631 votes for Biden - - - Upshur, West Virginia + 631 votes for Biden + Upshur, West Virginia 7,771 votes for Trump - 2,256 votes for Biden - - - Wayne, West Virginia + 2,256 votes for Biden + Wayne, West Virginia 12,585 votes for Trump - 4,088 votes for Biden - - - Webster, West Virginia + 4,088 votes for Biden + Webster, West Virginia 2,759 votes for Trump - 610 votes for Biden - - - Wetzel, West Virginia + 610 votes for Biden + Wetzel, West Virginia 4,993 votes for Trump - 1,539 votes for Biden - - - Wirt, West Virginia + 1,539 votes for Biden + Wirt, West Virginia 2,134 votes for Trump - 466 votes for Biden - - - Wood, West Virginia + 466 votes for Biden + Wood, West Virginia 26,963 votes for Trump - 10,816 votes for Biden - - - Wyoming, West Virginia + 10,816 votes for Biden + Wyoming, West Virginia 7,353 votes for Trump - 1,157 votes for Biden - - - Accomack, Virginia + 1,157 votes for Biden + Accomack, Virginia 9,172 votes for Trump - 7,578 votes for Biden - - - Albemarle, Virginia + 7,578 votes for Biden + Albemarle, Virginia 42,466 votes for Biden - 20,804 votes for Trump - - - Alexandria, Virginia + 20,804 votes for Trump + Alexandria, Virginia 66,240 votes for Biden - 14,544 votes for Trump - - - Alleghany, Virginia + 14,544 votes for Trump + Alleghany, Virginia 5,859 votes for Trump - 2,243 votes for Biden - - - Amelia, Virginia + 2,243 votes for Biden + Amelia, Virginia 5,390 votes for Trump - 2,411 votes for Biden - - - Amherst, Virginia + 2,411 votes for Biden + Amherst, Virginia 11,041 votes for Trump - 5,672 votes for Biden - - - Appomattox, Virginia + 5,672 votes for Biden + Appomattox, Virginia 6,702 votes for Trump - 2,418 votes for Biden - - - Arlington, Virginia + 2,418 votes for Biden + Arlington, Virginia 105,344 votes for Biden - 22,318 votes for Trump - - - Augusta, Virginia + 22,318 votes for Trump + Augusta, Virginia 30,714 votes for Trump - 10,840 votes for Biden - - - Bath, Virginia + 10,840 votes for Biden + Bath, Virginia 1,834 votes for Trump - 646 votes for Biden - - - Bedford, Virginia + 646 votes for Biden + Bedford, Virginia 35,600 votes for Trump - 12,176 votes for Biden - - - Bland, Virginia + 12,176 votes for Biden + Bland, Virginia 2,903 votes for Trump - 532 votes for Biden - - - Botetourt, Virginia + 532 votes for Biden + Botetourt, Virginia 15,099 votes for Trump - 5,700 votes for Biden - - - Bristol, Virginia + 5,700 votes for Biden + Bristol, Virginia 5,347 votes for Trump - 2,313 votes for Biden - - - Brunswick, Virginia + 2,313 votes for Biden + Brunswick, Virginia 4,552 votes for Biden - 3,357 votes for Trump - - - Buchanan, Virginia + 3,357 votes for Trump + Buchanan, Virginia 8,311 votes for Trump - 1,587 votes for Biden - - - Buckingham, Virginia + 1,587 votes for Biden + Buckingham, Virginia 4,544 votes for Trump - 3,471 votes for Biden - - - Buena Vista, Virginia + 3,471 votes for Biden + Buena Vista, Virginia 1,863 votes for Trump - 825 votes for Biden - - - Campbell, Virginia + 825 votes for Biden + Campbell, Virginia 21,245 votes for Trump - 8,070 votes for Biden - - - Caroline, Virginia + 8,070 votes for Biden + Caroline, Virginia 8,336 votes for Trump - 7,657 votes for Biden - - - Carroll, Virginia + 7,657 votes for Biden + Carroll, Virginia 12,659 votes for Trump - 2,842 votes for Biden - - - Charles City, Virginia + 2,842 votes for Biden + Charles City, Virginia 2,624 votes for Biden - 1,761 votes for Trump - - - Charlotte, Virginia + 1,761 votes for Trump + Charlotte, Virginia 3,815 votes for Trump - 2,317 votes for Biden - - - Charlottesville, Virginia + 2,317 votes for Biden + Charlottesville, Virginia 20,696 votes for Biden - 3,094 votes for Trump - - - Chesapeake, Virginia + 3,094 votes for Trump + Chesapeake, Virginia 66,377 votes for Biden - 58,180 votes for Trump - - - Chesterfield, Virginia + 58,180 votes for Trump + Chesterfield, Virginia 106,935 votes for Biden - 93,326 votes for Trump - - - Clarke, Virginia + 93,326 votes for Trump + Clarke, Virginia 5,192 votes for Trump - 3,920 votes for Biden - - - Colonial Heights, Virginia + 3,920 votes for Biden + Colonial Heights, Virginia 6,007 votes for Trump - 2,972 votes for Biden - - - Covington, Virginia + 2,972 votes for Biden + Covington, Virginia 1,580 votes for Trump - 964 votes for Biden - - - Craig, Virginia + 964 votes for Biden + Craig, Virginia 2,536 votes for Trump - 587 votes for Biden - - - Culpeper, Virginia + 587 votes for Biden + Culpeper, Virginia 16,012 votes for Trump - 10,617 votes for Biden - - - Cumberland, Virginia + 10,617 votes for Biden + Cumberland, Virginia 3,019 votes for Trump - 2,227 votes for Biden - - - Danville, Virginia + 2,227 votes for Biden + Danville, Virginia 11,710 votes for Biden - 7,428 votes for Trump - - - Dickenson, Virginia + 7,428 votes for Trump + Dickenson, Virginia 5,748 votes for Trump - 1,503 votes for Biden - - - Dinwiddie, Virginia + 1,503 votes for Biden + Dinwiddie, Virginia 8,695 votes for Trump - 6,224 votes for Biden - - - Emporia, Virginia + 6,224 votes for Biden + Emporia, Virginia 1,612 votes for Biden - 754 votes for Trump - - - Essex, Virginia + 754 votes for Trump + Essex, Virginia 3,075 votes for Trump - 3,038 votes for Biden - - - Fairfax, Virginia + 3,038 votes for Biden + Fairfax, Virginia 419,943 votes for Biden - 168,401 votes for Trump - - - Fairfax City, Virginia + 168,401 votes for Trump + Fairfax City, Virginia 9,192 votes for Biden - 4,002 votes for Trump - - - Falls Church, Virginia + 4,002 votes for Trump + Falls Church, Virginia 7,146 votes for Biden - 1,490 votes for Trump - - - Fauquier, Virginia + 1,490 votes for Trump + Fauquier, Virginia 25,106 votes for Trump - 17,565 votes for Biden - - - Floyd, Virginia + 17,565 votes for Biden + Floyd, Virginia 6,225 votes for Trump - 3,004 votes for Biden - - - Fluvanna, Virginia + 3,004 votes for Biden + Fluvanna, Virginia 8,155 votes for Trump - 7,414 votes for Biden - - - Franklin, Virginia + 7,414 votes for Biden + Franklin, Virginia 20,895 votes for Trump - 8,381 votes for Biden - - - Franklin City, Virginia + 8,381 votes for Biden + Franklin City, Virginia 2,525 votes for Biden - 1,487 votes for Trump - - - Frederick, Virginia + 1,487 votes for Trump + Frederick, Virginia 30,558 votes for Trump - 17,207 votes for Biden - - - Fredericksburg, Virginia + 17,207 votes for Biden + Fredericksburg, Virginia 8,517 votes for Biden - 4,037 votes for Trump - - - Galax, Virginia + 4,037 votes for Trump + Galax, Virginia 1,838 votes for Trump - 777 votes for Biden - - - Giles, Virginia + 777 votes for Biden + Giles, Virginia 6,876 votes for Trump - 2,156 votes for Biden - - - Gloucester, Virginia + 2,156 votes for Biden + Gloucester, Virginia 14,875 votes for Trump - 6,964 votes for Biden - - - Goochland, Virginia + 6,964 votes for Biden + Goochland, Virginia 9,966 votes for Trump - 6,685 votes for Biden - - - Grayson, Virginia + 6,685 votes for Biden + Grayson, Virginia 6,529 votes for Trump - 1,535 votes for Biden - - - Greene, Virginia + 1,535 votes for Biden + Greene, Virginia 6,866 votes for Trump - 4,163 votes for Biden - - - Greensville, Virginia + 4,163 votes for Biden + Greensville, Virginia 2,627 votes for Biden - 1,914 votes for Trump - - - Halifax, Virginia + 1,914 votes for Trump + Halifax, Virginia 10,418 votes for Trump - 7,666 votes for Biden - - - Hampton, Virginia + 7,666 votes for Biden + Hampton, Virginia 46,220 votes for Biden - 18,430 votes for Trump - - - Hanover, Virginia + 18,430 votes for Trump + Hanover, Virginia 44,318 votes for Trump - 25,307 votes for Biden - - - Harrisonburg, Virginia + 25,307 votes for Biden + Harrisonburg, Virginia 11,022 votes for Biden - 5,591 votes for Trump - - - Henrico, Virginia + 5,591 votes for Trump + Henrico, Virginia 116,572 votes for Biden - 63,440 votes for Trump - - - Henry, Virginia + 63,440 votes for Trump + Henry, Virginia 16,725 votes for Trump - 9,127 votes for Biden - - - Highland, Virginia + 9,127 votes for Biden + Highland, Virginia 1,092 votes for Trump - 417 votes for Biden - - - Hopewell, Virginia + 417 votes for Biden + Hopewell, Virginia 5,427 votes for Biden - 4,018 votes for Trump - - - Isle of Wight, Virginia + 4,018 votes for Trump + Isle of Wight, Virginia 13,707 votes for Trump - 9,399 votes for Biden - - - James City, Virginia + 9,399 votes for Biden + James City, Virginia 25,553 votes for Biden - 23,153 votes for Trump - - - King George, Virginia + 23,153 votes for Trump + King George, Virginia 8,446 votes for Trump - 5,404 votes for Biden - - - King William, Virginia + 5,404 votes for Biden + King William, Virginia 7,320 votes for Trump - 3,260 votes for Biden - - - King and Queen, Virginia + 3,260 votes for Biden + King and Queen, Virginia 2,450 votes for Trump - 1,590 votes for Biden - - - Lancaster, Virginia + 1,590 votes for Biden + Lancaster, Virginia 3,697 votes for Trump - 3,368 votes for Biden - - - Lee, Virginia + 3,368 votes for Biden + Lee, Virginia 8,365 votes for Trump - 1,489 votes for Biden - - - Lexington, Virginia + 1,489 votes for Biden + Lexington, Virginia 1,797 votes for Biden - 908 votes for Trump - - - Loudoun, Virginia + 908 votes for Trump + Loudoun, Virginia 138,372 votes for Biden - 82,088 votes for Trump - - - Louisa, Virginia + 82,088 votes for Trump + Louisa, Virginia 13,294 votes for Trump - 8,269 votes for Biden - - - Lunenburg, Virginia + 8,269 votes for Biden + Lunenburg, Virginia 3,537 votes for Trump - 2,418 votes for Biden - - - Lynchburg, Virginia + 2,418 votes for Biden + Lynchburg, Virginia 18,048 votes for Biden - 17,097 votes for Trump - - - Madison, Virginia + 17,097 votes for Trump + Madison, Virginia 5,300 votes for Trump - 2,698 votes for Biden - - - Manassas, Virginia + 2,698 votes for Biden + Manassas, Virginia 10,356 votes for Biden - 6,256 votes for Trump - - - Manassas Park, Virginia + 6,256 votes for Trump + Manassas Park, Virginia 3,913 votes for Biden - 2,062 votes for Trump - - - Martinsville, Virginia + 2,062 votes for Trump + Martinsville, Virginia 3,766 votes for Biden - 2,165 votes for Trump - - - Mathews, Virginia + 2,165 votes for Trump + Mathews, Virginia 3,901 votes for Trump - 1,825 votes for Biden - - - Mecklenburg, Virginia + 1,825 votes for Biden + Mecklenburg, Virginia 9,266 votes for Trump - 6,803 votes for Biden - - - Middlesex, Virginia + 6,803 votes for Biden + Middlesex, Virginia 4,196 votes for Trump - 2,491 votes for Biden - - - Montgomery, Virginia + 2,491 votes for Biden + Montgomery, Virginia 23,218 votes for Biden - 20,629 votes for Trump - - - Nelson, Virginia + 20,629 votes for Trump + Nelson, Virginia 4,812 votes for Trump - 4,327 votes for Biden - - - New Kent, Virginia + 4,327 votes for Biden + New Kent, Virginia 9,636 votes for Trump - 4,610 votes for Biden - - - Newport News, Virginia + 4,610 votes for Biden + Newport News, Virginia 53,099 votes for Biden - 26,377 votes for Trump - - - Norfolk, Virginia + 26,377 votes for Trump + Norfolk, Virginia 64,440 votes for Biden - 23,443 votes for Trump - - - Northampton, Virginia + 23,443 votes for Trump + Northampton, Virginia 3,667 votes for Biden - 2,955 votes for Trump - - - Northumberland, Virginia + 2,955 votes for Trump + Northumberland, Virginia 4,485 votes for Trump - 3,252 votes for Biden - - - Norton, Virginia + 3,252 votes for Biden + Norton, Virginia 1,112 votes for Trump - 464 votes for Biden - - - Nottoway, Virginia + 464 votes for Biden + Nottoway, Virginia 4,027 votes for Trump - 2,971 votes for Biden - - - Orange, Virginia + 2,971 votes for Biden + Orange, Virginia 12,426 votes for Trump - 7,995 votes for Biden - - - Page, Virginia + 7,995 votes for Biden + Page, Virginia 9,345 votes for Trump - 3,007 votes for Biden - - - Patrick, Virginia + 3,007 votes for Biden + Patrick, Virginia 7,485 votes for Trump - 1,954 votes for Biden - - - Petersburg, Virginia + 1,954 votes for Biden + Petersburg, Virginia 12,389 votes for Biden - 1,584 votes for Trump - - - Pittsylvania, Virginia + 1,584 votes for Trump + Pittsylvania, Virginia 23,751 votes for Trump - 10,115 votes for Biden - - - Poquoson, Virginia + 10,115 votes for Biden + Poquoson, Virginia 5,605 votes for Trump - 2,054 votes for Biden - - - Portsmouth, Virginia + 2,054 votes for Biden + Portsmouth, Virginia 30,948 votes for Biden - 12,755 votes for Trump - - - Powhatan, Virginia + 12,755 votes for Trump + Powhatan, Virginia 14,055 votes for Trump - 5,320 votes for Biden - - - Prince Edward, Virginia + 5,320 votes for Biden + Prince Edward, Virginia 4,973 votes for Biden - 4,434 votes for Trump - - - Prince George, Virginia + 4,434 votes for Trump + Prince George, Virginia 10,103 votes for Trump - 7,103 votes for Biden - - - Prince William, Virginia + 7,103 votes for Biden + Prince William, Virginia 142,863 votes for Biden - 81,222 votes for Trump - - - Pulaski, Virginia + 81,222 votes for Trump + Pulaski, Virginia 12,127 votes for Trump - 4,925 votes for Biden - - - Radford, Virginia + 4,925 votes for Biden + Radford, Virginia 3,358 votes for Biden - 2,786 votes for Trump - - - Rappahannock, Virginia + 2,786 votes for Trump + Rappahannock, Virginia 2,812 votes for Trump - 2,096 votes for Biden - - - Richmond, Virginia + 2,096 votes for Biden + Richmond, Virginia 2,547 votes for Trump - 1,513 votes for Biden - - - Richmond City, Virginia + 1,513 votes for Biden + Richmond City, Virginia 92,175 votes for Biden - 16,603 votes for Trump - - - Roanoke, Virginia + 16,603 votes for Trump + Roanoke, Virginia 34,268 votes for Trump - 22,261 votes for Biden - - - Roanoke City, Virginia + 22,261 votes for Biden + Roanoke City, Virginia 26,773 votes for Biden - 15,607 votes for Trump - - - Rockbridge, Virginia + 15,607 votes for Trump + Rockbridge, Virginia 8,047 votes for Trump - 4,022 votes for Biden - - - Rockingham, Virginia + 4,022 votes for Biden + Rockingham, Virginia 30,349 votes for Trump - 12,644 votes for Biden - - - Russell, Virginia + 12,644 votes for Biden + Russell, Virginia 10,879 votes for Trump - 2,373 votes for Biden - - - Salem, Virginia + 2,373 votes for Biden + Salem, Virginia 7,685 votes for Trump - 5,148 votes for Biden - - - Scott, Virginia + 5,148 votes for Biden + Scott, Virginia 9,063 votes for Trump - 1,692 votes for Biden - - - Shenandoah, Virginia + 1,692 votes for Biden + Shenandoah, Virginia 16,463 votes for Trump - 6,836 votes for Biden - - - Smyth, Virginia + 6,836 votes for Biden + Smyth, Virginia 10,963 votes for Trump - 3,008 votes for Biden - - - Southampton, Virginia + 3,008 votes for Biden + Southampton, Virginia 5,730 votes for Trump - 3,969 votes for Biden - - - Spotsylvania, Virginia + 3,969 votes for Biden + Spotsylvania, Virginia 39,506 votes for Trump - 34,385 votes for Biden - - - Stafford, Virginia + 34,385 votes for Biden + Stafford, Virginia 40,245 votes for Biden - 37,636 votes for Trump - - - Staunton, Virginia + 37,636 votes for Trump + Staunton, Virginia 6,981 votes for Biden - 5,695 votes for Trump - - - Suffolk, Virginia + 5,695 votes for Trump + Suffolk, Virginia 28,676 votes for Biden - 20,082 votes for Trump - - - Surry, Virginia + 20,082 votes for Trump + Surry, Virginia 2,397 votes for Biden - 2,025 votes for Trump - - - Sussex, Virginia + 2,025 votes for Trump + Sussex, Virginia 2,827 votes for Biden - 2,219 votes for Trump - - - Tazewell, Virginia + 2,219 votes for Trump + Tazewell, Virginia 16,731 votes for Trump - 3,205 votes for Biden - - - Virginia Beach, Virginia + 3,205 votes for Biden + Virginia Beach, Virginia 117,393 votes for Biden - 105,087 votes for Trump - - - Warren, Virginia + 105,087 votes for Trump + Warren, Virginia 14,069 votes for Trump - 6,603 votes for Biden - - - Washington, Virginia + 6,603 votes for Biden + Washington, Virginia 21,678 votes for Trump - 6,617 votes for Biden - - - Waynesboro, Virginia + 6,617 votes for Biden + Waynesboro, Virginia 5,507 votes for Trump - 4,961 votes for Biden - - - Westmoreland, Virginia + 4,961 votes for Biden + Westmoreland, Virginia 5,318 votes for Trump - 4,501 votes for Biden - - - Williamsburg, Virginia + 4,501 votes for Biden + Williamsburg, Virginia 4,790 votes for Biden - 1,963 votes for Trump - - - Winchester, Virginia + 1,963 votes for Trump + Winchester, Virginia 6,610 votes for Biden - 5,221 votes for Trump - - - Wise, Virginia + 5,221 votes for Trump + Wise, Virginia 13,366 votes for Trump - 3,110 votes for Biden - - - Wythe, Virginia + 3,110 votes for Biden + Wythe, Virginia 11,733 votes for Trump - 3,143 votes for Biden - - - York, Virginia + 3,143 votes for Biden + York, Virginia 20,241 votes for Trump - 17,683 votes for Biden - - - Adams, Wisconsin + 17,683 votes for Biden + Adams, Wisconsin 7,362 votes for Trump - 4,329 votes for Biden - - - Ashland, Wisconsin + 4,329 votes for Biden + Ashland, Wisconsin 4,801 votes for Biden - 3,841 votes for Trump - - - Barron, Wisconsin + 3,841 votes for Trump + Barron, Wisconsin 15,803 votes for Trump - 9,194 votes for Biden - - - Bayfield, Wisconsin + 9,194 votes for Biden + Bayfield, Wisconsin 6,147 votes for Biden - 4,617 votes for Trump - - - Brown, Wisconsin + 4,617 votes for Trump + Brown, Wisconsin 75,871 votes for Trump - 65,511 votes for Biden - - - Buffalo, Wisconsin + 65,511 votes for Biden + Buffalo, Wisconsin 4,834 votes for Trump - 2,860 votes for Biden - - - Burnett, Wisconsin + 2,860 votes for Biden + Burnett, Wisconsin 6,462 votes for Trump - 3,569 votes for Biden - - - Calumet, Wisconsin + 3,569 votes for Biden + Calumet, Wisconsin 18,156 votes for Trump - 12,116 votes for Biden - - - Chippewa, Wisconsin + 12,116 votes for Biden + Chippewa, Wisconsin 21,317 votes for Trump - 13,983 votes for Biden - - - Clark, Wisconsin + 13,983 votes for Biden + Clark, Wisconsin 10,002 votes for Trump - 4,524 votes for Biden - - - Columbia, Wisconsin + 4,524 votes for Biden + Columbia, Wisconsin 16,927 votes for Trump - 16,410 votes for Biden - - - Crawford, Wisconsin + 16,410 votes for Biden + Crawford, Wisconsin 4,620 votes for Trump - 3,953 votes for Biden - - - Dane, Wisconsin + 3,953 votes for Biden + Dane, Wisconsin 260,185 votes for Biden - 78,800 votes for Trump - - - Dodge, Wisconsin + 78,800 votes for Trump + Dodge, Wisconsin 31,355 votes for Trump - 16,356 votes for Biden - - - Door, Wisconsin + 16,356 votes for Biden + Door, Wisconsin 10,044 votes for Biden - 9,752 votes for Trump - - - Douglas, Wisconsin + 9,752 votes for Trump + Douglas, Wisconsin 13,218 votes for Biden - 10,923 votes for Trump - - - Dunn, Wisconsin + 10,923 votes for Trump + Dunn, Wisconsin 13,173 votes for Trump - 9,897 votes for Biden - - - Eau Claire, Wisconsin + 9,897 votes for Biden + Eau Claire, Wisconsin 31,620 votes for Biden - 25,341 votes for Trump - - - Florence, Wisconsin + 25,341 votes for Trump + Florence, Wisconsin 2,133 votes for Trump - 781 votes for Biden - - - Fond du Lac, Wisconsin + 781 votes for Biden + Fond du Lac, Wisconsin 35,754 votes for Trump - 20,588 votes for Biden - - - Forest, Wisconsin + 20,588 votes for Biden + Forest, Wisconsin 3,285 votes for Trump - 1,721 votes for Biden - - - Grant, Wisconsin + 1,721 votes for Biden + Grant, Wisconsin 14,142 votes for Trump - 10,998 votes for Biden - - - Green, Wisconsin + 10,998 votes for Biden + Green, Wisconsin 10,851 votes for Biden - 10,169 votes for Trump - - - Green Lake, Wisconsin + 10,169 votes for Trump + Green Lake, Wisconsin 7,168 votes for Trump - 3,344 votes for Biden - - - Iowa, Wisconsin + 3,344 votes for Biden + Iowa, Wisconsin 7,828 votes for Biden - 5,909 votes for Trump - - - Iron, Wisconsin + 5,909 votes for Trump + Iron, Wisconsin 2,438 votes for Trump - 1,533 votes for Biden - - - Jackson, Wisconsin + 1,533 votes for Biden + Jackson, Wisconsin 5,791 votes for Trump - 4,256 votes for Biden - - - Jefferson, Wisconsin + 4,256 votes for Biden + Jefferson, Wisconsin 27,208 votes for Trump - 19,904 votes for Biden - - - Juneau, Wisconsin + 19,904 votes for Biden + Juneau, Wisconsin 8,749 votes for Trump - 4,746 votes for Biden - - - Kenosha, Wisconsin + 4,746 votes for Biden + Kenosha, Wisconsin 44,972 votes for Trump - 42,193 votes for Biden - - - Kewaunee, Wisconsin + 42,193 votes for Biden + Kewaunee, Wisconsin 7,927 votes for Trump - 3,976 votes for Biden - - - La Crosse, Wisconsin + 3,976 votes for Biden + La Crosse, Wisconsin 37,846 votes for Biden - 28,684 votes for Trump - - - Lafayette, Wisconsin + 28,684 votes for Trump + Lafayette, Wisconsin 4,821 votes for Trump - 3,647 votes for Biden - - - Langlade, Wisconsin + 3,647 votes for Biden + Langlade, Wisconsin 7,330 votes for Trump - 3,704 votes for Biden - - - Lincoln, Wisconsin + 3,704 votes for Biden + Lincoln, Wisconsin 10,017 votes for Trump - 6,261 votes for Biden - - - Manitowoc, Wisconsin + 6,261 votes for Biden + Manitowoc, Wisconsin 27,218 votes for Trump - 16,818 votes for Biden - - - Marathon, Wisconsin + 16,818 votes for Biden + Marathon, Wisconsin 44,624 votes for Trump - 30,808 votes for Biden - - - Marinette, Wisconsin + 30,808 votes for Biden + Marinette, Wisconsin 15,304 votes for Trump - 7,366 votes for Biden - - - Marquette, Wisconsin + 7,366 votes for Biden + Marquette, Wisconsin 5,719 votes for Trump - 3,239 votes for Biden - - - Menominee, Wisconsin + 3,239 votes for Biden + Menominee, Wisconsin 1,303 votes for Biden - 278 votes for Trump - - - Milwaukee, Wisconsin + 278 votes for Trump + Milwaukee, Wisconsin 317,270 votes for Biden - 134,357 votes for Trump - - - Monroe, Wisconsin + 134,357 votes for Trump + Monroe, Wisconsin 13,775 votes for Trump - 8,433 votes for Biden - - - Oconto, Wisconsin + 8,433 votes for Biden + Oconto, Wisconsin 16,226 votes for Trump - 6,715 votes for Biden - - - Oneida, Wisconsin + 6,715 votes for Biden + Oneida, Wisconsin 13,671 votes for Trump - 10,105 votes for Biden - - - Outagamie, Wisconsin + 10,105 votes for Biden + Outagamie, Wisconsin 58,385 votes for Trump - 47,667 votes for Biden - - - Ozaukee, Wisconsin + 47,667 votes for Biden + Ozaukee, Wisconsin 33,912 votes for Trump - 26,517 votes for Biden - - - Pepin, Wisconsin + 26,517 votes for Biden + Pepin, Wisconsin 2,584 votes for Trump - 1,489 votes for Biden - - - Pierce, Wisconsin + 1,489 votes for Biden + Pierce, Wisconsin 12,903 votes for Trump - 9,839 votes for Biden - - - Polk, Wisconsin + 9,839 votes for Biden + Polk, Wisconsin 16,611 votes for Trump - 9,370 votes for Biden - - - Portage, Wisconsin + 9,370 votes for Biden + Portage, Wisconsin 20,428 votes for Biden - 19,299 votes for Trump - - - Price, Wisconsin + 19,299 votes for Trump + Price, Wisconsin 5,394 votes for Trump - 3,032 votes for Biden - - - Racine, Wisconsin + 3,032 votes for Biden + Racine, Wisconsin 54,479 votes for Trump - 50,159 votes for Biden - - - Richland, Wisconsin + 50,159 votes for Biden + Richland, Wisconsin 4,871 votes for Trump - 3,995 votes for Biden - - - Rock, Wisconsin + 3,995 votes for Biden + Rock, Wisconsin 46,658 votes for Biden - 37,138 votes for Trump - - - Rusk, Wisconsin + 37,138 votes for Trump + Rusk, Wisconsin 5,257 votes for Trump - 2,517 votes for Biden - - - Sauk, Wisconsin + 2,517 votes for Biden + Sauk, Wisconsin 18,108 votes for Biden - 17,493 votes for Trump - - - Sawyer, Wisconsin + 17,493 votes for Trump + Sawyer, Wisconsin 5,909 votes for Trump - 4,498 votes for Biden - - - Shawano, Wisconsin + 4,498 votes for Biden + Shawano, Wisconsin 15,173 votes for Trump - 7,131 votes for Biden - - - Sheboygan, Wisconsin + 7,131 votes for Biden + Sheboygan, Wisconsin 37,609 votes for Trump - 27,101 votes for Biden - - - St. Croix, Wisconsin + 27,101 votes for Biden + St. Croix, Wisconsin 32,199 votes for Trump - 23,190 votes for Biden - - - Taylor, Wisconsin + 23,190 votes for Biden + Taylor, Wisconsin 7,655 votes for Trump - 2,693 votes for Biden - - - Trempealeau, Wisconsin + 2,693 votes for Biden + Trempealeau, Wisconsin 8,833 votes for Trump - 6,285 votes for Biden - - - Vernon, Wisconsin + 6,285 votes for Biden + Vernon, Wisconsin 8,218 votes for Trump - 7,457 votes for Biden - - - Vilas, Wisconsin + 7,457 votes for Biden + Vilas, Wisconsin 9,261 votes for Trump - 5,903 votes for Biden - - - Walworth, Wisconsin + 5,903 votes for Biden + Walworth, Wisconsin 33,851 votes for Trump - 22,789 votes for Biden - - - Washburn, Wisconsin + 22,789 votes for Biden + Washburn, Wisconsin 6,334 votes for Trump - 3,867 votes for Biden - - - Washington, Wisconsin + 3,867 votes for Biden + Washington, Wisconsin 60,237 votes for Trump - 26,650 votes for Biden - - - Waukesha, Wisconsin + 26,650 votes for Biden + Waukesha, Wisconsin 159,649 votes for Trump - 103,906 votes for Biden - - - Waupaca, Wisconsin + 103,906 votes for Biden + Waupaca, Wisconsin 18,952 votes for Trump - 9,703 votes for Biden - - - Waushara, Wisconsin + 9,703 votes for Biden + Waushara, Wisconsin 9,016 votes for Trump - 4,388 votes for Biden - - - Winnebago, Wisconsin + 4,388 votes for Biden + Winnebago, Wisconsin 47,796 votes for Trump - 44,060 votes for Biden - - - Wood, Wisconsin + 44,060 votes for Biden + Wood, Wisconsin 24,308 votes for Trump - 16,365 votes for Biden - - - Adair, Kentucky + 16,365 votes for Biden + Adair, Kentucky 7,275 votes for Trump - 1,391 votes for Biden - - - Allen, Kentucky + 1,391 votes for Biden + Allen, Kentucky 7,586 votes for Trump - 1,642 votes for Biden - - - Anderson, Kentucky + 1,642 votes for Biden + Anderson, Kentucky 9,651 votes for Trump - 3,339 votes for Biden - - - Ballard, Kentucky + 3,339 votes for Biden + Ballard, Kentucky 3,356 votes for Trump - 825 votes for Biden - - - Barren, Kentucky + 825 votes for Biden + Barren, Kentucky 14,646 votes for Trump - 5,115 votes for Biden - - - Bath, Kentucky + 5,115 votes for Biden + Bath, Kentucky 3,986 votes for Trump - 1,573 votes for Biden - - - Bell, Kentucky + 1,573 votes for Biden + Bell, Kentucky 8,140 votes for Trump - 1,789 votes for Biden - - - Boone, Kentucky + 1,789 votes for Biden + Boone, Kentucky 44,811 votes for Trump - 20,897 votes for Biden - - - Bourbon, Kentucky + 20,897 votes for Biden + Bourbon, Kentucky 6,190 votes for Trump - 3,296 votes for Biden - - - Boyd, Kentucky + 3,296 votes for Biden + Boyd, Kentucky 14,295 votes for Trump - 7,083 votes for Biden - - - Boyle, Kentucky + 7,083 votes for Biden + Boyle, Kentucky 8,872 votes for Trump - 5,298 votes for Biden - - - Bracken, Kentucky + 5,298 votes for Biden + Bracken, Kentucky 3,397 votes for Trump - 799 votes for Biden - - - Breathitt, Kentucky + 799 votes for Biden + Breathitt, Kentucky 4,265 votes for Trump - 1,301 votes for Biden - - - Breckinridge, Kentucky + 1,301 votes for Biden + Breckinridge, Kentucky 7,701 votes for Trump - 2,350 votes for Biden - - - Bullitt, Kentucky + 2,350 votes for Biden + Bullitt, Kentucky 30,708 votes for Trump - 10,551 votes for Biden - - - Butler, Kentucky + 10,551 votes for Biden + Butler, Kentucky 4,960 votes for Trump - 1,078 votes for Biden - - - Caldwell, Kentucky + 1,078 votes for Biden + Caldwell, Kentucky 4,905 votes for Trump - 1,432 votes for Biden - - - Calloway, Kentucky + 1,432 votes for Biden + Calloway, Kentucky 11,351 votes for Trump - 5,794 votes for Biden - - - Campbell, Kentucky + 5,794 votes for Biden + Campbell, Kentucky 28,482 votes for Trump - 19,373 votes for Biden - - - Carlisle, Kentucky + 19,373 votes for Biden + Carlisle, Kentucky 2,159 votes for Trump - 463 votes for Biden - - - Carroll, Kentucky + 463 votes for Biden + Carroll, Kentucky 2,954 votes for Trump - 1,116 votes for Biden - - - Carter, Kentucky + 1,116 votes for Biden + Carter, Kentucky 8,775 votes for Trump - 2,642 votes for Biden - - - Casey, Kentucky + 2,642 votes for Biden + Casey, Kentucky 6,179 votes for Trump - 918 votes for Biden - - - Christian, Kentucky + 918 votes for Biden + Christian, Kentucky 15,080 votes for Trump - 8,296 votes for Biden - - - Clark, Kentucky + 8,296 votes for Biden + Clark, Kentucky 11,811 votes for Trump - 6,004 votes for Biden - - - Clay, Kentucky + 6,004 votes for Biden + Clay, Kentucky 6,677 votes for Trump - 831 votes for Biden - - - Clinton, Kentucky + 831 votes for Biden + Clinton, Kentucky 4,280 votes for Trump - 603 votes for Biden - - - Crittenden, Kentucky + 603 votes for Biden + Crittenden, Kentucky 3,451 votes for Trump - 731 votes for Biden - - - Cumberland, Kentucky + 731 votes for Biden + Cumberland, Kentucky 2,769 votes for Trump - 508 votes for Biden - - - Daviess, Kentucky + 508 votes for Biden + Daviess, Kentucky 31,023 votes for Trump - 17,283 votes for Biden - - - Edmonson, Kentucky + 17,283 votes for Biden + Edmonson, Kentucky 4,828 votes for Trump - 1,227 votes for Biden - - - Elliott, Kentucky + 1,227 votes for Biden + Elliott, Kentucky 2,246 votes for Trump - 712 votes for Biden - - - Estill, Kentucky + 712 votes for Biden + Estill, Kentucky 5,100 votes for Trump - 1,355 votes for Biden - - - Fayette, Kentucky + 1,355 votes for Biden + Fayette, Kentucky 90,566 votes for Biden - 58,845 votes for Trump - - - Fleming, Kentucky + 58,845 votes for Trump + Fleming, Kentucky 5,534 votes for Trump - 1,474 votes for Biden - - - Floyd, Kentucky + 1,474 votes for Biden + Floyd, Kentucky 12,211 votes for Trump - 3,855 votes for Biden - - - Franklin, Kentucky + 3,855 votes for Biden + Franklin, Kentucky 12,900 votes for Trump - 12,650 votes for Biden - - - Fulton, Kentucky + 12,650 votes for Biden + Fulton, Kentucky 1,605 votes for Trump - 791 votes for Biden - - - Gallatin, Kentucky + 791 votes for Biden + Gallatin, Kentucky 2,955 votes for Trump - 822 votes for Biden - - - Garrard, Kentucky + 822 votes for Biden + Garrard, Kentucky 6,754 votes for Trump - 1,830 votes for Biden - - - Grant, Kentucky + 1,830 votes for Biden + Grant, Kentucky 8,725 votes for Trump - 2,205 votes for Biden - - - Graves, Kentucky + 2,205 votes for Biden + Graves, Kentucky 13,206 votes for Trump - 3,559 votes for Biden - - - Grayson, Kentucky + 3,559 votes for Biden + Grayson, Kentucky 9,453 votes for Trump - 2,400 votes for Biden - - - Green, Kentucky + 2,400 votes for Biden + Green, Kentucky 4,838 votes for Trump - 920 votes for Biden - - - Greenup, Kentucky + 920 votes for Biden + Greenup, Kentucky 13,064 votes for Trump - 4,873 votes for Biden - - - Hancock, Kentucky + 4,873 votes for Biden + Hancock, Kentucky 3,145 votes for Trump - 1,351 votes for Biden - - - Hardin, Kentucky + 1,351 votes for Biden + Hardin, Kentucky 29,832 votes for Trump - 18,101 votes for Biden - - - Harlan, Kentucky + 18,101 votes for Biden + Harlan, Kentucky 9,367 votes for Trump - 1,494 votes for Biden - - - Harrison, Kentucky + 1,494 votes for Biden + Harrison, Kentucky 6,334 votes for Trump - 2,400 votes for Biden - - - Hart, Kentucky + 2,400 votes for Biden + Hart, Kentucky 6,345 votes for Trump - 1,908 votes for Biden - - - Henderson, Kentucky + 1,908 votes for Biden + Henderson, Kentucky 12,730 votes for Trump - 7,639 votes for Biden - - - Henry, Kentucky + 7,639 votes for Biden + Henry, Kentucky 5,843 votes for Trump - 2,142 votes for Biden - - - Hickman, Kentucky + 2,142 votes for Biden + Hickman, Kentucky 1,714 votes for Trump - 458 votes for Biden - - - Hopkins, Kentucky + 458 votes for Biden + Hopkins, Kentucky 15,757 votes for Trump - 5,439 votes for Biden - - - Jackson, Kentucky + 5,439 votes for Biden + Jackson, Kentucky 5,450 votes for Trump - 605 votes for Biden - - - Jefferson, Kentucky + 605 votes for Biden + Jefferson, Kentucky 228,288 votes for Biden - 150,619 votes for Trump - - - Jessamine, Kentucky + 150,619 votes for Trump + Jessamine, Kentucky 17,096 votes for Trump - 8,567 votes for Biden - - - Johnson, Kentucky + 8,567 votes for Biden + Johnson, Kentucky 8,446 votes for Trump - 1,607 votes for Biden - - - Kenton, Kentucky + 1,607 votes for Biden + Kenton, Kentucky 48,123 votes for Trump - 32,265 votes for Biden - - - Knott, Kentucky + 32,265 votes for Biden + Knott, Kentucky 4,779 votes for Trump - 1,412 votes for Biden - - - Knox, Kentucky + 1,412 votes for Biden + Knox, Kentucky 11,010 votes for Trump - 2,111 votes for Biden - - - LaRue, Kentucky + 2,111 votes for Biden + LaRue, Kentucky 5,685 votes for Trump - 1,504 votes for Biden - - - Laurel, Kentucky + 1,504 votes for Biden + Laurel, Kentucky 23,234 votes for Trump - 4,474 votes for Biden - - - Lawrence, Kentucky + 4,474 votes for Biden + Lawrence, Kentucky 5,633 votes for Trump - 1,238 votes for Biden - - - Lee, Kentucky + 1,238 votes for Biden + Lee, Kentucky 2,159 votes for Trump - 459 votes for Biden - - - Leslie, Kentucky + 459 votes for Biden + Leslie, Kentucky 4,318 votes for Trump - 446 votes for Biden - - - Letcher, Kentucky + 446 votes for Biden + Letcher, Kentucky 7,226 votes for Trump - 1,799 votes for Biden - - - Lewis, Kentucky + 1,799 votes for Biden + Lewis, Kentucky 4,986 votes for Trump - 823 votes for Biden - - - Lincoln, Kentucky + 823 votes for Biden + Lincoln, Kentucky 8,489 votes for Trump - 2,254 votes for Biden - - - Livingston, Kentucky + 2,254 votes for Biden + Livingston, Kentucky 4,010 votes for Trump - 939 votes for Biden - - - Logan, Kentucky + 939 votes for Biden + Logan, Kentucky 9,067 votes for Trump - 3,094 votes for Biden - - - Lyon, Kentucky + 3,094 votes for Biden + Lyon, Kentucky 3,100 votes for Trump - 1,092 votes for Biden - - - Madison, Kentucky + 1,092 votes for Biden + Madison, Kentucky 27,353 votes for Trump - 15,580 votes for Biden - - - Magoffin, Kentucky + 15,580 votes for Biden + Magoffin, Kentucky 4,174 votes for Trump - 1,213 votes for Biden - - - Marion, Kentucky + 1,213 votes for Biden + Marion, Kentucky 6,113 votes for Trump - 2,722 votes for Biden - - - Marshall, Kentucky + 2,722 votes for Biden + Marshall, Kentucky 13,297 votes for Trump - 4,071 votes for Biden - - - Martin, Kentucky + 4,071 votes for Biden + Martin, Kentucky 3,496 votes for Trump - 403 votes for Biden - - - Mason, Kentucky + 403 votes for Biden + Mason, Kentucky 5,477 votes for Trump - 2,362 votes for Biden - - - McCracken, Kentucky + 2,362 votes for Biden + McCracken, Kentucky 21,820 votes for Trump - 11,190 votes for Biden - - - McCreary, Kentucky + 11,190 votes for Biden + McCreary, Kentucky 5,664 votes for Trump - 725 votes for Biden - - - McLean, Kentucky + 725 votes for Biden + McLean, Kentucky 3,633 votes for Trump - 1,074 votes for Biden - - - Meade, Kentucky + 1,074 votes for Biden + Meade, Kentucky 10,184 votes for Trump - 3,632 votes for Biden - - - Menifee, Kentucky + 3,632 votes for Biden + Menifee, Kentucky 2,311 votes for Trump - 750 votes for Biden - - - Mercer, Kentucky + 750 votes for Biden + Mercer, Kentucky 8,506 votes for Trump - 3,033 votes for Biden - - - Metcalfe, Kentucky + 3,033 votes for Biden + Metcalfe, Kentucky 3,957 votes for Trump - 973 votes for Biden - - - Monroe, Kentucky + 973 votes for Biden + Monroe, Kentucky 4,628 votes for Trump - 657 votes for Biden - - - Montgomery, Kentucky + 657 votes for Biden + Montgomery, Kentucky 8,993 votes for Trump - 3,630 votes for Biden - - - Morgan, Kentucky + 3,630 votes for Biden + Morgan, Kentucky 4,297 votes for Trump - 1,172 votes for Biden - - - Muhlenberg, Kentucky + 1,172 votes for Biden + Muhlenberg, Kentucky 10,496 votes for Trump - 3,544 votes for Biden - - - Nelson, Kentucky + 3,544 votes for Biden + Nelson, Kentucky 15,703 votes for Trump - 7,188 votes for Biden - - - Nicholas, Kentucky + 7,188 votes for Biden + Nicholas, Kentucky 2,407 votes for Trump - 954 votes for Biden - - - Ohio, Kentucky + 954 votes for Biden + Ohio, Kentucky 8,582 votes for Trump - 2,404 votes for Biden - - - Oldham, Kentucky + 2,404 votes for Biden + Oldham, Kentucky 22,651 votes for Trump - 14,504 votes for Biden - - - Owen, Kentucky + 14,504 votes for Biden + Owen, Kentucky 4,292 votes for Trump - 1,098 votes for Biden - - - Owsley, Kentucky + 1,098 votes for Biden + Owsley, Kentucky 1,670 votes for Trump - 216 votes for Biden - - - Pendleton, Kentucky + 216 votes for Biden + Pendleton, Kentucky 5,515 votes for Trump - 1,322 votes for Biden - - - Perry, Kentucky + 1,322 votes for Biden + Perry, Kentucky 8,118 votes for Trump - 2,350 votes for Biden - - - Pike, Kentucky + 2,350 votes for Biden + Pike, Kentucky 20,279 votes for Trump - 4,862 votes for Biden - - - Powell, Kentucky + 4,862 votes for Biden + Powell, Kentucky 4,041 votes for Trump - 1,367 votes for Biden - - - Pulaski, Kentucky + 1,367 votes for Biden + Pulaski, Kentucky 25,441 votes for Trump - 5,664 votes for Biden - - - Robertson, Kentucky + 5,664 votes for Biden + Robertson, Kentucky 884 votes for Trump - 253 votes for Biden - - - Rockcastle, Kentucky + 253 votes for Biden + Rockcastle, Kentucky 6,577 votes for Trump - 1,134 votes for Biden - - - Rowan, Kentucky + 1,134 votes for Biden + Rowan, Kentucky 5,994 votes for Trump - 3,880 votes for Biden - - - Russell, Kentucky + 3,880 votes for Biden + Russell, Kentucky 7,506 votes for Trump - 1,329 votes for Biden - - - Scott, Kentucky + 1,329 votes for Biden + Scott, Kentucky 17,764 votes for Trump - 10,564 votes for Biden - - - Shelby, Kentucky + 10,564 votes for Biden + Shelby, Kentucky 15,054 votes for Trump - 8,076 votes for Biden - - - Simpson, Kentucky + 8,076 votes for Biden + Simpson, Kentucky 5,888 votes for Trump - 2,681 votes for Biden - - - Spencer, Kentucky + 2,681 votes for Biden + Spencer, Kentucky 8,737 votes for Trump - 2,530 votes for Biden - - - Taylor, Kentucky + 2,530 votes for Biden + Taylor, Kentucky 9,376 votes for Trump - 2,961 votes for Biden - - - Todd, Kentucky + 2,961 votes for Biden + Todd, Kentucky 4,060 votes for Trump - 1,202 votes for Biden - - - Trigg, Kentucky + 1,202 votes for Biden + Trigg, Kentucky 5,487 votes for Trump - 1,791 votes for Biden - - - Trimble, Kentucky + 1,791 votes for Biden + Trimble, Kentucky 3,227 votes for Trump - 1,012 votes for Biden - - - Union, Kentucky + 1,012 votes for Biden + Union, Kentucky 4,965 votes for Trump - 1,529 votes for Biden - - - Warren, Kentucky + 1,529 votes for Biden + Warren, Kentucky 31,790 votes for Trump - 22,477 votes for Biden - - - Washington, Kentucky + 22,477 votes for Biden + Washington, Kentucky 4,482 votes for Trump - 1,644 votes for Biden - - - Wayne, Kentucky + 1,644 votes for Biden + Wayne, Kentucky 7,430 votes for Trump - 1,700 votes for Biden - - - Webster, Kentucky + 1,700 votes for Biden + Webster, Kentucky 4,506 votes for Trump - 1,412 votes for Biden - - - Whitley, Kentucky + 1,412 votes for Biden + Whitley, Kentucky 12,567 votes for Trump - 2,552 votes for Biden - - - Wolfe, Kentucky + 2,552 votes for Biden + Wolfe, Kentucky 2,097 votes for Trump - 837 votes for Biden - - - Woodford, Kentucky + 837 votes for Biden + Woodford, Kentucky 8,362 votes for Trump - 6,530 votes for Biden - - - Acadia, Louisiana + 6,530 votes for Biden + Acadia, Louisiana 22,596 votes for Trump - 5,443 votes for Biden - - - Allen, Louisiana + 5,443 votes for Biden + Allen, Louisiana 7,574 votes for Trump - 2,108 votes for Biden - - - Ascension, Louisiana + 2,108 votes for Biden + Ascension, Louisiana 40,687 votes for Trump - 20,399 votes for Biden - - - Assumption, Louisiana + 20,399 votes for Biden + Assumption, Louisiana 7,271 votes for Trump - 3,833 votes for Biden - - - Avoyelles, Louisiana + 3,833 votes for Biden + Avoyelles, Louisiana 12,028 votes for Trump - 4,979 votes for Biden - - - Beauregard, Louisiana + 4,979 votes for Biden + Beauregard, Louisiana 13,575 votes for Trump - 2,542 votes for Biden - - - Bienville, Louisiana + 2,542 votes for Biden + Bienville, Louisiana 3,891 votes for Trump - 3,067 votes for Biden - - - Bossier, Louisiana + 3,067 votes for Biden + Bossier, Louisiana 38,074 votes for Trump - 15,662 votes for Biden - - - Caddo, Louisiana + 15,662 votes for Biden + Caddo, Louisiana 55,110 votes for Biden - 48,021 votes for Trump - - - Calcasieu, Louisiana + 48,021 votes for Trump + Calcasieu, Louisiana 55,066 votes for Trump - 25,982 votes for Biden - - - Caldwell, Louisiana + 25,982 votes for Biden + Caldwell, Louisiana 3,976 votes for Trump - 745 votes for Biden - - - Cameron, Louisiana + 745 votes for Biden + Cameron, Louisiana 3,671 votes for Trump - 324 votes for Biden - - - Catahoula, Louisiana + 324 votes for Biden + Catahoula, Louisiana 3,541 votes for Trump - 1,269 votes for Biden - - - Claiborne, Louisiana + 1,269 votes for Biden + Claiborne, Louisiana 3,770 votes for Trump - 2,731 votes for Biden - - - Concordia, Louisiana + 2,731 votes for Biden + Concordia, Louisiana 5,550 votes for Trump - 3,177 votes for Biden - - - DeSoto, Louisiana + 3,177 votes for Biden + DeSoto, Louisiana 9,112 votes for Trump - 5,457 votes for Biden - - - East Baton Rouge, Louisiana + 5,457 votes for Biden + East Baton Rouge, Louisiana 115,577 votes for Biden - 88,420 votes for Trump - - - East Carroll, Louisiana + 88,420 votes for Trump + East Carroll, Louisiana 1,900 votes for Biden - 1,080 votes for Trump - - - East Feliciana, Louisiana + 1,080 votes for Trump + East Feliciana, Louisiana 6,064 votes for Trump - 4,280 votes for Biden - - - Evangeline, Louisiana + 4,280 votes for Biden + Evangeline, Louisiana 11,053 votes for Trump - 4,158 votes for Biden - - - Franklin, Louisiana + 4,158 votes for Biden + Franklin, Louisiana 6,970 votes for Trump - 2,658 votes for Biden - - - Grant, Louisiana + 2,658 votes for Biden + Grant, Louisiana 8,117 votes for Trump - 1,157 votes for Biden - - - Iberia, Louisiana + 1,157 votes for Biden + Iberia, Louisiana 21,251 votes for Trump - 11,027 votes for Biden - - - Iberville, Louisiana + 11,027 votes for Biden + Iberville, Louisiana 8,514 votes for Biden - 7,893 votes for Trump - - - Jackson, Louisiana + 7,893 votes for Trump + Jackson, Louisiana 5,394 votes for Trump - 2,143 votes for Biden - - - Jeff Davis, Louisiana + 2,143 votes for Biden + Jeff Davis, Louisiana 11,423 votes for Trump - 3,208 votes for Biden - - - Jefferson, Louisiana + 3,208 votes for Biden + Jefferson, Louisiana 105,949 votes for Trump - 84,477 votes for Biden - - - LaSalle, Louisiana + 84,477 votes for Biden + LaSalle, Louisiana 6,378 votes for Trump - 638 votes for Biden - - - Lafayette, Louisiana + 638 votes for Biden + Lafayette, Louisiana 72,519 votes for Trump - 39,685 votes for Biden - - - Lafourche, Louisiana + 39,685 votes for Biden + Lafourche, Louisiana 36,024 votes for Trump - 8,672 votes for Biden - - - Lincoln, Louisiana + 8,672 votes for Biden + Lincoln, Louisiana 11,311 votes for Trump - 7,559 votes for Biden - - - Livingston, Louisiana + 7,559 votes for Biden + Livingston, Louisiana 54,877 votes for Trump - 9,249 votes for Biden - - - Madison, Louisiana + 9,249 votes for Biden + Madison, Louisiana 2,654 votes for Biden - 1,930 votes for Trump - - - Morehouse, Louisiana + 1,930 votes for Trump + Morehouse, Louisiana 6,510 votes for Trump - 4,946 votes for Biden - - - Natchitoches, Louisiana + 4,946 votes for Biden + Natchitoches, Louisiana 9,358 votes for Trump - 6,896 votes for Biden - - - Orleans, Louisiana + 6,896 votes for Biden + Orleans, Louisiana 147,854 votes for Biden - 26,664 votes for Trump - - - Ouachita, Louisiana + 26,664 votes for Trump + Ouachita, Louisiana 42,255 votes for Trump - 25,913 votes for Biden - - - Plaquemines, Louisiana + 25,913 votes for Biden + Plaquemines, Louisiana 7,412 votes for Trump - 3,414 votes for Biden - - - Pointe Coupee, Louisiana + 3,414 votes for Biden + Pointe Coupee, Louisiana 7,503 votes for Trump - 4,683 votes for Biden - - - Rapides, Louisiana + 4,683 votes for Biden + Rapides, Louisiana 38,347 votes for Trump - 19,475 votes for Biden - - - Red River, Louisiana + 19,475 votes for Biden + Red River, Louisiana 2,413 votes for Trump - 1,644 votes for Biden - - - Richland, Louisiana + 1,644 votes for Biden + Richland, Louisiana 6,607 votes for Trump - 3,225 votes for Biden - - - Sabine, Louisiana + 3,225 votes for Biden + Sabine, Louisiana 8,776 votes for Trump - 1,731 votes for Biden - - - St. Bernard, Louisiana + 1,731 votes for Biden + St. Bernard, Louisiana 11,179 votes for Trump - 6,151 votes for Biden - - - St. Charles, Louisiana + 6,151 votes for Biden + St. Charles, Louisiana 18,233 votes for Trump - 9,800 votes for Biden - - - St. Helena, Louisiana + 9,800 votes for Biden + St. Helena, Louisiana 3,346 votes for Biden - 2,714 votes for Trump - - - St. James, Louisiana + 2,714 votes for Trump + St. James, Louisiana 6,510 votes for Biden - 5,954 votes for Trump - - - St. John the Baptist, Louisiana + 5,954 votes for Trump + St. John the Baptist, Louisiana 13,582 votes for Biden - 7,538 votes for Trump - - - St. Landry, Louisiana + 7,538 votes for Trump + St. Landry, Louisiana 23,171 votes for Trump - 17,372 votes for Biden - - - St. Martin, Louisiana + 17,372 votes for Biden + St. Martin, Louisiana 18,203 votes for Trump - 8,439 votes for Biden - - - St. Mary, Louisiana + 8,439 votes for Biden + St. Mary, Louisiana 14,811 votes for Trump - 8,055 votes for Biden - - - St. Tammany, Louisiana + 8,055 votes for Biden + St. Tammany, Louisiana 99,666 votes for Trump - 37,746 votes for Biden - - - Tangipahoa, Louisiana + 37,746 votes for Biden + Tangipahoa, Louisiana 37,806 votes for Trump - 18,887 votes for Biden - - - Tensas, Louisiana + 18,887 votes for Biden + Tensas, Louisiana 1,329 votes for Biden - 1,197 votes for Trump - - - Terrebonne, Louisiana + 1,197 votes for Trump + Terrebonne, Louisiana 34,339 votes for Trump - 11,198 votes for Biden - - - Union, Louisiana + 11,198 votes for Biden + Union, Louisiana 8,407 votes for Trump - 2,654 votes for Biden - - - Vermilion, Louisiana + 2,654 votes for Biden + Vermilion, Louisiana 21,930 votes for Trump - 5,009 votes for Biden - - - Vernon, Louisiana + 5,009 votes for Biden + Vernon, Louisiana 14,107 votes for Trump - 2,898 votes for Biden - - - Washington, Louisiana + 2,898 votes for Biden + Washington, Louisiana 13,307 votes for Trump - 5,970 votes for Biden - - - Webster, Louisiana + 5,970 votes for Biden + Webster, Louisiana 11,830 votes for Trump - 6,172 votes for Biden - - - West Baton Rouge, Louisiana + 6,172 votes for Biden + West Baton Rouge, Louisiana 7,684 votes for Trump - 6,200 votes for Biden - - - West Carroll, Louisiana + 6,200 votes for Biden + West Carroll, Louisiana 4,317 votes for Trump - 710 votes for Biden - - - West Feliciana, Louisiana + 710 votes for Biden + West Feliciana, Louisiana 3,863 votes for Trump - 2,298 votes for Biden - - - Winn, Louisiana + 2,298 votes for Biden + Winn, Louisiana 4,619 votes for Trump - 1,543 votes for Biden - - - Adams, Mississippi + 1,543 votes for Biden + Adams, Mississippi 6,914 votes for Biden - 5,222 votes for Trump - - - Alcorn, Mississippi + 5,222 votes for Trump + Alcorn, Mississippi 12,818 votes for Trump - 2,782 votes for Biden - - - Amite, Mississippi + 2,782 votes for Biden + Amite, Mississippi 4,503 votes for Trump - 2,620 votes for Biden - - - Attala, Mississippi + 2,620 votes for Biden + Attala, Mississippi 5,178 votes for Trump - 3,542 votes for Biden - - - Benton, Mississippi + 3,542 votes for Biden + Benton, Mississippi 2,570 votes for Trump - 1,679 votes for Biden - - - Bolivar, Mississippi + 1,679 votes for Biden + Bolivar, Mississippi 8,904 votes for Biden - 4,671 votes for Trump - - - Calhoun, Mississippi + 4,671 votes for Trump + Calhoun, Mississippi 4,625 votes for Trump - 1,902 votes for Biden - - - Carroll, Mississippi + 1,902 votes for Biden + Carroll, Mississippi 3,924 votes for Trump - 1,729 votes for Biden - - - Chickasaw, Mississippi + 1,729 votes for Biden + Chickasaw, Mississippi 4,175 votes for Trump - 3,810 votes for Biden - - - Choctaw, Mississippi + 3,810 votes for Biden + Choctaw, Mississippi 3,001 votes for Trump - 1,185 votes for Biden - - - Claiborne, Mississippi + 1,185 votes for Biden + Claiborne, Mississippi 3,772 votes for Biden - 603 votes for Trump - - - Clarke, Mississippi + 603 votes for Trump + Clarke, Mississippi 5,417 votes for Trump - 2,838 votes for Biden - - - Clay, Mississippi + 2,838 votes for Biden + Clay, Mississippi 5,844 votes for Biden - 4,181 votes for Trump - - - Coahoma, Mississippi + 4,181 votes for Trump + Coahoma, Mississippi 6,130 votes for Biden - 2,400 votes for Trump - - - Copiah, Mississippi + 2,400 votes for Trump + Copiah, Mississippi 6,470 votes for Biden - 6,250 votes for Trump - - - Covington, Mississippi + 6,250 votes for Trump + Covington, Mississippi 5,854 votes for Trump - 3,416 votes for Biden - - - DeSoto, Mississippi + 3,416 votes for Biden + DeSoto, Mississippi 46,462 votes for Trump - 28,265 votes for Biden - - - Forrest, Mississippi + 28,265 votes for Biden + Forrest, Mississippi 17,290 votes for Trump - 13,755 votes for Biden - - - Franklin, Mississippi + 13,755 votes for Biden + Franklin, Mississippi 2,923 votes for Trump - 1,480 votes for Biden - - - George, Mississippi + 1,480 votes for Biden + George, Mississippi 9,713 votes for Trump - 1,218 votes for Biden - - - Greene, Mississippi + 1,218 votes for Biden + Greene, Mississippi 4,794 votes for Trump - 966 votes for Biden - - - Grenada, Mississippi + 966 votes for Biden + Grenada, Mississippi 4,889 votes for Trump - 2,866 votes for Biden - - - Hancock, Mississippi + 2,866 votes for Biden + Hancock, Mississippi 16,132 votes for Trump - 4,504 votes for Biden - - - Harrison, Mississippi + 4,504 votes for Biden + Harrison, Mississippi 46,822 votes for Trump - 27,728 votes for Biden - - - Hinds, Mississippi + 27,728 votes for Biden + Hinds, Mississippi 73,550 votes for Biden - 25,141 votes for Trump - - - Holmes, Mississippi + 25,141 votes for Trump + Holmes, Mississippi 5,182 votes for Biden - 1,196 votes for Trump - - - Humphreys, Mississippi + 1,196 votes for Trump + Humphreys, Mississippi 3,016 votes for Biden - 1,118 votes for Trump - - - Issaquena, Mississippi + 1,118 votes for Trump + Issaquena, Mississippi 355 votes for Biden - 308 votes for Trump - - - Itawamba, Mississippi + 308 votes for Trump + Itawamba, Mississippi 9,438 votes for Trump - 1,249 votes for Biden - - - Jackson, Mississippi + 1,249 votes for Biden + Jackson, Mississippi 36,295 votes for Trump - 17,375 votes for Biden - - - Jasper, Mississippi + 17,375 votes for Biden + Jasper, Mississippi 4,341 votes for Biden - 4,302 votes for Trump - - - Jeff Davis, Mississippi + 4,302 votes for Trump + Jeff Davis, Mississippi 3,599 votes for Biden - 2,534 votes for Trump - - - Jefferson, Mississippi + 2,534 votes for Trump + Jefferson, Mississippi 3,327 votes for Biden - 531 votes for Trump - - - Jones, Mississippi + 531 votes for Trump + Jones, Mississippi 21,226 votes for Trump - 8,517 votes for Biden - - - Kemper, Mississippi + 8,517 votes for Biden + Kemper, Mississippi 2,887 votes for Biden - 1,787 votes for Trump - - - Lafayette, Mississippi + 1,787 votes for Trump + Lafayette, Mississippi 12,949 votes for Trump - 10,070 votes for Biden - - - Lamar, Mississippi + 10,070 votes for Biden + Lamar, Mississippi 20,704 votes for Trump - 7,340 votes for Biden - - - Lauderdale, Mississippi + 7,340 votes for Biden + Lauderdale, Mississippi 17,967 votes for Trump - 12,960 votes for Biden - - - Lawrence, Mississippi + 12,960 votes for Biden + Lawrence, Mississippi 4,285 votes for Trump - 2,260 votes for Biden - - - Leake, Mississippi + 2,260 votes for Biden + Leake, Mississippi 5,228 votes for Trump - 3,897 votes for Biden - - - Lee, Mississippi + 3,897 votes for Biden + Lee, Mississippi 24,207 votes for Trump - 12,189 votes for Biden - - - Leflore, Mississippi + 12,189 votes for Biden + Leflore, Mississippi 5,444 votes for Biden - 2,623 votes for Trump - - - Lincoln, Mississippi + 2,623 votes for Trump + Lincoln, Mississippi 11,596 votes for Trump - 5,040 votes for Biden - - - Lowndes, Mississippi + 5,040 votes for Biden + Lowndes, Mississippi 13,800 votes for Trump - 13,087 votes for Biden - - - Madison, Mississippi + 13,087 votes for Biden + Madison, Mississippi 31,091 votes for Trump - 24,440 votes for Biden - - - Marion, Mississippi + 24,440 votes for Biden + Marion, Mississippi 8,273 votes for Trump - 3,787 votes for Biden - - - Marshall, Mississippi + 3,787 votes for Biden + Marshall, Mississippi 8,057 votes for Biden - 7,566 votes for Trump - - - Monroe, Mississippi + 7,566 votes for Trump + Monroe, Mississippi 11,177 votes for Trump - 5,874 votes for Biden - - - Montgomery, Mississippi + 5,874 votes for Biden + Montgomery, Mississippi 2,917 votes for Trump - 2,121 votes for Biden - - - Neshoba, Mississippi + 2,121 votes for Biden + Neshoba, Mississippi 8,320 votes for Trump - 3,260 votes for Biden - - - Newton, Mississippi + 3,260 votes for Biden + Newton, Mississippi 6,997 votes for Trump - 3,075 votes for Biden - - - Noxubee, Mississippi + 3,075 votes for Biden + Noxubee, Mississippi 4,040 votes for Biden - 1,240 votes for Trump - - - Oktibbeha, Mississippi + 1,240 votes for Trump + Oktibbeha, Mississippi 10,299 votes for Biden - 9,004 votes for Trump - - - Panola, Mississippi + 9,004 votes for Trump + Panola, Mississippi 8,060 votes for Trump - 7,403 votes for Biden - - - Pearl River, Mississippi + 7,403 votes for Biden + Pearl River, Mississippi 19,595 votes for Trump - 4,148 votes for Biden - - - Perry, Mississippi + 4,148 votes for Biden + Perry, Mississippi 4,500 votes for Trump - 1,362 votes for Biden - - - Pike, Mississippi + 1,362 votes for Biden + Pike, Mississippi 8,646 votes for Biden - 8,479 votes for Trump - - - Pontotoc, Mississippi + 8,479 votes for Trump + Pontotoc, Mississippi 11,550 votes for Trump - 2,614 votes for Biden - - - Prentiss, Mississippi + 2,614 votes for Biden + Prentiss, Mississippi 8,312 votes for Trump - 2,139 votes for Biden - - - Quitman, Mississippi + 2,139 votes for Biden + Quitman, Mississippi 2,150 votes for Biden - 1,026 votes for Trump - - - Rankin, Mississippi + 1,026 votes for Trump + Rankin, Mississippi 50,895 votes for Trump - 18,847 votes for Biden - - - Scott, Mississippi + 18,847 votes for Biden + Scott, Mississippi 6,285 votes for Trump - 4,330 votes for Biden - - - Sharkey, Mississippi + 4,330 votes for Biden + Sharkey, Mississippi 1,465 votes for Biden - 688 votes for Trump - - - Simpson, Mississippi + 688 votes for Trump + Simpson, Mississippi 7,635 votes for Trump - 4,037 votes for Biden - - - Smith, Mississippi + 4,037 votes for Biden + Smith, Mississippi 6,458 votes for Trump - 1,791 votes for Biden - - - Stone, Mississippi + 1,791 votes for Biden + Stone, Mississippi 5,964 votes for Trump - 1,802 votes for Biden - - - Sunflower, Mississippi + 1,802 votes for Biden + Sunflower, Mississippi 6,781 votes for Biden - 2,799 votes for Trump - - - Tallahatchie, Mississippi + 2,799 votes for Trump + Tallahatchie, Mississippi 3,105 votes for Biden - 2,488 votes for Trump - - - Tate, Mississippi + 2,488 votes for Trump + Tate, Mississippi 8,707 votes for Trump - 4,183 votes for Biden - - - Tippah, Mississippi + 4,183 votes for Biden + Tippah, Mississippi 8,054 votes for Trump - 1,937 votes for Biden - - - Tishomingo, Mississippi + 1,937 votes for Biden + Tishomingo, Mississippi 7,933 votes for Trump - 1,059 votes for Biden - - - Tunica, Mississippi + 1,059 votes for Biden + Tunica, Mississippi 2,580 votes for Biden - 926 votes for Trump - - - Union, Mississippi + 926 votes for Trump + Union, Mississippi 10,373 votes for Trump - 2,160 votes for Biden - - - Walthall, Mississippi + 2,160 votes for Biden + Walthall, Mississippi 3,426 votes for Trump - 2,236 votes for Biden - - - Warren, Mississippi + 2,236 votes for Biden + Warren, Mississippi 10,442 votes for Biden - 10,365 votes for Trump - - - Washington, Mississippi + 10,365 votes for Trump + Washington, Mississippi 12,503 votes for Biden - 5,300 votes for Trump - - - Wayne, Mississippi + 5,300 votes for Trump + Wayne, Mississippi 6,307 votes for Trump - 3,624 votes for Biden - - - Webster, Mississippi + 3,624 votes for Biden + Webster, Mississippi 4,291 votes for Trump - 1,043 votes for Biden - - - Wilkinson, Mississippi + 1,043 votes for Biden + Wilkinson, Mississippi 2,749 votes for Biden - 1,324 votes for Trump - - - Winston, Mississippi + 1,324 votes for Trump + Winston, Mississippi 5,112 votes for Trump - 4,040 votes for Biden - - - Yalobusha, Mississippi + 4,040 votes for Biden + Yalobusha, Mississippi 3,671 votes for Trump - 2,785 votes for Biden - - - Yazoo, Mississippi + 2,785 votes for Biden + Yazoo, Mississippi 5,496 votes for Biden - 4,832 votes for Trump - - - Adair, Missouri + 4,832 votes for Trump + Adair, Missouri 6,391 votes for Trump - 3,705 votes for Biden - - - Andrew, Missouri + 3,705 votes for Biden + Andrew, Missouri 7,256 votes for Trump - 2,351 votes for Biden - - - Atchison, Missouri + 2,351 votes for Biden + Atchison, Missouri 2,199 votes for Trump - 564 votes for Biden - - - Audrain, Missouri + 564 votes for Biden + Audrain, Missouri 7,727 votes for Trump - 2,703 votes for Biden - - - Barry, Missouri + 2,703 votes for Biden + Barry, Missouri 12,425 votes for Trump - 2,948 votes for Biden - - - Barton, Missouri + 2,948 votes for Biden + Barton, Missouri 5,168 votes for Trump - 844 votes for Biden - - - Bates, Missouri + 844 votes for Biden + Bates, Missouri 6,595 votes for Trump - 1,672 votes for Biden - - - Benton, Missouri + 1,672 votes for Biden + Benton, Missouri 8,106 votes for Trump - 2,179 votes for Biden - - - Bollinger, Missouri + 2,179 votes for Biden + Bollinger, Missouri 5,162 votes for Trump - 749 votes for Biden - - - Boone, Missouri + 749 votes for Biden + Boone, Missouri 49,999 votes for Biden - 38,596 votes for Trump - - - Buchanan, Missouri + 38,596 votes for Trump + Buchanan, Missouri 22,450 votes for Trump - 13,445 votes for Biden - - - Butler, Missouri + 13,445 votes for Biden + Butler, Missouri 14,599 votes for Trump - 3,301 votes for Biden - - - Caldwell, Missouri + 3,301 votes for Biden + Caldwell, Missouri 3,725 votes for Trump - 897 votes for Biden - - - Callaway, Missouri + 897 votes for Biden + Callaway, Missouri 14,812 votes for Trump - 5,868 votes for Biden - - - Camden, Missouri + 5,868 votes for Biden + Camden, Missouri 18,825 votes for Trump - 5,640 votes for Biden - - - Cape Girardeau, Missouri + 5,640 votes for Biden + Cape Girardeau, Missouri 28,873 votes for Trump - 10,738 votes for Biden - - - Carroll, Missouri + 10,738 votes for Biden + Carroll, Missouri 3,706 votes for Trump - 785 votes for Biden - - - Carter, Missouri + 785 votes for Biden + Carter, Missouri 2,451 votes for Trump - 418 votes for Biden - - - Cass, Missouri + 418 votes for Biden + Cass, Missouri 37,172 votes for Trump - 19,035 votes for Biden - - - Cedar, Missouri + 19,035 votes for Biden + Cedar, Missouri 5,786 votes for Trump - 1,143 votes for Biden - - - Chariton, Missouri + 1,143 votes for Biden + Chariton, Missouri 3,109 votes for Trump - 916 votes for Biden - - - Christian, Missouri + 916 votes for Biden + Christian, Missouri 34,904 votes for Trump - 11,126 votes for Biden - - - Clark, Missouri + 11,126 votes for Biden + Clark, Missouri 2,672 votes for Trump - 678 votes for Biden - - - Clay, Missouri + 678 votes for Biden + Clay, Missouri 64,583 votes for Trump - 59,519 votes for Biden - - - Clinton, Missouri + 59,519 votes for Biden + Clinton, Missouri 7,789 votes for Trump - 2,894 votes for Biden - - - Cole, Missouri + 2,894 votes for Biden + Cole, Missouri 26,066 votes for Trump - 12,687 votes for Biden - - - Cooper, Missouri + 12,687 votes for Biden + Cooper, Missouri 6,272 votes for Trump - 2,249 votes for Biden - - - Crawford, Missouri + 2,249 votes for Biden + Crawford, Missouri 8,725 votes for Trump - 2,113 votes for Biden - - - Dade, Missouri + 2,113 votes for Biden + Dade, Missouri 3,414 votes for Trump - 656 votes for Biden - - - Dallas, Missouri + 656 votes for Biden + Dallas, Missouri 6,620 votes for Trump - 1,380 votes for Biden - - - Daviess, Missouri + 1,380 votes for Biden + Daviess, Missouri 3,077 votes for Trump - 740 votes for Biden - - - DeKalb, Missouri + 740 votes for Biden + DeKalb, Missouri 3,827 votes for Trump - 930 votes for Biden - - - Dent, Missouri + 930 votes for Biden + Dent, Missouri 5,987 votes for Trump - 1,056 votes for Biden - - - Douglas, Missouri + 1,056 votes for Biden + Douglas, Missouri 5,896 votes for Trump - 1,012 votes for Biden - - - Dunklin, Missouri + 1,012 votes for Biden + Dunklin, Missouri 8,135 votes for Trump - 2,200 votes for Biden - - - Franklin, Missouri + 2,200 votes for Biden + Franklin, Missouri 38,034 votes for Trump - 14,561 votes for Biden - - - Gasconade, Missouri + 14,561 votes for Biden + Gasconade, Missouri 6,222 votes for Trump - 1,601 votes for Biden - - - Gentry, Missouri + 1,601 votes for Biden + Gentry, Missouri 2,580 votes for Trump - 613 votes for Biden - - - Greene, Missouri + 613 votes for Biden + Greene, Missouri 81,312 votes for Trump - 53,307 votes for Biden - - - Grundy, Missouri + 53,307 votes for Biden + Grundy, Missouri 3,585 votes for Trump - 799 votes for Biden - - - Harrison, Missouri + 799 votes for Biden + Harrison, Missouri 3,198 votes for Trump - 597 votes for Biden - - - Henry, Missouri + 597 votes for Biden + Henry, Missouri 8,019 votes for Trump - 2,615 votes for Biden - - - Hickory, Missouri + 2,615 votes for Biden + Hickory, Missouri 3,965 votes for Trump - 1,054 votes for Biden - - - Holt, Missouri + 1,054 votes for Biden + Holt, Missouri 1,976 votes for Trump - 338 votes for Biden - - - Howard, Missouri + 338 votes for Biden + Howard, Missouri 3,552 votes for Trump - 1,412 votes for Biden - - - Howell, Missouri + 1,412 votes for Biden + Howell, Missouri 15,174 votes for Trump - 3,214 votes for Biden - - - Iron, Missouri + 3,214 votes for Biden + Iron, Missouri 3,596 votes for Trump - 945 votes for Biden - - - Jackson, Missouri + 945 votes for Biden + Jackson, Missouri 198,031 votes for Biden - 125,897 votes for Trump - - - Jasper, Missouri + 125,897 votes for Trump + Jasper, Missouri 37,714 votes for Trump - 13,539 votes for Biden - - - Jefferson, Missouri + 13,539 votes for Biden + Jefferson, Missouri 77,021 votes for Trump - 37,507 votes for Biden - - - Johnson, Missouri + 37,507 votes for Biden + Johnson, Missouri 15,468 votes for Trump - 6,961 votes for Biden - - - Knox, Missouri + 6,961 votes for Biden + Knox, Missouri 1,486 votes for Trump - 340 votes for Biden - - - LaClede, Missouri + 340 votes for Biden + LaClede, Missouri 13,755 votes for Trump - 2,779 votes for Biden - - - Lafayette, Missouri + 2,779 votes for Biden + Lafayette, Missouri 12,262 votes for Trump - 4,470 votes for Biden - - - Lawrence, Missouri + 4,470 votes for Biden + Lawrence, Missouri 14,421 votes for Trump - 3,214 votes for Biden - - - Lewis, Missouri + 3,214 votes for Biden + Lewis, Missouri 3,541 votes for Trump - 984 votes for Biden - - - Lincoln, Missouri + 984 votes for Biden + Lincoln, Missouri 21,702 votes for Trump - 6,553 votes for Biden - - - Linn, Missouri + 6,553 votes for Biden + Linn, Missouri 4,344 votes for Trump - 1,274 votes for Biden - - - Livingston, Missouri + 1,274 votes for Biden + Livingston, Missouri 5,266 votes for Trump - 1,409 votes for Biden - - - Macon, Missouri + 1,409 votes for Biden + Macon, Missouri 6,075 votes for Trump - 1,661 votes for Biden - - - Madison, Missouri + 1,661 votes for Biden + Madison, Missouri 4,581 votes for Trump - 1,017 votes for Biden - - - Maries, Missouri + 1,017 votes for Biden + Maries, Missouri 3,890 votes for Trump - 814 votes for Biden - - - Marion, Missouri + 814 votes for Biden + Marion, Missouri 9,910 votes for Trump - 3,201 votes for Biden - - - McDonald, Missouri + 3,201 votes for Biden + McDonald, Missouri 7,465 votes for Trump - 1,437 votes for Biden - - - Mercer, Missouri + 1,437 votes for Biden + Mercer, Missouri 1,541 votes for Trump - 222 votes for Biden - - - Miller, Missouri + 222 votes for Biden + Miller, Missouri 10,175 votes for Trump - 2,038 votes for Biden - - - Mississippi, Missouri + 2,038 votes for Biden + Mississippi, Missouri 3,537 votes for Trump - 1,178 votes for Biden - - - Moniteau, Missouri + 1,178 votes for Biden + Moniteau, Missouri 5,738 votes for Trump - 1,307 votes for Biden - - - Monroe, Missouri + 1,307 votes for Biden + Monroe, Missouri 3,466 votes for Trump - 931 votes for Biden - - - Montgomery, Missouri + 931 votes for Biden + Montgomery, Missouri 4,457 votes for Trump - 1,206 votes for Biden - - - Morgan, Missouri + 1,206 votes for Biden + Morgan, Missouri 7,439 votes for Trump - 1,924 votes for Biden - - - New Madrid, Missouri + 1,924 votes for Biden + New Madrid, Missouri 5,447 votes for Trump - 1,748 votes for Biden - - - Newton, Missouri + 1,748 votes for Biden + Newton, Missouri 22,090 votes for Trump - 5,793 votes for Biden - - - Nodaway, Missouri + 5,793 votes for Biden + Nodaway, Missouri 6,855 votes for Trump - 2,849 votes for Biden - - - Oregon, Missouri + 2,849 votes for Biden + Oregon, Missouri 3,847 votes for Trump - 823 votes for Biden - - - Osage, Missouri + 823 votes for Biden + Osage, Missouri 6,341 votes for Trump - 1,031 votes for Biden - - - Ozark, Missouri + 1,031 votes for Biden + Ozark, Missouri 4,064 votes for Trump - 752 votes for Biden - - - Pemiscot, Missouri + 752 votes for Biden + Pemiscot, Missouri 4,116 votes for Trump - 1,556 votes for Biden - - - Perry, Missouri + 1,556 votes for Biden + Perry, Missouri 7,634 votes for Trump - 1,661 votes for Biden - - - Pettis, Missouri + 1,661 votes for Biden + Pettis, Missouri 13,835 votes for Trump - 4,776 votes for Biden - - - Phelps, Missouri + 4,776 votes for Biden + Phelps, Missouri 13,438 votes for Trump - 5,619 votes for Biden - - - Pike, Missouri + 5,619 votes for Biden + Pike, Missouri 5,856 votes for Trump - 1,717 votes for Biden - - - Platte, Missouri + 1,717 votes for Biden + Platte, Missouri 29,251 votes for Trump - 28,111 votes for Biden - - - Polk, Missouri + 28,111 votes for Biden + Polk, Missouri 11,849 votes for Trump - 2,883 votes for Biden - - - Pulaski, Missouri + 2,883 votes for Biden + Pulaski, Missouri 10,326 votes for Trump - 3,735 votes for Biden - - - Putnam, Missouri + 3,735 votes for Biden + Putnam, Missouri 1,984 votes for Trump - 361 votes for Biden - - - Ralls, Missouri + 361 votes for Biden + Ralls, Missouri 4,396 votes for Trump - 1,205 votes for Biden - - - Randolph, Missouri + 1,205 votes for Biden + Randolph, Missouri 8,018 votes for Trump - 2,485 votes for Biden - - - Ray, Missouri + 2,485 votes for Biden + Ray, Missouri 8,328 votes for Trump - 3,107 votes for Biden - - - Reynolds, Missouri + 3,107 votes for Biden + Reynolds, Missouri 2,733 votes for Trump - 529 votes for Biden - - - Ripley, Missouri + 529 votes for Biden + Ripley, Missouri 4,838 votes for Trump - 833 votes for Biden - - - Saline, Missouri + 833 votes for Biden + Saline, Missouri 6,447 votes for Trump - 2,903 votes for Biden - - - Schuyler, Missouri + 2,903 votes for Biden + Schuyler, Missouri 1,606 votes for Trump - 373 votes for Biden - - - Scotland, Missouri + 373 votes for Biden + Scotland, Missouri 1,560 votes for Trump - 387 votes for Biden - - - Scott, Missouri + 387 votes for Biden + Scott, Missouri 13,769 votes for Trump - 3,753 votes for Biden - - - Shannon, Missouri + 3,753 votes for Biden + Shannon, Missouri 3,164 votes for Trump - 706 votes for Biden - - - Shelby, Missouri + 706 votes for Biden + Shelby, Missouri 2,699 votes for Trump - 592 votes for Biden - - - St. Charles, Missouri + 592 votes for Biden + St. Charles, Missouri 128,193 votes for Trump - 89,346 votes for Biden - - - St. Clair, Missouri + 89,346 votes for Biden + St. Clair, Missouri 3,930 votes for Trump - 988 votes for Biden - - - St. Francois, Missouri + 988 votes for Biden + St. Francois, Missouri 20,506 votes for Trump - 7,044 votes for Biden - - - St. Louis City, Missouri + 7,044 votes for Biden + St. Louis City, Missouri 108,385 votes for Biden - 21,185 votes for Trump - - - St. Louis County, Missouri + 21,185 votes for Trump + St. Louis County, Missouri 322,802 votes for Biden - 196,808 votes for Trump - - - Ste. Genevieve, Missouri + 196,808 votes for Trump + Ste. Genevieve, Missouri 6,627 votes for Trump - 2,713 votes for Biden - - - Stoddard, Missouri + 2,713 votes for Biden + Stoddard, Missouri 11,460 votes for Trump - 1,814 votes for Biden - - - Stone, Missouri + 1,814 votes for Biden + Stone, Missouri 14,716 votes for Trump - 3,486 votes for Biden - - - Sullivan, Missouri + 3,486 votes for Biden + Sullivan, Missouri 1,974 votes for Trump - 478 votes for Biden - - - Taney, Missouri + 478 votes for Biden + Taney, Missouri 20,426 votes for Trump - 5,325 votes for Biden - - - Texas, Missouri + 5,325 votes for Biden + Texas, Missouri 9,478 votes for Trump - 1,716 votes for Biden - - - Vernon, Missouri + 1,716 votes for Biden + Vernon, Missouri 7,135 votes for Trump - 1,902 votes for Biden - - - Warren, Missouri + 1,902 votes for Biden + Warren, Missouri 13,222 votes for Trump - 4,769 votes for Biden - - - Washington, Missouri + 4,769 votes for Biden + Washington, Missouri 8,046 votes for Trump - 1,804 votes for Biden - - - Wayne, Missouri + 1,804 votes for Biden + Wayne, Missouri 4,984 votes for Trump - 844 votes for Biden - - - Webster, Missouri + 844 votes for Biden + Webster, Missouri 14,874 votes for Trump - 3,572 votes for Biden - - - Worth, Missouri + 3,572 votes for Biden + Worth, Missouri 877 votes for Trump - 215 votes for Biden - - - Wright, Missouri + 215 votes for Biden + Wright, Missouri 7,452 votes for Trump - 1,167 votes for Biden - - - Alamance, North Carolina + 1,167 votes for Biden + Alamance, North Carolina 46,056 votes for Trump - 38,825 votes for Biden - - - Alexander, North Carolina + 38,825 votes for Biden + Alexander, North Carolina 15,888 votes for Trump - 4,145 votes for Biden - - - Alleghany, North Carolina + 4,145 votes for Biden + Alleghany, North Carolina 4,527 votes for Trump - 1,486 votes for Biden - - - Anson, North Carolina + 1,486 votes for Biden + Anson, North Carolina 5,789 votes for Biden - 5,321 votes for Trump - - - Ashe, North Carolina + 5,321 votes for Trump + Ashe, North Carolina 11,451 votes for Trump - 4,164 votes for Biden - - - Avery, North Carolina + 4,164 votes for Biden + Avery, North Carolina 7,172 votes for Trump - 2,191 votes for Biden - - - Beaufort, North Carolina + 2,191 votes for Biden + Beaufort, North Carolina 16,437 votes for Trump - 9,633 votes for Biden - - - Bertie, North Carolina + 9,633 votes for Biden + Bertie, North Carolina 5,939 votes for Biden - 3,817 votes for Trump - - - Bladen, North Carolina + 3,817 votes for Trump + Bladen, North Carolina 9,676 votes for Trump - 7,326 votes for Biden - - - Brunswick, North Carolina + 7,326 votes for Biden + Brunswick, North Carolina 55,850 votes for Trump - 33,310 votes for Biden - - - Buncombe, North Carolina + 33,310 votes for Biden + Buncombe, North Carolina 96,515 votes for Biden - 62,412 votes for Trump - - - Burke, North Carolina + 62,412 votes for Trump + Burke, North Carolina 31,019 votes for Trump - 13,118 votes for Biden - - - Cabarrus, North Carolina + 13,118 votes for Biden + Cabarrus, North Carolina 63,237 votes for Trump - 52,162 votes for Biden - - - Caldwell, North Carolina + 52,162 votes for Biden + Caldwell, North Carolina 32,119 votes for Trump - 10,245 votes for Biden - - - Camden, North Carolina + 10,245 votes for Biden + Camden, North Carolina 4,312 votes for Trump - 1,537 votes for Biden - - - Carteret, North Carolina + 1,537 votes for Biden + Carteret, North Carolina 30,028 votes for Trump - 12,093 votes for Biden - - - Caswell, North Carolina + 12,093 votes for Biden + Caswell, North Carolina 7,089 votes for Trump - 4,860 votes for Biden - - - Catawba, North Carolina + 4,860 votes for Biden + Catawba, North Carolina 56,588 votes for Trump - 25,689 votes for Biden - - - Chatham, North Carolina + 25,689 votes for Biden + Chatham, North Carolina 26,787 votes for Biden - 21,186 votes for Trump - - - Cherokee, North Carolina + 21,186 votes for Trump + Cherokee, North Carolina 12,628 votes for Trump - 3,583 votes for Biden - - - Chowan, North Carolina + 3,583 votes for Biden + Chowan, North Carolina 4,471 votes for Trump - 3,247 votes for Biden - - - Clay, North Carolina + 3,247 votes for Biden + Clay, North Carolina 5,112 votes for Trump - 1,699 votes for Biden - - - Cleveland, North Carolina + 1,699 votes for Biden + Cleveland, North Carolina 33,798 votes for Trump - 16,955 votes for Biden - - - Columbus, North Carolina + 16,955 votes for Biden + Columbus, North Carolina 16,832 votes for Trump - 9,446 votes for Biden - - - Craven, North Carolina + 9,446 votes for Biden + Craven, North Carolina 31,032 votes for Trump - 21,148 votes for Biden - - - Cumberland, North Carolina + 21,148 votes for Biden + Cumberland, North Carolina 84,469 votes for Biden - 60,032 votes for Trump - - - Currituck, North Carolina + 60,032 votes for Trump + Currituck, North Carolina 11,657 votes for Trump - 4,195 votes for Biden - - - Dare, North Carolina + 4,195 votes for Biden + Dare, North Carolina 13,938 votes for Trump - 9,936 votes for Biden - - - Davidson, North Carolina + 9,936 votes for Biden + Davidson, North Carolina 64,658 votes for Trump - 22,636 votes for Biden - - - Davie, North Carolina + 22,636 votes for Biden + Davie, North Carolina 18,228 votes for Trump - 6,713 votes for Biden - - - Duplin, North Carolina + 6,713 votes for Biden + Duplin, North Carolina 13,793 votes for Trump - 8,767 votes for Biden - - - Durham, North Carolina + 8,767 votes for Biden + Durham, North Carolina 144,688 votes for Biden - 32,459 votes for Trump - - - Edgecombe, North Carolina + 32,459 votes for Trump + Edgecombe, North Carolina 16,089 votes for Biden - 9,206 votes for Trump - - - Forsyth, North Carolina + 9,206 votes for Trump + Forsyth, North Carolina 113,029 votes for Biden - 85,060 votes for Trump - - - Franklin, North Carolina + 85,060 votes for Trump + Franklin, North Carolina 20,904 votes for Trump - 15,882 votes for Biden - - - Gaston, North Carolina + 15,882 votes for Biden + Gaston, North Carolina 73,033 votes for Trump - 40,959 votes for Biden - - - Gates, North Carolina + 40,959 votes for Biden + Gates, North Carolina 3,367 votes for Trump - 2,546 votes for Biden - - - Graham, North Carolina + 2,546 votes for Biden + Graham, North Carolina 3,710 votes for Trump - 905 votes for Biden - - - Granville, North Carolina + 905 votes for Biden + Granville, North Carolina 16,647 votes for Trump - 14,565 votes for Biden - - - Greene, North Carolina + 14,565 votes for Biden + Greene, North Carolina 4,874 votes for Trump - 3,832 votes for Biden - - - Guilford, North Carolina + 3,832 votes for Biden + Guilford, North Carolina 173,086 votes for Biden - 107,294 votes for Trump - - - Halifax, North Carolina + 107,294 votes for Trump + Halifax, North Carolina 15,545 votes for Biden - 10,080 votes for Trump - - - Harnett, North Carolina + 10,080 votes for Trump + Harnett, North Carolina 35,177 votes for Trump - 22,093 votes for Biden - - - Haywood, North Carolina + 22,093 votes for Biden + Haywood, North Carolina 22,834 votes for Trump - 13,144 votes for Biden - - - Henderson, North Carolina + 13,144 votes for Biden + Henderson, North Carolina 40,032 votes for Trump - 27,211 votes for Biden - - - Hertford, North Carolina + 27,211 votes for Biden + Hertford, North Carolina 7,097 votes for Biden - 3,479 votes for Trump - - - Hoke, North Carolina + 3,479 votes for Trump + Hoke, North Carolina 11,804 votes for Biden - 9,453 votes for Trump - - - Hyde, North Carolina + 9,453 votes for Trump + Hyde, North Carolina 1,418 votes for Trump - 1,046 votes for Biden - - - Iredell, North Carolina + 1,046 votes for Biden + Iredell, North Carolina 67,010 votes for Trump - 33,888 votes for Biden - - - Jackson, North Carolina + 33,888 votes for Biden + Jackson, North Carolina 11,356 votes for Trump - 9,591 votes for Biden - - - Johnston, North Carolina + 9,591 votes for Biden + Johnston, North Carolina 68,354 votes for Trump - 41,261 votes for Biden - - - Jones, North Carolina + 41,261 votes for Biden + Jones, North Carolina 3,280 votes for Trump - 2,197 votes for Biden - - - Lee, North Carolina + 2,197 votes for Biden + Lee, North Carolina 16,469 votes for Trump - 12,143 votes for Biden - - - Lenoir, North Carolina + 12,143 votes for Biden + Lenoir, North Carolina 14,590 votes for Trump - 13,605 votes for Biden - - - Lincoln, North Carolina + 13,605 votes for Biden + Lincoln, North Carolina 36,341 votes for Trump - 13,274 votes for Biden - - - Macon, North Carolina + 13,274 votes for Biden + Macon, North Carolina 14,211 votes for Trump - 6,230 votes for Biden - - - Madison, North Carolina + 6,230 votes for Biden + Madison, North Carolina 7,979 votes for Trump - 4,901 votes for Biden - - - Martin, North Carolina + 4,901 votes for Biden + Martin, North Carolina 6,532 votes for Trump - 5,911 votes for Biden - - - McDowell, North Carolina + 5,911 votes for Biden + McDowell, North Carolina 16,883 votes for Trump - 5,832 votes for Biden - - - Mecklenburg, North Carolina + 5,832 votes for Biden + Mecklenburg, North Carolina 378,107 votes for Biden - 179,211 votes for Trump - - - Mitchell, North Carolina + 179,211 votes for Trump + Mitchell, North Carolina 7,090 votes for Trump - 1,867 votes for Biden - - - Montgomery, North Carolina + 1,867 votes for Biden + Montgomery, North Carolina 8,411 votes for Trump - 4,327 votes for Biden - - - Moore, North Carolina + 4,327 votes for Biden + Moore, North Carolina 36,764 votes for Trump - 20,779 votes for Biden - - - Nash, North Carolina + 20,779 votes for Biden + Nash, North Carolina 25,947 votes for Biden - 25,827 votes for Trump - - - New Hanover, North Carolina + 25,827 votes for Trump + New Hanover, North Carolina 66,146 votes for Biden - 63,333 votes for Trump - - - Northampton, North Carolina + 63,333 votes for Trump + Northampton, North Carolina 6,069 votes for Biden - 3,989 votes for Trump - - - Onslow, North Carolina + 3,989 votes for Trump + Onslow, North Carolina 46,078 votes for Trump - 24,266 votes for Biden - - - Orange, North Carolina + 24,266 votes for Biden + Orange, North Carolina 63,594 votes for Biden - 20,176 votes for Trump - - - Pamlico, North Carolina + 20,176 votes for Trump + Pamlico, North Carolina 4,849 votes for Trump - 2,713 votes for Biden - - - Pasquotank, North Carolina + 2,713 votes for Biden + Pasquotank, North Carolina 9,832 votes for Biden - 9,770 votes for Trump - - - Pender, North Carolina + 9,770 votes for Trump + Pender, North Carolina 21,956 votes for Trump - 11,723 votes for Biden - - - Perquimans, North Carolina + 11,723 votes for Biden + Perquimans, North Carolina 4,903 votes for Trump - 2,492 votes for Biden - - - Person, North Carolina + 2,492 votes for Biden + Person, North Carolina 13,184 votes for Trump - 8,465 votes for Biden - - - Pitt, North Carolina + 8,465 votes for Biden + Pitt, North Carolina 47,252 votes for Biden - 38,982 votes for Trump - - - Polk, North Carolina + 38,982 votes for Trump + Polk, North Carolina 7,689 votes for Trump - 4,518 votes for Biden - - - Randolph, North Carolina + 4,518 votes for Biden + Randolph, North Carolina 56,894 votes for Trump - 15,618 votes for Biden - - - Richmond, North Carolina + 15,618 votes for Biden + Richmond, North Carolina 11,830 votes for Trump - 8,754 votes for Biden - - - Robeson, North Carolina + 8,754 votes for Biden + Robeson, North Carolina 27,806 votes for Trump - 19,020 votes for Biden - - - Rockingham, North Carolina + 19,020 votes for Biden + Rockingham, North Carolina 31,301 votes for Trump - 15,992 votes for Biden - - - Rowan, North Carolina + 15,992 votes for Biden + Rowan, North Carolina 49,297 votes for Trump - 23,114 votes for Biden - - - Rutherford, North Carolina + 23,114 votes for Biden + Rutherford, North Carolina 24,891 votes for Trump - 9,135 votes for Biden - - - Sampson, North Carolina + 9,135 votes for Biden + Sampson, North Carolina 17,411 votes for Trump - 10,966 votes for Biden - - - Scotland, North Carolina + 10,966 votes for Biden + Scotland, North Carolina 7,473 votes for Trump - 7,186 votes for Biden - - - Stanly, North Carolina + 7,186 votes for Biden + Stanly, North Carolina 25,458 votes for Trump - 8,129 votes for Biden - - - Stokes, North Carolina + 8,129 votes for Biden + Stokes, North Carolina 20,143 votes for Trump - 5,286 votes for Biden - - - Surry, North Carolina + 5,286 votes for Biden + Surry, North Carolina 27,538 votes for Trump - 8,721 votes for Biden - - - Swain, North Carolina + 8,721 votes for Biden + Swain, North Carolina 4,161 votes for Trump - 2,780 votes for Biden - - - Transylvania, North Carolina + 2,780 votes for Biden + Transylvania, North Carolina 11,636 votes for Trump - 8,444 votes for Biden - - - Tyrrell, North Carolina + 8,444 votes for Biden + Tyrrell, North Carolina 1,044 votes for Trump - 758 votes for Biden - - - Union, North Carolina + 758 votes for Biden + Union, North Carolina 80,382 votes for Trump - 48,725 votes for Biden - - - Vance, North Carolina + 48,725 votes for Biden + Vance, North Carolina 12,431 votes for Biden - 8,391 votes for Trump - - - Wake, North Carolina + 8,391 votes for Trump + Wake, North Carolina 393,336 votes for Biden - 226,197 votes for Trump - - - Warren, North Carolina + 226,197 votes for Trump + Warren, North Carolina 6,400 votes for Biden - 3,752 votes for Trump - - - Washington, North Carolina + 3,752 votes for Trump + Washington, North Carolina 3,396 votes for Biden - 2,781 votes for Trump - - - Watauga, North Carolina + 2,781 votes for Trump + Watauga, North Carolina 17,122 votes for Biden - 14,451 votes for Trump - - - Wayne, North Carolina + 14,451 votes for Trump + Wayne, North Carolina 30,709 votes for Trump - 24,215 votes for Biden - - - Wilkes, North Carolina + 24,215 votes for Biden + Wilkes, North Carolina 27,591 votes for Trump - 7,510 votes for Biden - - - Wilson, North Carolina + 7,510 votes for Biden + Wilson, North Carolina 20,754 votes for Biden - 19,581 votes for Trump - - - Yadkin, North Carolina + 19,581 votes for Trump + Yadkin, North Carolina 15,933 votes for Trump - 3,763 votes for Biden - - - Yancey, North Carolina + 3,763 votes for Biden + Yancey, North Carolina 7,516 votes for Trump - 3,688 votes for Biden - - - Alameda, California + 3,688 votes for Biden + Alameda, California 616,180 votes for Biden - 135,925 votes for Trump - - - Alpine, California + 135,925 votes for Trump + Alpine, California 473 votes for Biden - 238 votes for Trump - - - Amador, California + 238 votes for Trump + Amador, California 13,584 votes for Trump - 8,152 votes for Biden - - - Butte, California + 8,152 votes for Biden + Butte, California 49,402 votes for Biden - 47,568 votes for Trump - - - Calaveras, California + 47,568 votes for Trump + Calaveras, California 16,287 votes for Trump - 9,845 votes for Biden - - - Colusa, California + 9,845 votes for Biden + Colusa, California 4,533 votes for Trump - 3,213 votes for Biden - - - Contra Costa, California + 3,213 votes for Biden + Contra Costa, California 407,639 votes for Biden - 148,623 votes for Trump - - - Del Norte, California + 148,623 votes for Trump + Del Norte, California 6,434 votes for Trump - 4,656 votes for Biden - - - El Dorado, California + 4,656 votes for Biden + El Dorado, California 61,614 votes for Trump - 51,473 votes for Biden - - - Fresno, California + 51,473 votes for Biden + Fresno, California 192,118 votes for Biden - 163,880 votes for Trump - - - Glenn, California + 163,880 votes for Trump + Glenn, California 7,000 votes for Trump - 3,939 votes for Biden - - - Humboldt, California + 3,939 votes for Biden + Humboldt, California 37,367 votes for Biden - 17,474 votes for Trump - - - Imperial, California + 17,474 votes for Trump + Imperial, California 31,545 votes for Biden - 18,129 votes for Trump - - - Inyo, California + 18,129 votes for Trump + Inyo, California 4,623 votes for Biden - 4,611 votes for Trump - - - Kern, California + 4,611 votes for Trump + Kern, California 152,778 votes for Trump - 124,973 votes for Biden - - - Kings, California + 124,973 votes for Biden + Kings, California 23,169 votes for Trump - 17,729 votes for Biden - - - Lake, California + 17,729 votes for Biden + Lake, California 6,874 votes for Biden - 3,955 votes for Trump - - - Lassen, California + 3,955 votes for Trump + Lassen, California 8,798 votes for Trump - 2,772 votes for Biden - - - Los Angeles, California + 2,772 votes for Biden + Los Angeles, California 3,001,862 votes for Biden - 1,132,647 votes for Trump - - - Madera, California + 1,132,647 votes for Trump + Madera, California 29,265 votes for Trump - 23,086 votes for Biden - - - Marin, California + 23,086 votes for Biden + Marin, California 126,652 votes for Biden - 24,007 votes for Trump - - - Mariposa, California + 24,007 votes for Trump + Mariposa, California 5,950 votes for Trump - 4,088 votes for Biden - - - Mendocino, California + 4,088 votes for Biden + Mendocino, California 18,303 votes for Biden - 6,312 votes for Trump - - - Merced, California + 6,312 votes for Trump + Merced, California 47,861 votes for Biden - 38,568 votes for Trump - - - Modoc, California + 38,568 votes for Trump + Modoc, California 2,675 votes for Trump - 1,063 votes for Biden - - - Mono, California + 1,063 votes for Biden + Mono, California 3,998 votes for Biden - 2,504 votes for Trump - - - Monterey, California + 2,504 votes for Trump + Monterey, California 113,893 votes for Biden - 46,274 votes for Trump - - - Napa, California + 46,274 votes for Trump + Napa, California 46,962 votes for Biden - 19,388 votes for Trump - - - Nevada, California + 19,388 votes for Trump + Nevada, California 35,773 votes for Biden - 26,316 votes for Trump - - - Orange, California + 26,316 votes for Trump + Orange, California 813,132 votes for Biden - 675,855 votes for Trump - - - Placer, California + 675,855 votes for Trump + Placer, California 117,426 votes for Trump - 103,108 votes for Biden - - - Plumas, California + 103,108 votes for Biden + Plumas, California 6,247 votes for Trump - 4,465 votes for Biden - - - Riverside, California + 4,465 votes for Biden + Riverside, California 511,967 votes for Biden - 433,374 votes for Trump - - - Sacramento, California + 433,374 votes for Trump + Sacramento, California 434,512 votes for Biden - 253,959 votes for Trump - - - San Benito, California + 253,959 votes for Trump + San Benito, California 17,315 votes for Biden - 10,412 votes for Trump - - - San Bernardino, California + 10,412 votes for Trump + San Bernardino, California 439,705 votes for Biden - 352,781 votes for Trump - - - San Diego, California + 352,781 votes for Trump + San Diego, California 962,325 votes for Biden - 598,434 votes for Trump - - - San Francisco, California + 598,434 votes for Trump + San Francisco, California 377,772 votes for Biden - 56,329 votes for Trump - - - San Joaquin, California + 56,329 votes for Trump + San Joaquin, California 152,056 votes for Biden - 113,627 votes for Trump - - - San Luis Obispo, California + 113,627 votes for Trump + San Luis Obispo, California 86,829 votes for Biden - 65,907 votes for Trump - - - San Mateo, California + 65,907 votes for Trump + San Mateo, California 288,333 votes for Biden - 74,756 votes for Trump - - - Santa Barbara, California + 74,756 votes for Trump + Santa Barbara, California 126,419 votes for Biden - 63,583 votes for Trump - - - Santa Clara, California + 63,583 votes for Trump + Santa Clara, California 615,258 votes for Biden - 213,518 votes for Trump - - - Santa Cruz, California + 213,518 votes for Trump + Santa Cruz, California 113,487 votes for Biden - 26,688 votes for Trump - - - Shasta, California + 26,688 votes for Trump + Shasta, California 58,886 votes for Trump - 29,312 votes for Biden - - - Sierra, California + 29,312 votes for Biden + Sierra, California 1,142 votes for Trump - 730 votes for Biden - - - Siskiyou, California + 730 votes for Biden + Siskiyou, California 13,288 votes for Trump - 9,591 votes for Biden - - - Solano, California + 9,591 votes for Biden + Solano, California 131,525 votes for Biden - 69,234 votes for Trump - - - Sonoma, California + 69,234 votes for Trump + Sonoma, California 197,010 votes for Biden - 60,355 votes for Trump - - - Stanislaus, California + 60,355 votes for Trump + Stanislaus, California 104,323 votes for Biden - 102,568 votes for Trump - - - Sutter, California + 102,568 votes for Trump + Sutter, California 24,372 votes for Trump - 17,364 votes for Biden - - - Tehama, California + 17,364 votes for Biden + Tehama, California 17,739 votes for Trump - 8,493 votes for Biden - - - Trinity, California + 8,493 votes for Biden + Trinity, California 3,185 votes for Trump - 2,848 votes for Biden - - - Tulare, California + 2,848 votes for Biden + Tulare, California 76,315 votes for Trump - 65,056 votes for Biden - - - Tuolumne, California + 65,056 votes for Biden + Tuolumne, California 17,302 votes for Trump - 11,808 votes for Biden - - - Ventura, California + 11,808 votes for Biden + Ventura, California 250,535 votes for Biden - 161,510 votes for Trump - - - Yolo, California + 161,510 votes for Trump + Yolo, California 53,621 votes for Biden - 19,825 votes for Trump - - - Yuba, California + 19,825 votes for Trump + Yuba, California 16,210 votes for Trump - 10,343 votes for Biden - - - Adair, Iowa + 10,343 votes for Biden + Adair, Iowa 2,917 votes for Trump - 1,197 votes for Biden - - - Adams, Iowa + 1,197 votes for Biden + Adams, Iowa 1,528 votes for Trump - 590 votes for Biden - - - Allamakee, Iowa + 590 votes for Biden + Allamakee, Iowa 4,733 votes for Trump - 2,575 votes for Biden - - - Appanoose, Iowa + 2,575 votes for Biden + Appanoose, Iowa 4,512 votes for Trump - 1,891 votes for Biden - - - Audubon, Iowa + 1,891 votes for Biden + Audubon, Iowa 2,295 votes for Trump - 1,071 votes for Biden - - - Benton, Iowa + 1,071 votes for Biden + Benton, Iowa 9,179 votes for Trump - 5,156 votes for Biden - - - Black Hawk, Iowa + 5,156 votes for Biden + Black Hawk, Iowa 35,621 votes for Biden - 29,623 votes for Trump - - - Boone, Iowa + 29,623 votes for Trump + Boone, Iowa 8,695 votes for Trump - 6,303 votes for Biden - - - Bremer, Iowa + 6,303 votes for Biden + Bremer, Iowa 8,287 votes for Trump - 5,954 votes for Biden - - - Buchanan, Iowa + 5,954 votes for Biden + Buchanan, Iowa 6,420 votes for Trump - 4,169 votes for Biden - - - Buena Vista, Iowa + 4,169 votes for Biden + Buena Vista, Iowa 5,056 votes for Trump - 2,961 votes for Biden - - - Butler, Iowa + 2,961 votes for Biden + Butler, Iowa 5,542 votes for Trump - 2,424 votes for Biden - - - Calhoun, Iowa + 2,424 votes for Biden + Calhoun, Iowa 3,689 votes for Trump - 1,470 votes for Biden - - - Carroll, Iowa + 1,470 votes for Biden + Carroll, Iowa 7,737 votes for Trump - 3,454 votes for Biden - - - Cass, Iowa + 3,454 votes for Biden + Cass, Iowa 4,969 votes for Trump - 2,201 votes for Biden - - - Cedar, Iowa + 2,201 votes for Biden + Cedar, Iowa 6,161 votes for Trump - 4,337 votes for Biden - - - Cerro Gordo, Iowa + 4,337 votes for Biden + Cerro Gordo, Iowa 12,435 votes for Trump - 10,941 votes for Biden - - - Cherokee, Iowa + 10,941 votes for Biden + Cherokee, Iowa 4,495 votes for Trump - 1,936 votes for Biden - - - Chickasaw, Iowa + 1,936 votes for Biden + Chickasaw, Iowa 4,308 votes for Trump - 2,233 votes for Biden - - - Clarke, Iowa + 2,233 votes for Biden + Clarke, Iowa 3,140 votes for Trump - 1,466 votes for Biden - - - Clay, Iowa + 1,466 votes for Biden + Clay, Iowa 6,137 votes for Trump - 2,662 votes for Biden - - - Clayton, Iowa + 2,662 votes for Biden + Clayton, Iowa 6,106 votes for Trump - 3,340 votes for Biden - - - Clinton, Iowa + 3,340 votes for Biden + Clinton, Iowa 13,349 votes for Trump - 10,806 votes for Biden - - - Crawford, Iowa + 10,806 votes for Biden + Crawford, Iowa 4,854 votes for Trump - 2,220 votes for Biden - - - Dallas, Iowa + 2,220 votes for Biden + Dallas, Iowa 27,987 votes for Trump - 26,879 votes for Biden - - - Davis, Iowa + 26,879 votes for Biden + Davis, Iowa 3,032 votes for Trump - 1,013 votes for Biden - - - Decatur, Iowa + 1,013 votes for Biden + Decatur, Iowa 2,615 votes for Trump - 1,120 votes for Biden - - - Delaware, Iowa + 1,120 votes for Biden + Delaware, Iowa 6,666 votes for Trump - 3,157 votes for Biden - - - Des Moines, Iowa + 3,157 votes for Biden + Des Moines, Iowa 10,589 votes for Trump - 8,887 votes for Biden - - - Dickinson, Iowa + 8,887 votes for Biden + Dickinson, Iowa 7,438 votes for Trump - 3,661 votes for Biden - - - Dubuque, Iowa + 3,661 votes for Biden + Dubuque, Iowa 27,214 votes for Trump - 25,655 votes for Biden - - - Emmet, Iowa + 25,655 votes for Biden + Emmet, Iowa 3,265 votes for Trump - 1,520 votes for Biden - - - Fayette, Iowa + 1,520 votes for Biden + Fayette, Iowa 6,145 votes for Trump - 3,834 votes for Biden - - - Floyd, Iowa + 3,834 votes for Biden + Floyd, Iowa 4,730 votes for Trump - 3,168 votes for Biden - - - Franklin, Iowa + 3,168 votes for Biden + Franklin, Iowa 3,422 votes for Trump - 1,626 votes for Biden - - - Fremont, Iowa + 1,626 votes for Biden + Fremont, Iowa 2,711 votes for Trump - 1,078 votes for Biden - - - Greene, Iowa + 1,078 votes for Biden + Greene, Iowa 3,221 votes for Trump - 1,768 votes for Biden - - - Grundy, Iowa + 1,768 votes for Biden + Grundy, Iowa 4,929 votes for Trump - 2,206 votes for Biden - - - Guthrie, Iowa + 2,206 votes for Biden + Guthrie, Iowa 4,272 votes for Trump - 1,985 votes for Biden - - - Hamilton, Iowa + 1,985 votes for Biden + Hamilton, Iowa 4,956 votes for Trump - 2,842 votes for Biden - - - Hancock, Iowa + 2,842 votes for Biden + Hancock, Iowa 4,390 votes for Trump - 1,683 votes for Biden - - - Hardin, Iowa + 1,683 votes for Biden + Hardin, Iowa 5,850 votes for Trump - 2,976 votes for Biden - - - Harrison, Iowa + 2,976 votes for Biden + Harrison, Iowa 5,569 votes for Trump - 2,440 votes for Biden - - - Henry, Iowa + 2,440 votes for Biden + Henry, Iowa 6,507 votes for Trump - 3,275 votes for Biden - - - Howard, Iowa + 3,275 votes for Biden + Howard, Iowa 3,127 votes for Trump - 1,772 votes for Biden - - - Humboldt, Iowa + 1,772 votes for Biden + Humboldt, Iowa 3,819 votes for Trump - 1,442 votes for Biden - - - Ida, Iowa + 1,442 votes for Biden + Ida, Iowa 2,876 votes for Trump - 917 votes for Biden - - - Iowa, Iowa + 917 votes for Biden + Iowa, Iowa 6,009 votes for Trump - 3,547 votes for Biden - - - Jackson, Iowa + 3,547 votes for Biden + Jackson, Iowa 6,940 votes for Trump - 4,029 votes for Biden - - - Jasper, Iowa + 4,029 votes for Biden + Jasper, Iowa 12,082 votes for Trump - 7,737 votes for Biden - - - Jefferson, Iowa + 7,737 votes for Biden + Jefferson, Iowa 4,442 votes for Trump - 4,314 votes for Biden - - - Johnson, Iowa + 4,314 votes for Biden + Johnson, Iowa 59,177 votes for Biden - 22,925 votes for Trump - - - Jones, Iowa + 22,925 votes for Trump + Jones, Iowa 6,572 votes for Trump - 4,213 votes for Biden - - - Keokuk, Iowa + 4,213 votes for Biden + Keokuk, Iowa 3,797 votes for Trump - 1,414 votes for Biden - - - Kossuth, Iowa + 1,414 votes for Biden + Kossuth, Iowa 6,275 votes for Trump - 2,696 votes for Biden - - - Lee, Iowa + 2,696 votes for Biden + Lee, Iowa 9,763 votes for Trump - 6,539 votes for Biden - - - Linn, Iowa + 6,539 votes for Biden + Linn, Iowa 70,874 votes for Biden - 53,364 votes for Trump - - - Louisa, Iowa + 53,364 votes for Trump + Louisa, Iowa 3,500 votes for Trump - 1,726 votes for Biden - - - Lucas, Iowa + 1,726 votes for Biden + Lucas, Iowa 3,287 votes for Trump - 1,284 votes for Biden - - - Lyon, Iowa + 1,284 votes for Biden + Lyon, Iowa 5,707 votes for Trump - 1,067 votes for Biden - - - Madison, Iowa + 1,067 votes for Biden + Madison, Iowa 6,507 votes for Trump - 3,134 votes for Biden - - - Mahaska, Iowa + 3,134 votes for Biden + Mahaska, Iowa 8,297 votes for Trump - 2,894 votes for Biden - - - Marion, Iowa + 2,894 votes for Biden + Marion, Iowa 12,657 votes for Trump - 6,170 votes for Biden - - - Marshall, Iowa + 6,170 votes for Biden + Marshall, Iowa 9,564 votes for Trump - 8,171 votes for Biden - - - Mills, Iowa + 8,171 votes for Biden + Mills, Iowa 5,572 votes for Trump - 2,500 votes for Biden - - - Mitchell, Iowa + 2,500 votes for Biden + Mitchell, Iowa 3,677 votes for Trump - 2,053 votes for Biden - - - Monona, Iowa + 2,053 votes for Biden + Monona, Iowa 3,248 votes for Trump - 1,407 votes for Biden - - - Monroe, Iowa + 1,407 votes for Biden + Monroe, Iowa 2,975 votes for Trump - 1,078 votes for Biden - - - Montgomery, Iowa + 1,078 votes for Biden + Montgomery, Iowa 3,659 votes for Trump - 1,583 votes for Biden - - - Muscatine, Iowa + 1,583 votes for Biden + Muscatine, Iowa 10,823 votes for Trump - 9,372 votes for Biden - - - O'Brien, Iowa + 9,372 votes for Biden + O'Brien, Iowa 5,861 votes for Trump - 1,569 votes for Biden - - - Osceola, Iowa + 1,569 votes for Biden + Osceola, Iowa 2,688 votes for Trump - 600 votes for Biden - - - Page, Iowa + 600 votes for Biden + Page, Iowa 5,319 votes for Trump - 2,086 votes for Biden - - - Palo Alto, Iowa + 2,086 votes for Biden + Palo Alto, Iowa 3,370 votes for Trump - 1,519 votes for Biden - - - Plymouth, Iowa + 1,519 votes for Biden + Plymouth, Iowa 10,492 votes for Trump - 3,494 votes for Biden - - - Pocahontas, Iowa + 3,494 votes for Biden + Pocahontas, Iowa 2,825 votes for Trump - 932 votes for Biden - - - Polk, Iowa + 932 votes for Biden + Polk, Iowa 146,250 votes for Biden - 106,800 votes for Trump - - - Pottawattamie, Iowa + 106,800 votes for Trump + Pottawattamie, Iowa 26,241 votes for Trump - 18,570 votes for Biden - - - Poweshiek, Iowa + 18,570 votes for Biden + Poweshiek, Iowa 5,657 votes for Trump - 4,306 votes for Biden - - - Ringgold, Iowa + 4,306 votes for Biden + Ringgold, Iowa 1,964 votes for Trump - 708 votes for Biden - - - Sac, Iowa + 708 votes for Biden + Sac, Iowa 4,061 votes for Trump - 1,389 votes for Biden - - - Scott, Iowa + 1,389 votes for Biden + Scott, Iowa 46,890 votes for Biden - 43,661 votes for Trump - - - Shelby, Iowa + 43,661 votes for Trump + Shelby, Iowa 4,697 votes for Trump - 1,959 votes for Biden - - - Sioux, Iowa + 1,959 votes for Biden + Sioux, Iowa 15,680 votes for Trump - 3,019 votes for Biden - - - Story, Iowa + 3,019 votes for Biden + Story, Iowa 29,175 votes for Biden - 20,340 votes for Trump - - - Tama, Iowa + 20,340 votes for Trump + Tama, Iowa 5,303 votes for Trump - 3,577 votes for Biden - - - Taylor, Iowa + 3,577 votes for Biden + Taylor, Iowa 2,463 votes for Trump - 746 votes for Biden - - - Union, Iowa + 746 votes for Biden + Union, Iowa 4,010 votes for Trump - 2,061 votes for Biden - - - Van Buren, Iowa + 2,061 votes for Biden + Van Buren, Iowa 2,859 votes for Trump - 875 votes for Biden - - - Wapello, Iowa + 875 votes for Biden + Wapello, Iowa 9,516 votes for Trump - 5,821 votes for Biden - - - Warren, Iowa + 5,821 votes for Biden + Warren, Iowa 17,738 votes for Trump - 12,537 votes for Biden - - - Washington, Iowa + 12,537 votes for Biden + Washington, Iowa 6,966 votes for Trump - 4,558 votes for Biden - - - Wayne, Iowa + 4,558 votes for Biden + Wayne, Iowa 2,338 votes for Trump - 727 votes for Biden - - - Webster, Iowa + 727 votes for Biden + Webster, Iowa 10,927 votes for Trump - 6,604 votes for Biden - - - Winnebago, Iowa + 6,604 votes for Biden + Winnebago, Iowa 3,707 votes for Trump - 2,135 votes for Biden - - - Winneshiek, Iowa + 2,135 votes for Biden + Winneshiek, Iowa 6,235 votes for Trump - 5,617 votes for Biden - - - Woodbury, Iowa + 5,617 votes for Biden + Woodbury, Iowa 25,736 votes for Trump - 18,704 votes for Biden - - - Worth, Iowa + 18,704 votes for Biden + Worth, Iowa 2,738 votes for Trump - 1,596 votes for Biden - - - Wright, Iowa + 1,596 votes for Biden + Wright, Iowa 4,136 votes for Trump - 1,996 votes for Biden - - - Androscoggin, Maine + 1,996 votes for Biden + Androscoggin, Maine 29,259 votes for Trump - 27,568 votes for Biden - - - Aroostook, Maine + 27,568 votes for Biden + Aroostook, Maine 19,622 votes for Trump - 13,318 votes for Biden - - - Cumberland, Maine + 13,318 votes for Biden + Cumberland, Maine 128,563 votes for Biden - 59,491 votes for Trump - - - Franklin, Maine + 59,491 votes for Trump + Franklin, Maine 7,324 votes for Trump - 7,061 votes for Biden - - - Hancock, Maine + 7,061 votes for Biden + Hancock, Maine 18,412 votes for Biden - 13,662 votes for Trump - - - Kennebec, Maine + 13,662 votes for Trump + Kennebec, Maine 34,297 votes for Biden - 34,151 votes for Trump - - - Knox, Maine + 34,151 votes for Trump + Knox, Maine 14,798 votes for Biden - 9,870 votes for Trump - - - Lincoln, Maine + 9,870 votes for Trump + Lincoln, Maine 11,807 votes for Biden - 9,723 votes for Trump - - - Oxford, Maine + 9,723 votes for Trump + Oxford, Maine 16,860 votes for Trump - 14,027 votes for Biden - - - Penobscot, Maine + 14,027 votes for Biden + Penobscot, Maine 40,132 votes for Trump - 35,327 votes for Biden - - - Piscataquis, Maine + 35,327 votes for Biden + Piscataquis, Maine 5,703 votes for Trump - 3,273 votes for Biden - - - Sagadahoc, Maine + 3,273 votes for Biden + Sagadahoc, Maine 13,531 votes for Biden - 9,755 votes for Trump - - - Somerset, Maine + 9,755 votes for Trump + Somerset, Maine 13,915 votes for Trump - 8,971 votes for Biden - - - Waldo, Maine + 8,971 votes for Biden + Waldo, Maine 12,389 votes for Biden - 11,279 votes for Trump - - - Washington, Maine + 11,279 votes for Trump + Washington, Maine 7,104 votes for Trump - 4,652 votes for Biden - - - York, Maine + 4,652 votes for Biden + York, Maine 72,363 votes for Biden - 54,099 votes for Trump - - - Alachua, Florida + 54,099 votes for Trump + Alachua, Florida 89,704 votes for Biden - 50,972 votes for Trump - - - Baker, Florida + 50,972 votes for Trump + Baker, Florida 11,911 votes for Trump - 2,037 votes for Biden - - - Bay, Florida + 2,037 votes for Biden + Bay, Florida 66,097 votes for Trump - 25,614 votes for Biden - - - Bradford, Florida + 25,614 votes for Biden + Bradford, Florida 10,334 votes for Trump - 3,160 votes for Biden - - - Brevard, Florida + 3,160 votes for Biden + Brevard, Florida 207,883 votes for Trump - 148,549 votes for Biden - - - Broward, Florida + 148,549 votes for Biden + Broward, Florida 618,752 votes for Biden - 333,409 votes for Trump - - - Calhoun, Florida + 333,409 votes for Trump + Calhoun, Florida 5,274 votes for Trump - 1,209 votes for Biden - - - Charlotte, Florida + 1,209 votes for Biden + Charlotte, Florida 73,243 votes for Trump - 42,273 votes for Biden - - - Citrus, Florida + 42,273 votes for Biden + Citrus, Florida 65,352 votes for Trump - 27,092 votes for Biden - - - Clay, Florida + 27,092 votes for Biden + Clay, Florida 84,480 votes for Trump - 38,317 votes for Biden - - - Collier, Florida + 38,317 votes for Biden + Collier, Florida 128,950 votes for Trump - 77,621 votes for Biden - - - Columbia, Florida + 77,621 votes for Biden + Columbia, Florida 23,836 votes for Trump - 8,914 votes for Biden - - - DeSoto, Florida + 8,914 votes for Biden + DeSoto, Florida 8,313 votes for Trump - 4,259 votes for Biden - - - Dixie, Florida + 4,259 votes for Biden + Dixie, Florida 6,759 votes for Trump - 1,365 votes for Biden - - - Duval, Florida + 1,365 votes for Biden + Duval, Florida 252,556 votes for Biden - 233,762 votes for Trump - - - Escambia, Florida + 233,762 votes for Trump + Escambia, Florida 96,674 votes for Trump - 70,929 votes for Biden - - - Flagler, Florida + 70,929 votes for Biden + Flagler, Florida 43,043 votes for Trump - 28,161 votes for Biden - - - Franklin, Florida + 28,161 votes for Biden + Franklin, Florida 4,675 votes for Trump - 2,120 votes for Biden - - - Gadsden, Florida + 2,120 votes for Biden + Gadsden, Florida 16,153 votes for Biden - 7,465 votes for Trump - - - Gilchrist, Florida + 7,465 votes for Trump + Gilchrist, Florida 7,895 votes for Trump - 1,700 votes for Biden - - - Glades, Florida + 1,700 votes for Biden + Glades, Florida 3,782 votes for Trump - 1,385 votes for Biden - - - Gulf, Florida + 1,385 votes for Biden + Gulf, Florida 6,113 votes for Trump - 1,985 votes for Biden - - - Hamilton, Florida + 1,985 votes for Biden + Hamilton, Florida 3,815 votes for Trump - 1,963 votes for Biden - - - Hardee, Florida + 1,963 votes for Biden + Hardee, Florida 6,122 votes for Trump - 2,298 votes for Biden - - - Hendry, Florida + 2,298 votes for Biden + Hendry, Florida 7,906 votes for Trump - 4,929 votes for Biden - - - Hernando, Florida + 4,929 votes for Biden + Hernando, Florida 70,412 votes for Trump - 37,519 votes for Biden - - - Highlands, Florida + 37,519 votes for Biden + Highlands, Florida 34,873 votes for Trump - 16,938 votes for Biden - - - Hillsborough, Florida + 16,938 votes for Biden + Hillsborough, Florida 376,367 votes for Biden - 327,398 votes for Trump - - - Holmes, Florida + 327,398 votes for Trump + Holmes, Florida 8,080 votes for Trump - 924 votes for Biden - - - Indian River, Florida + 924 votes for Biden + Indian River, Florida 58,872 votes for Trump - 37,844 votes for Biden - - - Jackson, Florida + 37,844 votes for Biden + Jackson, Florida 15,488 votes for Trump - 6,766 votes for Biden - - - Jefferson, Florida + 6,766 votes for Biden + Jefferson, Florida 4,479 votes for Trump - 3,897 votes for Biden - - - Lafayette, Florida + 3,897 votes for Biden + Lafayette, Florida 3,128 votes for Trump - 510 votes for Biden - - - Lake, Florida + 510 votes for Biden + Lake, Florida 125,859 votes for Trump - 83,505 votes for Biden - - - Lee, Florida + 83,505 votes for Biden + Lee, Florida 233,247 votes for Trump - 157,695 votes for Biden - - - Leon, Florida + 157,695 votes for Biden + Leon, Florida 103,517 votes for Biden - 57,453 votes for Trump - - - Levy, Florida + 57,453 votes for Trump + Levy, Florida 16,749 votes for Trump - 6,205 votes for Biden - - - Liberty, Florida + 6,205 votes for Biden + Liberty, Florida 2,846 votes for Trump - 694 votes for Biden - - - Madison, Florida + 694 votes for Biden + Madison, Florida 5,576 votes for Trump - 3,747 votes for Biden - - - Manatee, Florida + 3,747 votes for Biden + Manatee, Florida 124,987 votes for Trump - 90,166 votes for Biden - - - Marion, Florida + 90,166 votes for Biden + Marion, Florida 127,826 votes for Trump - 74,858 votes for Biden - - - Martin, Florida + 74,858 votes for Biden + Martin, Florida 61,168 votes for Trump - 36,893 votes for Biden - - - Miami-Dade, Florida + 36,893 votes for Biden + Miami-Dade, Florida 617,864 votes for Biden - 532,833 votes for Trump - - - Monroe, Florida + 532,833 votes for Trump + Monroe, Florida 25,693 votes for Trump - 21,881 votes for Biden - - - Nassau, Florida + 21,881 votes for Biden + Nassau, Florida 42,566 votes for Trump - 15,564 votes for Biden - - - Okaloosa, Florida + 15,564 votes for Biden + Okaloosa, Florida 79,798 votes for Trump - 34,248 votes for Biden - - - Okeechobee, Florida + 34,248 votes for Biden + Okeechobee, Florida 11,470 votes for Trump - 4,390 votes for Biden - - - Orange, Florida + 4,390 votes for Biden + Orange, Florida 395,014 votes for Biden - 245,398 votes for Trump - - - Osceola, Florida + 245,398 votes for Trump + Osceola, Florida 97,297 votes for Biden - 73,480 votes for Trump - - - Palm Beach, Florida + 73,480 votes for Trump + Palm Beach, Florida 433,572 votes for Biden - 334,711 votes for Trump - - - Pasco, Florida + 334,711 votes for Trump + Pasco, Florida 179,621 votes for Trump - 119,073 votes for Biden - - - Pinellas, Florida + 119,073 votes for Biden + Pinellas, Florida 277,450 votes for Biden - 276,209 votes for Trump - - - Polk, Florida + 276,209 votes for Trump + Polk, Florida 194,586 votes for Trump - 145,049 votes for Biden - - - Putnam, Florida + 145,049 votes for Biden + Putnam, Florida 25,514 votes for Trump - 10,527 votes for Biden - - - Santa Rosa, Florida + 10,527 votes for Biden + Santa Rosa, Florida 77,385 votes for Trump - 27,612 votes for Biden - - - Sarasota, Florida + 27,612 votes for Biden + Sarasota, Florida 148,370 votes for Trump - 120,110 votes for Biden - - - Seminole, Florida + 120,110 votes for Biden + Seminole, Florida 132,528 votes for Biden - 125,241 votes for Trump - - - St. Johns, Florida + 125,241 votes for Trump + St. Johns, Florida 110,946 votes for Trump - 63,850 votes for Biden - - - St. Lucie, Florida + 63,850 votes for Biden + St. Lucie, Florida 86,831 votes for Trump - 84,137 votes for Biden - - - Sumter, Florida + 84,137 votes for Biden + Sumter, Florida 62,761 votes for Trump - 29,341 votes for Biden - - - Suwannee, Florida + 29,341 votes for Biden + Suwannee, Florida 16,410 votes for Trump - 4,485 votes for Biden - - - Taylor, Florida + 4,485 votes for Biden + Taylor, Florida 7,751 votes for Trump - 2,299 votes for Biden - - - Union, Florida + 2,299 votes for Biden + Union, Florida 5,133 votes for Trump - 1,053 votes for Biden - - - Volusia, Florida + 1,053 votes for Biden + Volusia, Florida 173,821 votes for Trump - 130,575 votes for Biden - - - Wakulla, Florida + 130,575 votes for Biden + Wakulla, Florida 12,874 votes for Trump - 5,351 votes for Biden - - - Walton, Florida + 5,351 votes for Biden + Walton, Florida 32,947 votes for Trump - 10,338 votes for Biden - - - Washington, Florida + 10,338 votes for Biden + Washington, Florida 9,876 votes for Trump - 2,347 votes for Biden - - - Adams, Washington + 2,347 votes for Biden + Adams, Washington 3,881 votes for Trump - 1,789 votes for Biden - - - Asotin, Washington + 1,789 votes for Biden + Asotin, Washington 7,259 votes for Trump - 4,233 votes for Biden - - - Benton, Washington + 4,233 votes for Biden + Benton, Washington 60,177 votes for Trump - 38,572 votes for Biden - - - Chelan, Washington + 38,572 votes for Biden + Chelan, Washington 22,476 votes for Trump - 19,005 votes for Biden - - - Clallam, Washington + 19,005 votes for Biden + Clallam, Washington 24,532 votes for Biden - 22,912 votes for Trump - - - Clark, Washington + 22,912 votes for Trump + Clark, Washington 140,095 votes for Biden - 126,079 votes for Trump - - - Columbia, Washington + 126,079 votes for Trump + Columbia, Washington 1,754 votes for Trump - 668 votes for Biden - - - Cowlitz, Washington + 668 votes for Biden + Cowlitz, Washington 34,314 votes for Trump - 23,889 votes for Biden - - - Douglas, Washington + 23,889 votes for Biden + Douglas, Washington 12,908 votes for Trump - 7,787 votes for Biden - - - Ferry, Washington + 7,787 votes for Biden + Ferry, Washington 2,735 votes for Trump - 1,465 votes for Biden - - - Franklin, Washington + 1,465 votes for Biden + Franklin, Washington 17,849 votes for Trump - 13,148 votes for Biden - - - Garfield, Washington + 13,148 votes for Biden + Garfield, Washington 1,062 votes for Trump - 362 votes for Biden - - - Grant, Washington + 362 votes for Biden + Grant, Washington 24,703 votes for Trump - 11,751 votes for Biden - - - Grays Harbor, Washington + 11,751 votes for Biden + Grays Harbor, Washington 19,590 votes for Trump - 17,172 votes for Biden - - - Island, Washington + 17,172 votes for Biden + Island, Washington 29,171 votes for Biden - 22,698 votes for Trump - - - Jefferson, Washington + 22,698 votes for Trump + Jefferson, Washington 17,190 votes for Biden - 6,921 votes for Trump - - - King, Washington + 6,921 votes for Trump + King, Washington 905,714 votes for Biden - 268,322 votes for Trump - - - Kitsap, Washington + 268,322 votes for Trump + Kitsap, Washington 90,163 votes for Biden - 61,489 votes for Trump - - - Kittitas, Washington + 61,489 votes for Trump + Kittitas, Washington 13,778 votes for Trump - 11,004 votes for Biden - - - Klickitat, Washington + 11,004 votes for Biden + Klickitat, Washington 7,223 votes for Trump - 5,947 votes for Biden - - - Lewis, Washington + 5,947 votes for Biden + Lewis, Washington 29,318 votes for Trump - 14,462 votes for Biden - - - Lincoln, Washington + 14,462 votes for Biden + Lincoln, Washington 5,134 votes for Trump - 1,711 votes for Biden - - - Mason, Washington + 1,711 votes for Biden + Mason, Washington 18,676 votes for Trump - 17,253 votes for Biden - - - Okanogan, Washington + 17,253 votes for Biden + Okanogan, Washington 11,758 votes for Trump - 8,833 votes for Biden - - - Pacific, Washington + 8,833 votes for Biden + Pacific, Washington 6,930 votes for Trump - 6,776 votes for Biden - - - Pend Oreille, Washington + 6,776 votes for Biden + Pend Oreille, Washington 5,655 votes for Trump - 2,578 votes for Biden - - - Pierce, Washington + 2,578 votes for Biden + Pierce, Washington 249,316 votes for Biden - 197,578 votes for Trump - - - San Juan, Washington + 197,578 votes for Trump + San Juan, Washington 9,606 votes for Biden - 2,994 votes for Trump - - - Skagit, Washington + 2,994 votes for Trump + Skagit, Washington 37,668 votes for Biden - 32,247 votes for Trump - - - Skamania, Washington + 32,247 votes for Trump + Skamania, Washington 3,783 votes for Trump - 3,100 votes for Biden - - - Snohomish, Washington + 3,100 votes for Biden + Snohomish, Washington 256,277 votes for Biden - 166,090 votes for Trump - - - Spokane, Washington + 166,090 votes for Trump + Spokane, Washington 148,244 votes for Trump - 135,511 votes for Biden - - - Stevens, Washington + 135,511 votes for Biden + Stevens, Washington 19,592 votes for Trump - 7,721 votes for Biden - - - Thurston, Washington + 7,721 votes for Biden + Thurston, Washington 96,255 votes for Biden - 64,995 votes for Trump - - - Wahkiakum, Washington + 64,995 votes for Trump + Wahkiakum, Washington 1,711 votes for Trump - 1,150 votes for Biden - - - Walla Walla, Washington + 1,150 votes for Biden + Walla Walla, Washington 15,794 votes for Trump - 13,211 votes for Biden - - - Whatcom, Washington + 13,211 votes for Biden + Whatcom, Washington 83,557 votes for Biden - 50,407 votes for Trump - - - Whitman, Washington + 50,407 votes for Trump + Whitman, Washington 10,570 votes for Biden - 8,642 votes for Trump - - - Yakima, Washington + 8,642 votes for Trump + Yakima, Washington 50,531 votes for Trump - 43,162 votes for Biden - - - Adams, Illinois + 43,162 votes for Biden + Adams, Illinois 24,131 votes for Trump - 8,569 votes for Biden - - - Alexander, Illinois + 8,569 votes for Biden + Alexander, Illinois 1,486 votes for Trump - 1,114 votes for Biden - - - Bond, Illinois + 1,114 votes for Biden + Bond, Illinois 5,612 votes for Trump - 2,275 votes for Biden - - - Boone, Illinois + 2,275 votes for Biden + Boone, Illinois 13,762 votes for Trump - 10,372 votes for Biden - - - Brown, Illinois + 10,372 votes for Biden + Brown, Illinois 1,930 votes for Trump - 485 votes for Biden - - - Bureau, Illinois + 485 votes for Biden + Bureau, Illinois 10,296 votes for Trump - 6,545 votes for Biden - - - Calhoun, Illinois + 6,545 votes for Biden + Calhoun, Illinois 2,043 votes for Trump - 674 votes for Biden - - - Carroll, Illinois + 674 votes for Biden + Carroll, Illinois 5,098 votes for Trump - 2,737 votes for Biden - - - Cass, Illinois + 2,737 votes for Biden + Cass, Illinois 3,624 votes for Trump - 1,615 votes for Biden - - - Champaign, Illinois + 1,615 votes for Biden + Champaign, Illinois 56,596 votes for Biden - 35,122 votes for Trump - - - Christian, Illinois + 35,122 votes for Trump + Christian, Illinois 11,505 votes for Trump - 4,286 votes for Biden - - - Clark, Illinois + 4,286 votes for Biden + Clark, Illinois 6,215 votes for Trump - 1,990 votes for Biden - - - Clay, Illinois + 1,990 votes for Biden + Clay, Illinois 5,626 votes for Trump - 1,129 votes for Biden - - - Clinton, Illinois + 1,129 votes for Biden + Clinton, Illinois 14,264 votes for Trump - 4,459 votes for Biden - - - Coles, Illinois + 4,459 votes for Biden + Coles, Illinois 13,981 votes for Trump - 7,997 votes for Biden - - - Cook, Illinois + 7,997 votes for Biden + Cook, Illinois 1,682,455 votes for Biden - 546,789 votes for Trump - - - Crawford, Illinois + 546,789 votes for Trump + Crawford, Illinois 7,025 votes for Trump - 2,198 votes for Biden - - - Cumberland, Illinois + 2,198 votes for Biden + Cumberland, Illinois 4,595 votes for Trump - 1,141 votes for Biden - - - DeKalb, Illinois + 1,141 votes for Biden + DeKalb, Illinois 24,484 votes for Biden - 21,818 votes for Trump - - - DeWitt, Illinois + 21,818 votes for Trump + DeWitt, Illinois 5,623 votes for Trump - 2,171 votes for Biden - - - Douglas, Illinois + 2,171 votes for Biden + Douglas, Illinois 6,221 votes for Trump - 2,327 votes for Biden - - - DuPage, Illinois + 2,327 votes for Biden + DuPage, Illinois 281,222 votes for Biden - 193,611 votes for Trump - - - Edgar, Illinois + 193,611 votes for Trump + Edgar, Illinois 6,169 votes for Trump - 1,869 votes for Biden - - - Edwards, Illinois + 1,869 votes for Biden + Edwards, Illinois 2,833 votes for Trump - 488 votes for Biden - - - Effingham, Illinois + 488 votes for Biden + Effingham, Illinois 14,983 votes for Trump - 3,700 votes for Biden - - - Fayette, Illinois + 3,700 votes for Biden + Fayette, Illinois 8,025 votes for Trump - 1,815 votes for Biden - - - Ford, Illinois + 1,815 votes for Biden + Ford, Illinois 4,956 votes for Trump - 1,691 votes for Biden - - - Franklin, Illinois + 1,691 votes for Biden + Franklin, Illinois 13,514 votes for Trump - 4,690 votes for Biden - - - Fulton, Illinois + 4,690 votes for Biden + Fulton, Illinois 9,798 votes for Trump - 6,371 votes for Biden - - - Gallatin, Illinois + 6,371 votes for Biden + Gallatin, Illinois 2,019 votes for Trump - 621 votes for Biden - - - Greene, Illinois + 621 votes for Biden + Greene, Illinois 4,767 votes for Trump - 1,349 votes for Biden - - - Grundy, Illinois + 1,349 votes for Biden + Grundy, Illinois 16,372 votes for Trump - 9,445 votes for Biden - - - Hamilton, Illinois + 9,445 votes for Biden + Hamilton, Illinois 3,429 votes for Trump - 821 votes for Biden - - - Hancock, Illinois + 821 votes for Biden + Hancock, Illinois 5,309 votes for Trump - 1,114 votes for Biden - - - Henderson, Illinois + 1,114 votes for Biden + Henderson, Illinois 2,391 votes for Trump - 1,186 votes for Biden - - - Henry, Illinois + 1,186 votes for Biden + Henry, Illinois 15,266 votes for Trump - 9,762 votes for Biden - - - Iroquois, Illinois + 9,762 votes for Biden + Iroquois, Illinois 10,858 votes for Trump - 2,895 votes for Biden - - - Jackson, Illinois + 2,895 votes for Biden + Jackson, Illinois 11,104 votes for Biden - 10,835 votes for Trump - - - Jasper, Illinois + 10,835 votes for Trump + Jasper, Illinois 4,492 votes for Trump - 1,006 votes for Biden - - - Jefferson, Illinois + 1,006 votes for Biden + Jefferson, Illinois 12,461 votes for Trump - 4,597 votes for Biden - - - Jersey, Illinois + 4,597 votes for Biden + Jersey, Illinois 8,699 votes for Trump - 2,956 votes for Biden - - - JoDaviess, Illinois + 2,956 votes for Biden + JoDaviess, Illinois 7,161 votes for Trump - 5,097 votes for Biden - - - Johnson, Illinois + 5,097 votes for Biden + Johnson, Illinois 5,052 votes for Trump - 1,280 votes for Biden - - - Kane, Illinois + 1,280 votes for Biden + Kane, Illinois 130,166 votes for Biden - 96,775 votes for Trump - - - Kankakee, Illinois + 96,775 votes for Trump + Kankakee, Illinois 28,410 votes for Trump - 20,112 votes for Biden - - - Kendall, Illinois + 20,112 votes for Biden + Kendall, Illinois 31,394 votes for Biden - 28,515 votes for Trump - - - Knox, Illinois + 28,515 votes for Trump + Knox, Illinois 11,818 votes for Trump - 10,421 votes for Biden - - - LaSalle, Illinois + 10,421 votes for Biden + LaSalle, Illinois 29,482 votes for Trump - 21,491 votes for Biden - - - Lake, Illinois + 21,491 votes for Biden + Lake, Illinois 204,032 votes for Biden - 123,594 votes for Trump - - - Lawrence, Illinois + 123,594 votes for Trump + Lawrence, Illinois 4,849 votes for Trump - 1,414 votes for Biden - - - Lee, Illinois + 1,414 votes for Biden + Lee, Illinois 9,584 votes for Trump - 6,368 votes for Biden - - - Livingston, Illinois + 6,368 votes for Biden + Livingston, Illinois 12,134 votes for Trump - 4,568 votes for Biden - - - Logan, Illinois + 4,568 votes for Biden + Logan, Illinois 9,042 votes for Trump - 3,769 votes for Biden - - - Macon, Illinois + 3,769 votes for Biden + Macon, Illinois 28,373 votes for Trump - 19,633 votes for Biden - - - Macoupin, Illinois + 19,633 votes for Biden + Macoupin, Illinois 16,058 votes for Trump - 7,313 votes for Biden - - - Madison, Illinois + 7,313 votes for Biden + Madison, Illinois 75,272 votes for Trump - 56,845 votes for Biden - - - Marion, Illinois + 56,845 votes for Biden + Marion, Illinois 12,540 votes for Trump - 4,396 votes for Biden - - - Marshall, Illinois + 4,396 votes for Biden + Marshall, Illinois 4,196 votes for Trump - 2,004 votes for Biden - - - Mason, Illinois + 2,004 votes for Biden + Mason, Illinois 4,645 votes for Trump - 1,984 votes for Biden - - - Massac, Illinois + 1,984 votes for Biden + Massac, Illinois 4,989 votes for Trump - 1,719 votes for Biden - - - McDonough, Illinois + 1,719 votes for Biden + McDonough, Illinois 7,009 votes for Trump - 4,973 votes for Biden - - - McHenry, Illinois + 4,973 votes for Biden + McHenry, Illinois 81,479 votes for Trump - 77,208 votes for Biden - - - McLean, Illinois + 77,208 votes for Biden + McLean, Illinois 43,719 votes for Biden - 40,365 votes for Trump - - - Menard, Illinois + 40,365 votes for Trump + Menard, Illinois 4,764 votes for Trump - 2,022 votes for Biden - - - Mercer, Illinois + 2,022 votes for Biden + Mercer, Illinois 5,328 votes for Trump - 3,212 votes for Biden - - - Monroe, Illinois + 3,212 votes for Biden + Monroe, Illinois 14,046 votes for Trump - 6,489 votes for Biden - - - Montgomery, Illinois + 6,489 votes for Biden + Montgomery, Illinois 9,504 votes for Trump - 3,889 votes for Biden - - - Morgan, Illinois + 3,889 votes for Biden + Morgan, Illinois 9,903 votes for Trump - 5,020 votes for Biden - - - Moultrie, Illinois + 5,020 votes for Biden + Moultrie, Illinois 4,938 votes for Trump - 1,645 votes for Biden - - - Ogle, Illinois + 1,645 votes for Biden + Ogle, Illinois 16,092 votes for Trump - 9,300 votes for Biden - - - Peoria, Illinois + 9,300 votes for Biden + Peoria, Illinois 42,600 votes for Biden - 37,612 votes for Trump - - - Perry, Illinois + 37,612 votes for Trump + Perry, Illinois 7,305 votes for Trump - 2,609 votes for Biden - - - Piatt, Illinois + 2,609 votes for Biden + Piatt, Illinois 6,219 votes for Trump - 3,302 votes for Biden - - - Pike, Illinois + 3,302 votes for Biden + Pike, Illinois 6,235 votes for Trump - 1,458 votes for Biden - - - Pope, Illinois + 1,458 votes for Biden + Pope, Illinois 1,720 votes for Trump - 432 votes for Biden - - - Pulaski, Illinois + 432 votes for Biden + Pulaski, Illinois 1,699 votes for Trump - 891 votes for Biden - - - Putnam, Illinois + 891 votes for Biden + Putnam, Illinois 1,978 votes for Trump - 1,309 votes for Biden - - - Randolph, Illinois + 1,309 votes for Biden + Randolph, Illinois 11,065 votes for Trump - 3,590 votes for Biden - - - Richland, Illinois + 3,590 votes for Biden + Richland, Illinois 7,988 votes for Trump - 1,355 votes for Biden - - - Rock Island, Illinois + 1,355 votes for Biden + Rock Island, Illinois 36,647 votes for Biden - 28,585 votes for Trump - - - Saline, Illinois + 28,585 votes for Trump + Saline, Illinois 8,096 votes for Trump - 2,786 votes for Biden - - - Sangamon, Illinois + 2,786 votes for Biden + Sangamon, Illinois 53,303 votes for Trump - 48,756 votes for Biden - - - Schuyler, Illinois + 48,756 votes for Biden + Schuyler, Illinois 2,767 votes for Trump - 1,064 votes for Biden - - - Scott, Illinois + 1,064 votes for Biden + Scott, Illinois 2,104 votes for Trump - 569 votes for Biden - - - Shelby, Illinois + 569 votes for Biden + Shelby, Illinois 9,396 votes for Trump - 2,488 votes for Biden - - - St. Clair, Illinois + 2,488 votes for Biden + St. Clair, Illinois 66,698 votes for Biden - 56,000 votes for Trump - - - Stark, Illinois + 56,000 votes for Trump + Stark, Illinois 2,000 votes for Trump - 814 votes for Biden - - - Stephenson, Illinois + 814 votes for Biden + Stephenson, Illinois 12,253 votes for Trump - 8,756 votes for Biden - - - Tazewell, Illinois + 8,756 votes for Biden + Tazewell, Illinois 42,194 votes for Trump - 24,486 votes for Biden - - - Union, Illinois + 24,486 votes for Biden + Union, Illinois 6,157 votes for Trump - 2,575 votes for Biden - - - Vermilion, Illinois + 2,575 votes for Biden + Vermilion, Illinois 20,710 votes for Trump - 10,313 votes for Biden - - - Wabash, Illinois + 10,313 votes for Biden + Wabash, Illinois 4,228 votes for Trump - 1,248 votes for Biden - - - Warren, Illinois + 1,248 votes for Biden + Warren, Illinois 4,671 votes for Trump - 3,087 votes for Biden - - - Washington, Illinois + 3,087 votes for Biden + Washington, Illinois 6,110 votes for Trump - 1,639 votes for Biden - - - Wayne, Illinois + 1,639 votes for Biden + Wayne, Illinois 7,172 votes for Trump - 1,185 votes for Biden - - - White, Illinois + 1,185 votes for Biden + White, Illinois 5,788 votes for Trump - 1,517 votes for Biden - - - Whiteside, Illinois + 1,517 votes for Biden + Whiteside, Illinois 14,472 votes for Trump - 12,195 votes for Biden - - - Will, Illinois + 12,195 votes for Biden + Will, Illinois 182,957 votes for Biden - 154,351 votes for Trump - - - Williamson, Illinois + 154,351 votes for Trump + Williamson, Illinois 22,681 votes for Trump - 10,107 votes for Biden - - - Winnebago, Illinois + 10,107 votes for Biden + Winnebago, Illinois 60,601 votes for Biden - 58,796 votes for Trump - - - Woodford, Illinois + 58,796 votes for Trump + Woodford, Illinois 14,590 votes for Trump - 5,976 votes for Biden - - - Adams, North Dakota + 5,976 votes for Biden + Adams, North Dakota 981 votes for Trump - 258 votes for Biden - - - Barnes, North Dakota + 258 votes for Biden + Barnes, North Dakota 3,568 votes for Trump - 1,820 votes for Biden - - - Benson, North Dakota + 1,820 votes for Biden + Benson, North Dakota 1,094 votes for Trump - 822 votes for Biden - - - Billings, North Dakota + 822 votes for Biden + Billings, North Dakota 541 votes for Trump - 72 votes for Biden - - - Bottineau, North Dakota + 72 votes for Biden + Bottineau, North Dakota 2,575 votes for Trump - 821 votes for Biden - - - Bowman, North Dakota + 821 votes for Biden + Bowman, North Dakota 1,395 votes for Trump - 228 votes for Biden - - - Burke, North Dakota + 228 votes for Biden + Burke, North Dakota 994 votes for Trump - 137 votes for Biden - - - Burleigh, North Dakota + 137 votes for Biden + Burleigh, North Dakota 34,744 votes for Trump - 14,348 votes for Biden - - - Cass, North Dakota + 14,348 votes for Biden + Cass, North Dakota 42,619 votes for Trump - 40,311 votes for Biden - - - Cavalier, North Dakota + 40,311 votes for Biden + Cavalier, North Dakota 1,499 votes for Trump - 474 votes for Biden - - - Dickey, North Dakota + 474 votes for Biden + Dickey, North Dakota 1,742 votes for Trump - 608 votes for Biden - - - Divide, North Dakota + 608 votes for Biden + Divide, North Dakota 904 votes for Trump - 265 votes for Biden - - - Dunn, North Dakota + 265 votes for Biden + Dunn, North Dakota 1,951 votes for Trump - 342 votes for Biden - - - Eddy, North Dakota + 342 votes for Biden + Eddy, North Dakota 854 votes for Trump - 383 votes for Biden - - - Emmons, North Dakota + 383 votes for Biden + Emmons, North Dakota 1,738 votes for Trump - 237 votes for Biden - - - Foster, North Dakota + 237 votes for Biden + Foster, North Dakota 1,362 votes for Trump - 373 votes for Biden - - - Golden Valley, North Dakota + 373 votes for Biden + Golden Valley, North Dakota 871 votes for Trump - 137 votes for Biden - - - Grand Forks, North Dakota + 137 votes for Biden + Grand Forks, North Dakota 16,987 votes for Trump - 12,880 votes for Biden - - - Grant, North Dakota + 12,880 votes for Biden + Grant, North Dakota 1,145 votes for Trump - 207 votes for Biden - - - Griggs, North Dakota + 207 votes for Biden + Griggs, North Dakota 907 votes for Trump - 308 votes for Biden - - - Hettinger, North Dakota + 308 votes for Biden + Hettinger, North Dakota 1,091 votes for Trump - 196 votes for Biden - - - Kidder, North Dakota + 196 votes for Biden + Kidder, North Dakota 1,215 votes for Trump - 221 votes for Biden - - - LaMoure, North Dakota + 221 votes for Biden + LaMoure, North Dakota 1,645 votes for Trump - 527 votes for Biden - - - Logan, North Dakota + 527 votes for Biden + Logan, North Dakota 930 votes for Trump - 128 votes for Biden - - - McHenry, North Dakota + 128 votes for Biden + McHenry, North Dakota 2,364 votes for Trump - 564 votes for Biden - - - McIntosh, North Dakota + 564 votes for Biden + McIntosh, North Dakota 1,153 votes for Trump - 261 votes for Biden - - - McKenzie, North Dakota + 261 votes for Biden + McKenzie, North Dakota 4,482 votes for Trump - 814 votes for Biden - - - McLean, North Dakota + 814 votes for Biden + McLean, North Dakota 4,198 votes for Trump - 1,230 votes for Biden - - - Mercer, North Dakota + 1,230 votes for Biden + Mercer, North Dakota 3,856 votes for Trump - 704 votes for Biden - - - Morton, North Dakota + 704 votes for Biden + Morton, North Dakota 12,243 votes for Trump - 3,872 votes for Biden - - - Mountrail, North Dakota + 3,872 votes for Biden + Mountrail, North Dakota 2,824 votes for Trump - 1,256 votes for Biden - - - Nelson, North Dakota + 1,256 votes for Biden + Nelson, North Dakota 1,141 votes for Trump - 586 votes for Biden - - - Oliver, North Dakota + 586 votes for Biden + Oliver, North Dakota 918 votes for Trump - 129 votes for Biden - - - Pembina, North Dakota + 129 votes for Biden + Pembina, North Dakota 2,460 votes for Trump - 786 votes for Biden - - - Pierce, North Dakota + 786 votes for Biden + Pierce, North Dakota 1,585 votes for Trump - 497 votes for Biden - - - Ramsey, North Dakota + 497 votes for Biden + Ramsey, North Dakota 3,577 votes for Trump - 1,639 votes for Biden - - - Ransom, North Dakota + 1,639 votes for Biden + Ransom, North Dakota 1,418 votes for Trump - 945 votes for Biden - - - Renville, North Dakota + 945 votes for Biden + Renville, North Dakota 1,065 votes for Trump - 220 votes for Biden - - - Richland, North Dakota + 220 votes for Biden + Richland, North Dakota 5,072 votes for Trump - 2,510 votes for Biden - - - Rolette, North Dakota + 2,510 votes for Biden + Rolette, North Dakota 2,482 votes for Biden - 1,257 votes for Trump - - - Sargent, North Dakota + 1,257 votes for Trump + Sargent, North Dakota 1,266 votes for Trump - 738 votes for Biden - - - Sheridan, North Dakota + 738 votes for Biden + Sheridan, North Dakota 688 votes for Trump - 104 votes for Biden - - - Sioux, North Dakota + 104 votes for Biden + Sioux, North Dakota 804 votes for Biden - 258 votes for Trump - - - Slope, North Dakota + 258 votes for Trump + Slope, North Dakota 380 votes for Trump - 44 votes for Biden - - - Stark, North Dakota + 44 votes for Biden + Stark, North Dakota 12,110 votes for Trump - 2,499 votes for Biden - - - Steele, North Dakota + 2,499 votes for Biden + Steele, North Dakota 652 votes for Trump - 392 votes for Biden - - - Stutsman, North Dakota + 392 votes for Biden + Stutsman, North Dakota 6,994 votes for Trump - 2,676 votes for Biden - - - Towner, North Dakota + 2,676 votes for Biden + Towner, North Dakota 830 votes for Trump - 317 votes for Biden - - - Traill, North Dakota + 317 votes for Biden + Traill, North Dakota 2,522 votes for Trump - 1,493 votes for Biden - - - Walsh, North Dakota + 1,493 votes for Biden + Walsh, North Dakota 3,324 votes for Trump - 1,333 votes for Biden - - - Ward, North Dakota + 1,333 votes for Biden + Ward, North Dakota 19,974 votes for Trump - 7,293 votes for Biden - - - Wells, North Dakota + 7,293 votes for Biden + Wells, North Dakota 1,893 votes for Trump - 442 votes for Biden - - - Williams, North Dakota + 442 votes for Biden + Williams, North Dakota 11,739 votes for Trump - 2,169 votes for Biden - - - Allegany, Maryland + 2,169 votes for Biden + Allegany, Maryland 20,886 votes for Trump - 9,158 votes for Biden - - - Anne Arundel, Maryland + 9,158 votes for Biden + Anne Arundel, Maryland 172,823 votes for Biden - 127,821 votes for Trump - - - Baltimore, Maryland + 127,821 votes for Trump + Baltimore, Maryland 236,859 votes for Biden - 139,229 votes for Trump - - - Baltimore City, Maryland + 139,229 votes for Trump + Baltimore City, Maryland 205,558 votes for Biden - 25,169 votes for Trump - - - Calvert, Maryland + 25,169 votes for Trump + Calvert, Maryland 25,346 votes for Trump - 22,587 votes for Biden - - - Caroline, Maryland + 22,587 votes for Biden + Caroline, Maryland 10,283 votes for Trump - 5,095 votes for Biden - - - Carroll, Maryland + 5,095 votes for Biden + Carroll, Maryland 60,218 votes for Trump - 36,456 votes for Biden - - - Cecil, Maryland + 36,456 votes for Biden + Cecil, Maryland 29,439 votes for Trump - 16,809 votes for Biden - - - Charles, Maryland + 16,809 votes for Biden + Charles, Maryland 62,171 votes for Biden - 25,579 votes for Trump - - - Dorchester, Maryland + 25,579 votes for Trump + Dorchester, Maryland 8,764 votes for Trump - 6,857 votes for Biden - - - Frederick, Maryland + 6,857 votes for Biden + Frederick, Maryland 76,554 votes for Biden - 63,101 votes for Trump - - - Garrett, Maryland + 63,101 votes for Trump + Garrett, Maryland 12,002 votes for Trump - 3,281 votes for Biden - - - Harford, Maryland + 3,281 votes for Biden + Harford, Maryland 80,930 votes for Trump - 63,095 votes for Biden - - - Howard, Maryland + 63,095 votes for Biden + Howard, Maryland 129,433 votes for Biden - 48,390 votes for Trump - - - Kent, Maryland + 48,390 votes for Trump + Kent, Maryland 5,329 votes for Biden - 5,195 votes for Trump - - - Montgomery, Maryland + 5,195 votes for Trump + Montgomery, Maryland 385,321 votes for Biden - 94,335 votes for Trump - - - Prince George's, Maryland + 94,335 votes for Trump + Prince George's, Maryland 370,212 votes for Biden - 36,006 votes for Trump - - - Queen Anne's, Maryland + 36,006 votes for Trump + Queen Anne's, Maryland 18,741 votes for Trump - 10,709 votes for Biden - - - Somerset, Maryland + 10,709 votes for Biden + Somerset, Maryland 5,739 votes for Trump - 4,241 votes for Biden - - - St. Mary's, Maryland + 4,241 votes for Biden + St. Mary's, Maryland 30,826 votes for Trump - 23,138 votes for Biden - - - Talbot, Maryland + 23,138 votes for Biden + Talbot, Maryland 11,062 votes for Biden - 10,946 votes for Trump - - - Washington, Maryland + 10,946 votes for Trump + Washington, Maryland 40,221 votes for Trump - 26,044 votes for Biden - - - Wicomico, Maryland + 26,044 votes for Biden + Wicomico, Maryland 22,944 votes for Trump - 22,054 votes for Biden - - - Worcester, Maryland + 22,054 votes for Biden + Worcester, Maryland 18,571 votes for Trump - 12,560 votes for Biden - - - Appling, Georgia + 12,560 votes for Biden + Appling, Georgia 6,526 votes for Trump - 1,779 votes for Biden - - - Atkinson, Georgia + 1,779 votes for Biden + Atkinson, Georgia 2,300 votes for Trump - 825 votes for Biden - - - Bacon, Georgia + 825 votes for Biden + Bacon, Georgia 4,018 votes for Trump - 625 votes for Biden - - - Baker, Georgia + 625 votes for Biden + Baker, Georgia 897 votes for Trump - 652 votes for Biden - - - Baldwin, Georgia + 652 votes for Biden + Baldwin, Georgia 9,140 votes for Biden - 8,903 votes for Trump - - - Banks, Georgia + 8,903 votes for Trump + Banks, Georgia 7,795 votes for Trump - 932 votes for Biden - - - Barrow, Georgia + 932 votes for Biden + Barrow, Georgia 26,804 votes for Trump - 10,453 votes for Biden - - - Bartow, Georgia + 10,453 votes for Biden + Bartow, Georgia 37,674 votes for Trump - 12,092 votes for Biden - - - Ben Hill, Georgia + 12,092 votes for Biden + Ben Hill, Georgia 4,110 votes for Trump - 2,392 votes for Biden - - - Berrien, Georgia + 2,392 votes for Biden + Berrien, Georgia 6,419 votes for Trump - 1,269 votes for Biden - - - Bibb, Georgia + 1,269 votes for Biden + Bibb, Georgia 43,468 votes for Biden - 26,585 votes for Trump - - - Bleckley, Georgia + 26,585 votes for Trump + Bleckley, Georgia 4,328 votes for Trump - 1,311 votes for Biden - - - Brantley, Georgia + 1,311 votes for Biden + Brantley, Georgia 6,991 votes for Trump - 699 votes for Biden - - - Brooks, Georgia + 699 votes for Biden + Brooks, Georgia 4,260 votes for Trump - 2,790 votes for Biden - - - Bryan, Georgia + 2,790 votes for Biden + Bryan, Georgia 14,244 votes for Trump - 6,739 votes for Biden - - - Bulloch, Georgia + 6,739 votes for Biden + Bulloch, Georgia 18,386 votes for Trump - 11,243 votes for Biden - - - Burke, Georgia + 11,243 votes for Biden + Burke, Georgia 5,400 votes for Trump - 5,209 votes for Biden - - - Butts, Georgia + 5,209 votes for Biden + Butts, Georgia 8,405 votes for Trump - 3,272 votes for Biden - - - Calhoun, Georgia + 3,272 votes for Biden + Calhoun, Georgia 1,260 votes for Biden - 923 votes for Trump - - - Camden, Georgia + 923 votes for Trump + Camden, Georgia 15,251 votes for Trump - 7,967 votes for Biden - - - Candler, Georgia + 7,967 votes for Biden + Candler, Georgia 3,134 votes for Trump - 1,269 votes for Biden - - - Carroll, Georgia + 1,269 votes for Biden + Carroll, Georgia 37,476 votes for Trump - 16,238 votes for Biden - - - Catoosa, Georgia + 16,238 votes for Biden + Catoosa, Georgia 25,167 votes for Trump - 6,932 votes for Biden - - - Charlton, Georgia + 6,932 votes for Biden + Charlton, Georgia 3,419 votes for Trump - 1,103 votes for Biden - - - Chatham, Georgia + 1,103 votes for Biden + Chatham, Georgia 78,369 votes for Biden - 53,288 votes for Trump - - - Chattahoochee, Georgia + 53,288 votes for Trump + Chattahoochee, Georgia 880 votes for Trump - 667 votes for Biden - - - Chattooga, Georgia + 667 votes for Biden + Chattooga, Georgia 8,064 votes for Trump - 1,854 votes for Biden - - - Cherokee, Georgia + 1,854 votes for Biden + Cherokee, Georgia 99,587 votes for Trump - 42,794 votes for Biden - - - Clarke, Georgia + 42,794 votes for Biden + Clarke, Georgia 36,048 votes for Biden - 14,446 votes for Trump - - - Clay, Georgia + 14,446 votes for Trump + Clay, Georgia 790 votes for Biden - 637 votes for Trump - - - Clayton, Georgia + 637 votes for Trump + Clayton, Georgia 95,476 votes for Biden - 15,813 votes for Trump - - - Clinch, Georgia + 15,813 votes for Trump + Clinch, Georgia 2,105 votes for Trump - 747 votes for Biden - - - Cobb, Georgia + 747 votes for Biden + Cobb, Georgia 221,846 votes for Biden - 165,459 votes for Trump - - - Coffee, Georgia + 165,459 votes for Trump + Coffee, Georgia 10,578 votes for Trump - 4,511 votes for Biden - - - Colquitt, Georgia + 4,511 votes for Biden + Colquitt, Georgia 11,777 votes for Trump - 4,187 votes for Biden - - - Columbia, Georgia + 4,187 votes for Biden + Columbia, Georgia 50,013 votes for Trump - 29,236 votes for Biden - - - Cook, Georgia + 29,236 votes for Biden + Cook, Georgia 4,900 votes for Trump - 2,059 votes for Biden - - - Coweta, Georgia + 2,059 votes for Biden + Coweta, Georgia 51,501 votes for Trump - 24,210 votes for Biden - - - Crawford, Georgia + 24,210 votes for Biden + Crawford, Georgia 4,428 votes for Trump - 1,615 votes for Biden - - - Crisp, Georgia + 1,615 votes for Biden + Crisp, Georgia 4,987 votes for Trump - 2,986 votes for Biden - - - Dade, Georgia + 2,986 votes for Biden + Dade, Georgia 6,066 votes for Trump - 1,261 votes for Biden - - - Dawson, Georgia + 1,261 votes for Biden + Dawson, Georgia 13,398 votes for Trump - 2,486 votes for Biden - - - DeKalb, Georgia + 2,486 votes for Biden + DeKalb, Georgia 308,140 votes for Biden - 58,369 votes for Trump - - - Decatur, Georgia + 58,369 votes for Trump + Decatur, Georgia 6,758 votes for Trump - 4,780 votes for Biden - - - Dodge, Georgia + 4,780 votes for Biden + Dodge, Georgia 5,843 votes for Trump - 2,171 votes for Biden - - - Dooly, Georgia + 2,171 votes for Biden + Dooly, Georgia 2,159 votes for Trump - 1,911 votes for Biden - - - Dougherty, Georgia + 1,911 votes for Biden + Dougherty, Georgia 24,579 votes for Biden - 10,449 votes for Trump - - - Douglas, Georgia + 10,449 votes for Trump + Douglas, Georgia 42,809 votes for Biden - 25,451 votes for Trump - - - Early, Georgia + 25,451 votes for Trump + Early, Georgia 2,722 votes for Trump - 2,437 votes for Biden - - - Echols, Georgia + 2,437 votes for Biden + Echols, Georgia 1,256 votes for Trump - 167 votes for Biden - - - Effingham, Georgia + 167 votes for Biden + Effingham, Georgia 23,357 votes for Trump - 7,720 votes for Biden - - - Elbert, Georgia + 7,720 votes for Biden + Elbert, Georgia 6,226 votes for Trump - 2,879 votes for Biden - - - Emanuel, Georgia + 2,879 votes for Biden + Emanuel, Georgia 6,551 votes for Trump - 2,884 votes for Biden - - - Evans, Georgia + 2,884 votes for Biden + Evans, Georgia 2,888 votes for Trump - 1,324 votes for Biden - - - Fannin, Georgia + 1,324 votes for Biden + Fannin, Georgia 12,169 votes for Trump - 2,571 votes for Biden - - - Fayette, Georgia + 2,571 votes for Biden + Fayette, Georgia 36,375 votes for Trump - 31,937 votes for Biden - - - Floyd, Georgia + 31,937 votes for Biden + Floyd, Georgia 27,120 votes for Trump - 10,972 votes for Biden - - - Forsyth, Georgia + 10,972 votes for Biden + Forsyth, Georgia 85,122 votes for Trump - 42,203 votes for Biden - - - Franklin, Georgia + 42,203 votes for Biden + Franklin, Georgia 9,069 votes for Trump - 1,593 votes for Biden - - - Fulton, Georgia + 1,593 votes for Biden + Fulton, Georgia 381,144 votes for Biden - 137,240 votes for Trump - - - Gilmer, Georgia + 137,240 votes for Trump + Gilmer, Georgia 13,429 votes for Trump - 2,932 votes for Biden - - - Glascock, Georgia + 2,932 votes for Biden + Glascock, Georgia 1,403 votes for Trump - 155 votes for Biden - - - Glynn, Georgia + 155 votes for Biden + Glynn, Georgia 25,616 votes for Trump - 15,879 votes for Biden - - - Gordon, Georgia + 15,879 votes for Biden + Gordon, Georgia 19,405 votes for Trump - 4,384 votes for Biden - - - Grady, Georgia + 4,384 votes for Biden + Grady, Georgia 7,034 votes for Trump - 3,619 votes for Biden - - - Greene, Georgia + 3,619 votes for Biden + Greene, Georgia 7,068 votes for Trump - 4,088 votes for Biden - - - Gwinnett, Georgia + 4,088 votes for Biden + Gwinnett, Georgia 241,827 votes for Biden - 166,413 votes for Trump - - - Habersham, Georgia + 166,413 votes for Trump + Habersham, Georgia 16,637 votes for Trump - 3,563 votes for Biden - - - Hall, Georgia + 3,563 votes for Biden + Hall, Georgia 64,170 votes for Trump - 25,031 votes for Biden - - - Hancock, Georgia + 25,031 votes for Biden + Hancock, Georgia 2,985 votes for Biden - 1,159 votes for Trump - - - Haralson, Georgia + 1,159 votes for Trump + Haralson, Georgia 12,331 votes for Trump - 1,792 votes for Biden - - - Harris, Georgia + 1,792 votes for Biden + Harris, Georgia 14,319 votes for Trump - 5,457 votes for Biden - - - Hart, Georgia + 5,457 votes for Biden + Hart, Georgia 9,464 votes for Trump - 3,157 votes for Biden - - - Heard, Georgia + 3,157 votes for Biden + Heard, Georgia 4,516 votes for Trump - 824 votes for Biden - - - Henry, Georgia + 824 votes for Biden + Henry, Georgia 73,276 votes for Biden - 48,187 votes for Trump - - - Houston, Georgia + 48,187 votes for Trump + Houston, Georgia 41,534 votes for Trump - 32,232 votes for Biden - - - Irwin, Georgia + 32,232 votes for Biden + Irwin, Georgia 3,134 votes for Trump - 1,008 votes for Biden - - - Jackson, Georgia + 1,008 votes for Biden + Jackson, Georgia 29,497 votes for Trump - 7,642 votes for Biden - - - Jasper, Georgia + 7,642 votes for Biden + Jasper, Georgia 5,822 votes for Trump - 1,761 votes for Biden - - - Jeff Davis, Georgia + 1,761 votes for Biden + Jeff Davis, Georgia 4,695 votes for Trump - 1,028 votes for Biden - - - Jefferson, Georgia + 1,028 votes for Biden + Jefferson, Georgia 4,061 votes for Biden - 3,537 votes for Trump - - - Jenkins, Georgia + 3,537 votes for Trump + Jenkins, Georgia 2,161 votes for Trump - 1,266 votes for Biden - - - Johnson, Georgia + 1,266 votes for Biden + Johnson, Georgia 2,850 votes for Trump - 1,222 votes for Biden - - - Jones, Georgia + 1,222 votes for Biden + Jones, Georgia 9,965 votes for Trump - 4,888 votes for Biden - - - Lamar, Georgia + 4,888 votes for Biden + Lamar, Georgia 6,330 votes for Trump - 2,615 votes for Biden - - - Lanier, Georgia + 2,615 votes for Biden + Lanier, Georgia 2,509 votes for Trump - 1,019 votes for Biden - - - Laurens, Georgia + 1,019 votes for Biden + Laurens, Georgia 14,493 votes for Trump - 8,073 votes for Biden - - - Lee, Georgia + 8,073 votes for Biden + Lee, Georgia 12,007 votes for Trump - 4,558 votes for Biden - - - Liberty, Georgia + 4,558 votes for Biden + Liberty, Georgia 13,099 votes for Biden - 7,959 votes for Trump - - - Lincoln, Georgia + 7,959 votes for Trump + Lincoln, Georgia 3,179 votes for Trump - 1,435 votes for Biden - - - Long, Georgia + 1,435 votes for Biden + Long, Georgia 3,528 votes for Trump - 2,033 votes for Biden - - - Lowndes, Georgia + 2,033 votes for Biden + Lowndes, Georgia 25,691 votes for Trump - 20,117 votes for Biden - - - Lumpkin, Georgia + 20,117 votes for Biden + Lumpkin, Georgia 12,163 votes for Trump - 3,126 votes for Biden - - - Macon, Georgia + 3,126 votes for Biden + Macon, Georgia 2,857 votes for Biden - 1,783 votes for Trump - - - Madison, Georgia + 1,783 votes for Trump + Madison, Georgia 11,326 votes for Trump - 3,411 votes for Biden - - - Marion, Georgia + 3,411 votes for Biden + Marion, Georgia 2,275 votes for Trump - 1,311 votes for Biden - - - McDuffie, Georgia + 1,311 votes for Biden + McDuffie, Georgia 6,169 votes for Trump - 4,168 votes for Biden - - - McIntosh, Georgia + 4,168 votes for Biden + McIntosh, Georgia 4,016 votes for Trump - 2,612 votes for Biden - - - Meriwether, Georgia + 2,612 votes for Biden + Meriwether, Georgia 6,524 votes for Trump - 4,287 votes for Biden - - - Miller, Georgia + 4,287 votes for Biden + Miller, Georgia 2,066 votes for Trump - 749 votes for Biden - - - Mitchell, Georgia + 749 votes for Biden + Mitchell, Georgia 4,935 votes for Trump - 3,995 votes for Biden - - - Monroe, Georgia + 3,995 votes for Biden + Monroe, Georgia 11,060 votes for Trump - 4,384 votes for Biden - - - Montgomery, Georgia + 4,384 votes for Biden + Montgomery, Georgia 2,960 votes for Trump - 979 votes for Biden - - - Morgan, Georgia + 979 votes for Biden + Morgan, Georgia 8,230 votes for Trump - 3,355 votes for Biden - - - Murray, Georgia + 3,355 votes for Biden + Murray, Georgia 12,943 votes for Trump - 2,302 votes for Biden - - - Muscogee, Georgia + 2,302 votes for Biden + Muscogee, Georgia 49,529 votes for Biden - 30,049 votes for Trump - - - Newton, Georgia + 30,049 votes for Trump + Newton, Georgia 29,794 votes for Biden - 23,869 votes for Trump - - - Oconee, Georgia + 23,869 votes for Trump + Oconee, Georgia 16,595 votes for Trump - 8,162 votes for Biden - - - Oglethorpe, Georgia + 8,162 votes for Biden + Oglethorpe, Georgia 5,593 votes for Trump - 2,436 votes for Biden - - - Paulding, Georgia + 2,436 votes for Biden + Paulding, Georgia 54,525 votes for Trump - 29,704 votes for Biden - - - Peach, Georgia + 29,704 votes for Biden + Peach, Georgia 6,502 votes for Trump - 5,920 votes for Biden - - - Pickens, Georgia + 5,920 votes for Biden + Pickens, Georgia 14,075 votes for Trump - 2,808 votes for Biden - - - Pierce, Georgia + 2,808 votes for Biden + Pierce, Georgia 7,899 votes for Trump - 1,100 votes for Biden - - - Pike, Georgia + 1,100 votes for Biden + Pike, Georgia 9,127 votes for Trump - 1,505 votes for Biden - - - Polk, Georgia + 1,505 votes for Biden + Polk, Georgia 13,589 votes for Trump - 3,658 votes for Biden - - - Pulaski, Georgia + 3,658 votes for Biden + Pulaski, Georgia 2,805 votes for Trump - 1,217 votes for Biden - - - Putnam, Georgia + 1,217 votes for Biden + Putnam, Georgia 8,291 votes for Trump - 3,448 votes for Biden - - - Quitman, Georgia + 3,448 votes for Biden + Quitman, Georgia 604 votes for Trump - 497 votes for Biden - - - Rabun, Georgia + 497 votes for Biden + Rabun, Georgia 7,474 votes for Trump - 1,984 votes for Biden - - - Randolph, Georgia + 1,984 votes for Biden + Randolph, Georgia 1,671 votes for Biden - 1,391 votes for Trump - - - Richmond, Georgia + 1,391 votes for Trump + Richmond, Georgia 59,124 votes for Biden - 26,781 votes for Trump - - - Rockdale, Georgia + 26,781 votes for Trump + Rockdale, Georgia 31,244 votes for Biden - 13,012 votes for Trump - - - Schley, Georgia + 13,012 votes for Trump + Schley, Georgia 1,800 votes for Trump - 462 votes for Biden - - - Screven, Georgia + 462 votes for Biden + Screven, Georgia 3,916 votes for Trump - 2,661 votes for Biden - - - Seminole, Georgia + 2,661 votes for Biden + Seminole, Georgia 2,611 votes for Trump - 1,254 votes for Biden - - - Spalding, Georgia + 1,254 votes for Biden + Spalding, Georgia 18,057 votes for Trump - 11,784 votes for Biden - - - Stephens, Georgia + 11,784 votes for Biden + Stephens, Georgia 9,368 votes for Trump - 2,385 votes for Biden - - - Stewart, Georgia + 2,385 votes for Biden + Stewart, Georgia 1,182 votes for Biden - 801 votes for Trump - - - Sumter, Georgia + 801 votes for Trump + Sumter, Georgia 6,318 votes for Biden - 5,732 votes for Trump - - - Talbot, Georgia + 5,732 votes for Trump + Talbot, Georgia 2,114 votes for Biden - 1,392 votes for Trump - - - Taliaferro, Georgia + 1,392 votes for Trump + Taliaferro, Georgia 561 votes for Biden - 360 votes for Trump - - - Tattnall, Georgia + 360 votes for Trump + Tattnall, Georgia 6,053 votes for Trump - 2,061 votes for Biden - - - Taylor, Georgia + 2,061 votes for Biden + Taylor, Georgia 2,418 votes for Trump - 1,387 votes for Biden - - - Telfair, Georgia + 1,387 votes for Biden + Telfair, Georgia 2,825 votes for Trump - 1,487 votes for Biden - - - Terrell, Georgia + 1,487 votes for Biden + Terrell, Georgia 2,376 votes for Biden - 2,004 votes for Trump - - - Thomas, Georgia + 2,004 votes for Trump + Thomas, Georgia 12,954 votes for Trump - 8,708 votes for Biden - - - Tift, Georgia + 8,708 votes for Biden + Tift, Georgia 10,784 votes for Trump - 5,322 votes for Biden - - - Toombs, Georgia + 5,322 votes for Biden + Toombs, Georgia 7,872 votes for Trump - 2,939 votes for Biden - - - Towns, Georgia + 2,939 votes for Biden + Towns, Georgia 6,384 votes for Trump - 1,550 votes for Biden - - - Treutlen, Georgia + 1,550 votes for Biden + Treutlen, Georgia 2,101 votes for Trump - 952 votes for Biden - - - Troup, Georgia + 952 votes for Biden + Troup, Georgia 18,146 votes for Trump - 11,585 votes for Biden - - - Turner, Georgia + 11,585 votes for Biden + Turner, Georgia 2,349 votes for Trump - 1,410 votes for Biden - - - Twiggs, Georgia + 1,410 votes for Biden + Twiggs, Georgia 2,370 votes for Trump - 2,044 votes for Biden - - - Union, Georgia + 2,044 votes for Biden + Union, Georgia 12,651 votes for Trump - 2,801 votes for Biden - - - Upson, Georgia + 2,801 votes for Biden + Upson, Georgia 8,608 votes for Trump - 4,201 votes for Biden - - - Walker, Georgia + 4,201 votes for Biden + Walker, Georgia 23,174 votes for Trump - 5,769 votes for Biden - - - Walton, Georgia + 5,769 votes for Biden + Walton, Georgia 37,842 votes for Trump - 12,682 votes for Biden - - - Ware, Georgia + 12,682 votes for Biden + Ware, Georgia 9,930 votes for Trump - 4,249 votes for Biden - - - Warren, Georgia + 4,249 votes for Biden + Warren, Georgia 1,488 votes for Biden - 1,177 votes for Trump - - - Washington, Georgia + 1,177 votes for Trump + Washington, Georgia 4,730 votes for Biden - 4,663 votes for Trump - - - Wayne, Georgia + 4,663 votes for Trump + Wayne, Georgia 9,987 votes for Trump - 2,687 votes for Biden - - - Webster, Georgia + 2,687 votes for Biden + Webster, Georgia 748 votes for Trump - 639 votes for Biden - - - Wheeler, Georgia + 639 votes for Biden + Wheeler, Georgia 1,583 votes for Trump - 689 votes for Biden - - - White, Georgia + 689 votes for Biden + White, Georgia 12,222 votes for Trump - 2,411 votes for Biden - - - Whitfield, Georgia + 2,411 votes for Biden + Whitfield, Georgia 25,636 votes for Trump - 10,670 votes for Biden - - - Wilcox, Georgia + 10,670 votes for Biden + Wilcox, Georgia 2,403 votes for Trump - 862 votes for Biden - - - Wilkes, Georgia + 862 votes for Biden + Wilkes, Georgia 2,823 votes for Trump - 2,159 votes for Biden - - - Wilkinson, Georgia + 2,159 votes for Biden + Wilkinson, Georgia 2,664 votes for Trump - 2,075 votes for Biden - - - Worth, Georgia + 2,075 votes for Biden + Worth, Georgia 6,831 votes for Trump - 2,395 votes for Biden - - - Anderson, Tennessee + 2,395 votes for Biden + Anderson, Tennessee 23,163 votes for Trump - 11,733 votes for Biden - - - Bedford, Tennessee + 11,733 votes for Biden + Bedford, Tennessee 14,317 votes for Trump - 4,443 votes for Biden - - - Benton, Tennessee + 4,443 votes for Biden + Benton, Tennessee 5,661 votes for Trump - 1,526 votes for Biden - - - Bledsoe, Tennessee + 1,526 votes for Biden + Bledsoe, Tennessee 4,725 votes for Trump - 971 votes for Biden - - - Blount, Tennessee + 971 votes for Biden + Blount, Tennessee 47,195 votes for Trump - 17,834 votes for Biden - - - Bradley, Tennessee + 17,834 votes for Biden + Bradley, Tennessee 35,194 votes for Trump - 9,849 votes for Biden - - - Campbell, Tennessee + 9,849 votes for Biden + Campbell, Tennessee 12,330 votes for Trump - 2,438 votes for Biden - - - Cannon, Tennessee + 2,438 votes for Biden + Cannon, Tennessee 5,190 votes for Trump - 1,261 votes for Biden - - - Carroll, Tennessee + 1,261 votes for Biden + Carroll, Tennessee 9,194 votes for Trump - 2,558 votes for Biden - - - Carter, Tennessee + 2,558 votes for Biden + Carter, Tennessee 19,873 votes for Trump - 4,613 votes for Biden - - - Cheatham, Tennessee + 4,613 votes for Biden + Cheatham, Tennessee 14,328 votes for Trump - 5,457 votes for Biden - - - Chester, Tennessee + 5,457 votes for Biden + Chester, Tennessee 5,951 votes for Trump - 1,411 votes for Biden - - - Claiborne, Tennessee + 1,411 votes for Biden + Claiborne, Tennessee 10,598 votes for Trump - 2,201 votes for Biden - - - Clay, Tennessee + 2,201 votes for Biden + Clay, Tennessee 2,733 votes for Trump - 735 votes for Biden - - - Cocke, Tennessee + 735 votes for Biden + Cocke, Tennessee 12,182 votes for Trump - 2,524 votes for Biden - - - Coffee, Tennessee + 2,524 votes for Biden + Coffee, Tennessee 17,863 votes for Trump - 5,704 votes for Biden - - - Crockett, Tennessee + 5,704 votes for Biden + Crockett, Tennessee 4,673 votes for Trump - 1,382 votes for Biden - - - Cumberland, Tennessee + 1,382 votes for Biden + Cumberland, Tennessee 25,167 votes for Trump - 6,728 votes for Biden - - - Davidson, Tennessee + 6,728 votes for Biden + Davidson, Tennessee 197,846 votes for Biden - 99,415 votes for Trump - - - DeKalb, Tennessee + 99,415 votes for Trump + DeKalb, Tennessee 6,663 votes for Trump - 1,747 votes for Biden - - - Decatur, Tennessee + 1,747 votes for Biden + Decatur, Tennessee 4,229 votes for Trump - 904 votes for Biden - - - Dickson, Tennessee + 904 votes for Biden + Dickson, Tennessee 17,619 votes for Trump - 6,098 votes for Biden - - - Dyer, Tennessee + 6,098 votes for Biden + Dyer, Tennessee 11,766 votes for Trump - 3,157 votes for Biden - - - Fayette, Tennessee + 3,157 votes for Biden + Fayette, Tennessee 15,661 votes for Trump - 7,000 votes for Biden - - - Fentress, Tennessee + 7,000 votes for Biden + Fentress, Tennessee 7,403 votes for Trump - 1,210 votes for Biden - - - Franklin, Tennessee + 1,210 votes for Biden + Franklin, Tennessee 13,977 votes for Trump - 4,863 votes for Biden - - - Gibson, Tennessee + 4,863 votes for Biden + Gibson, Tennessee 16,245 votes for Trump - 5,764 votes for Biden - - - Giles, Tennessee + 5,764 votes for Biden + Giles, Tennessee 9,783 votes for Trump - 3,298 votes for Biden - - - Grainger, Tennessee + 3,298 votes for Biden + Grainger, Tennessee 8,559 votes for Trump - 1,463 votes for Biden - - - Greene, Tennessee + 1,463 votes for Biden + Greene, Tennessee 22,185 votes for Trump - 5,183 votes for Biden - - - Grundy, Tennessee + 5,183 votes for Biden + Grundy, Tennessee 4,795 votes for Trump - 985 votes for Biden - - - Hamblen, Tennessee + 985 votes for Biden + Hamblen, Tennessee 18,789 votes for Trump - 5,497 votes for Biden - - - Hamilton, Tennessee + 5,497 votes for Biden + Hamilton, Tennessee 91,991 votes for Trump - 75,360 votes for Biden - - - Hancock, Tennessee + 75,360 votes for Biden + Hancock, Tennessee 2,372 votes for Trump - 362 votes for Biden - - - Hardeman, Tennessee + 362 votes for Biden + Hardeman, Tennessee 5,760 votes for Trump - 4,180 votes for Biden - - - Hardin, Tennessee + 4,180 votes for Biden + Hardin, Tennessee 9,556 votes for Trump - 1,774 votes for Biden - - - Hawkins, Tennessee + 1,774 votes for Biden + Hawkins, Tennessee 20,372 votes for Trump - 4,069 votes for Biden - - - Haywood, Tennessee + 4,069 votes for Biden + Haywood, Tennessee 4,000 votes for Biden - 3,338 votes for Trump - - - Henderson, Tennessee + 3,338 votes for Trump + Henderson, Tennessee 9,797 votes for Trump - 2,092 votes for Biden - - - Henry, Tennessee + 2,092 votes for Biden + Henry, Tennessee 11,230 votes for Trump - 3,547 votes for Biden - - - Hickman, Tennessee + 3,547 votes for Biden + Hickman, Tennessee 7,577 votes for Trump - 2,130 votes for Biden - - - Houston, Tennessee + 2,130 votes for Biden + Houston, Tennessee 2,715 votes for Trump - 869 votes for Biden - - - Humphreys, Tennessee + 869 votes for Biden + Humphreys, Tennessee 6,116 votes for Trump - 2,017 votes for Biden - - - Jackson, Tennessee + 2,017 votes for Biden + Jackson, Tennessee 4,106 votes for Trump - 1,133 votes for Biden - - - Jefferson, Tennessee + 1,133 votes for Biden + Jefferson, Tennessee 18,609 votes for Trump - 4,645 votes for Biden - - - Johnson, Tennessee + 4,645 votes for Biden + Johnson, Tennessee 6,466 votes for Trump - 1,242 votes for Biden - - - Knox, Tennessee + 1,242 votes for Biden + Knox, Tennessee 124,339 votes for Trump - 91,097 votes for Biden - - - Lake, Tennessee + 91,097 votes for Biden + Lake, Tennessee 1,492 votes for Trump - 526 votes for Biden - - - Lauderdale, Tennessee + 526 votes for Biden + Lauderdale, Tennessee 5,672 votes for Trump - 3,193 votes for Biden - - - Lawrence, Tennessee + 3,193 votes for Biden + Lawrence, Tennessee 15,334 votes for Trump - 3,195 votes for Biden - - - Lewis, Tennessee + 3,195 votes for Biden + Lewis, Tennessee 4,473 votes for Trump - 1,068 votes for Biden - - - Lincoln, Tennessee + 1,068 votes for Biden + Lincoln, Tennessee 12,258 votes for Trump - 2,909 votes for Biden - - - Loudon, Tennessee + 2,909 votes for Biden + Loudon, Tennessee 21,684 votes for Trump - 6,933 votes for Biden - - - Macon, Tennessee + 6,933 votes for Biden + Macon, Tennessee 8,095 votes for Trump - 1,307 votes for Biden - - - Madison, Tennessee + 1,307 votes for Biden + Madison, Tennessee 23,922 votes for Trump - 18,309 votes for Biden - - - Marion, Tennessee + 18,309 votes for Biden + Marion, Tennessee 9,873 votes for Trump - 3,165 votes for Biden - - - Marshall, Tennessee + 3,165 votes for Biden + Marshall, Tennessee 11,029 votes for Trump - 3,603 votes for Biden - - - Maury, Tennessee + 3,603 votes for Biden + Maury, Tennessee 31,408 votes for Trump - 14,386 votes for Biden - - - McMinn, Tennessee + 14,386 votes for Biden + McMinn, Tennessee 18,175 votes for Trump - 4,357 votes for Biden - - - McNairy, Tennessee + 4,357 votes for Biden + McNairy, Tennessee 9,085 votes for Trump - 1,943 votes for Biden - - - Meigs, Tennessee + 1,943 votes for Biden + Meigs, Tennessee 4,464 votes for Trump - 1,008 votes for Biden - - - Monroe, Tennessee + 1,008 votes for Biden + Monroe, Tennessee 16,742 votes for Trump - 3,760 votes for Biden - - - Montgomery, Tennessee + 3,760 votes for Biden + Montgomery, Tennessee 42,156 votes for Trump - 32,426 votes for Biden - - - Moore, Tennessee + 32,426 votes for Biden + Moore, Tennessee 2,888 votes for Trump - 573 votes for Biden - - - Morgan, Tennessee + 573 votes for Biden + Morgan, Tennessee 6,926 votes for Trump - 1,161 votes for Biden - - - Obion, Tennessee + 1,161 votes for Biden + Obion, Tennessee 10,790 votes for Trump - 2,589 votes for Biden - - - Overton, Tennessee + 2,589 votes for Biden + Overton, Tennessee 7,911 votes for Trump - 2,028 votes for Biden - - - Perry, Tennessee + 2,028 votes for Biden + Perry, Tennessee 2,775 votes for Trump - 615 votes for Biden - - - Pickett, Tennessee + 615 votes for Biden + Pickett, Tennessee 2,373 votes for Trump - 524 votes for Biden - - - Polk, Tennessee + 524 votes for Biden + Polk, Tennessee 6,792 votes for Trump - 1,492 votes for Biden - - - Putnam, Tennessee + 1,492 votes for Biden + Putnam, Tennessee 23,694 votes for Trump - 9,154 votes for Biden - - - Rhea, Tennessee + 9,154 votes for Biden + Rhea, Tennessee 11,031 votes for Trump - 2,363 votes for Biden - - - Roane, Tennessee + 2,363 votes for Biden + Roane, Tennessee 19,195 votes for Trump - 6,034 votes for Biden - - - Robertson, Tennessee + 6,034 votes for Biden + Robertson, Tennessee 24,535 votes for Trump - 8,690 votes for Biden - - - Rutherford, Tennessee + 8,690 votes for Biden + Rutherford, Tennessee 81,373 votes for Trump - 59,189 votes for Biden - - - Scott, Tennessee + 59,189 votes for Biden + Scott, Tennessee 8,004 votes for Trump - 986 votes for Biden - - - Sequatchie, Tennessee + 986 votes for Biden + Sequatchie, Tennessee 5,846 votes for Trump - 1,295 votes for Biden - - - Sevier, Tennessee + 1,295 votes for Biden + Sevier, Tennessee 33,742 votes for Trump - 8,695 votes for Biden - - - Shelby, Tennessee + 8,695 votes for Biden + Shelby, Tennessee 245,208 votes for Biden - 129,543 votes for Trump - - - Smith, Tennessee + 129,543 votes for Trump + Smith, Tennessee 7,124 votes for Trump - 1,798 votes for Biden - - - Stewart, Tennessee + 1,798 votes for Biden + Stewart, Tennessee 4,942 votes for Trump - 1,230 votes for Biden - - - Sullivan, Tennessee + 1,230 votes for Biden + Sullivan, Tennessee 55,774 votes for Trump - 17,226 votes for Biden - - - Sumner, Tennessee + 17,226 votes for Biden + Sumner, Tennessee 63,404 votes for Trump - 27,630 votes for Biden - - - Tipton, Tennessee + 27,630 votes for Biden + Tipton, Tennessee 20,063 votes for Trump - 6,832 votes for Biden - - - Trousdale, Tennessee + 6,832 votes for Biden + Trousdale, Tennessee 2,930 votes for Trump - 1,011 votes for Biden - - - Unicoi, Tennessee + 1,011 votes for Biden + Unicoi, Tennessee 6,593 votes for Trump - 1,610 votes for Biden - - - Union, Tennessee + 1,610 votes for Biden + Union, Tennessee 6,777 votes for Trump - 1,248 votes for Biden - - - Van Buren, Tennessee + 1,248 votes for Biden + Van Buren, Tennessee 2,338 votes for Trump - 544 votes for Biden - - - Warren, Tennessee + 544 votes for Biden + Warren, Tennessee 12,323 votes for Trump - 4,126 votes for Biden - - - Washington, Tennessee + 4,126 votes for Biden + Washington, Tennessee 40,120 votes for Trump - 18,214 votes for Biden - - - Wayne, Tennessee + 18,214 votes for Biden + Wayne, Tennessee 5,795 votes for Trump - 820 votes for Biden - - - Weakley, Tennessee + 820 votes for Biden + Weakley, Tennessee 10,382 votes for Trump - 3,011 votes for Biden - - - White, Tennessee + 3,011 votes for Biden + White, Tennessee 9,587 votes for Trump - 2,134 votes for Biden - - - Williamson, Tennessee + 2,134 votes for Biden + Williamson, Tennessee 86,469 votes for Trump - 50,161 votes for Biden - - - Wilson, Tennessee + 50,161 votes for Biden + Wilson, Tennessee 50,149 votes for Trump - 22,197 votes for Biden - - - Albany, New York + 22,197 votes for Biden + Albany, New York 73,189 votes for Biden - 45,570 votes for Trump - - - Allegany, New York + 45,570 votes for Trump + Allegany, New York 12,670 votes for Trump - 4,188 votes for Biden - - - Bronx, New York + 4,188 votes for Biden + Bronx, New York 271,835 votes for Biden - 55,849 votes for Trump - - - Brooklyn, New York + 55,849 votes for Trump + Brooklyn, New York 514,133 votes for Biden - 174,731 votes for Trump - - - Broome, New York + 174,731 votes for Trump + Broome, New York 38,351 votes for Trump - 32,275 votes for Biden - - - Cattaraugus, New York + 32,275 votes for Biden + Cattaraugus, New York 20,295 votes for Trump - 9,142 votes for Biden - - - Cayuga, New York + 9,142 votes for Biden + Cayuga, New York 19,495 votes for Trump - 16,143 votes for Biden - - - Chautauqua, New York + 16,143 votes for Biden + Chautauqua, New York 34,846 votes for Trump - 23,075 votes for Biden - - - Chemung, New York + 23,075 votes for Biden + Chemung, New York 19,388 votes for Trump - 11,573 votes for Biden - - - Chenango, New York + 11,573 votes for Biden + Chenango, New York 11,736 votes for Trump - 5,126 votes for Biden - - - Clinton, New York + 5,126 votes for Biden + Clinton, New York 14,354 votes for Trump - 12,690 votes for Biden - - - Columbia, New York + 12,690 votes for Biden + Columbia, New York 19,764 votes for Biden - 14,235 votes for Trump - - - Cortland, New York + 14,235 votes for Trump + Cortland, New York 10,788 votes for Trump - 10,367 votes for Biden - - - Delaware, New York + 10,367 votes for Biden + Delaware, New York 11,952 votes for Trump - 6,420 votes for Biden - - - Dutchess, New York + 6,420 votes for Biden + Dutchess, New York 59,661 votes for Trump - 57,720 votes for Biden - - - Erie, New York + 57,720 votes for Biden + Erie, New York 198,808 votes for Biden - 178,349 votes for Trump - - - Essex, New York + 178,349 votes for Trump + Essex, New York 7,953 votes for Trump - 6,970 votes for Biden - - - Franklin, New York + 6,970 votes for Biden + Franklin, New York 8,530 votes for Trump - 6,586 votes for Biden - - - Fulton, New York + 6,586 votes for Biden + Fulton, New York 13,989 votes for Trump - 5,804 votes for Biden - - - Genesee, New York + 5,804 votes for Biden + Genesee, New York 17,340 votes for Trump - 7,048 votes for Biden - - - Greene, New York + 7,048 votes for Biden + Greene, New York 12,722 votes for Trump - 7,675 votes for Biden - - - Hamilton, New York + 7,675 votes for Biden + Hamilton, New York 2,225 votes for Trump - 1,178 votes for Biden - - - Herkimer, New York + 1,178 votes for Biden + Herkimer, New York 17,038 votes for Trump - 7,282 votes for Biden - - - Jefferson, New York + 7,282 votes for Biden + Jefferson, New York 22,779 votes for Trump - 12,053 votes for Biden - - - Lewis, New York + 12,053 votes for Biden + Lewis, New York 7,931 votes for Trump - 2,768 votes for Biden - - - Livingston, New York + 2,768 votes for Biden + Livingston, New York 18,139 votes for Trump - 12,401 votes for Biden - - - Madison, New York + 12,401 votes for Biden + Madison, New York 18,385 votes for Trump - 14,682 votes for Biden - - - Manhattan, New York + 14,682 votes for Biden + Manhattan, New York 377,605 votes for Biden - 65,001 votes for Trump - - - Monroe, New York + 65,001 votes for Trump + Monroe, New York 223,936 votes for Biden - 145,290 votes for Trump - - - Montgomery, New York + 145,290 votes for Trump + Montgomery, New York 11,500 votes for Trump - 5,746 votes for Biden - - - Nassau, New York + 5,746 votes for Biden + Nassau, New York 348,355 votes for Biden - 308,765 votes for Trump - - - Niagara, New York + 308,765 votes for Trump + Niagara, New York 51,355 votes for Trump - 34,809 votes for Biden - - - Oneida, New York + 34,809 votes for Biden + Oneida, New York 51,950 votes for Trump - 30,542 votes for Biden - - - Onondaga, New York + 30,542 votes for Biden + Onondaga, New York 113,970 votes for Biden - 84,117 votes for Trump - - - Ontario, New York + 84,117 votes for Trump + Ontario, New York 25,757 votes for Trump - 20,779 votes for Biden - - - Orange, New York + 20,779 votes for Biden + Orange, New York 76,218 votes for Trump - 61,868 votes for Biden - - - Orleans, New York + 61,868 votes for Biden + Orleans, New York 11,173 votes for Trump - 4,082 votes for Biden - - - Oswego, New York + 4,082 votes for Biden + Oswego, New York 28,930 votes for Trump - 14,698 votes for Biden - - - Otsego, New York + 14,698 votes for Biden + Otsego, New York 14,366 votes for Trump - 12,986 votes for Biden - - - Putnam, New York + 12,986 votes for Biden + Putnam, New York 26,888 votes for Trump - 20,266 votes for Biden - - - Queens, New York + 20,266 votes for Biden + Queens, New York 412,393 votes for Biden - 181,225 votes for Trump - - - Rensselaer, New York + 181,225 votes for Trump + Rensselaer, New York 40,969 votes for Biden - 36,500 votes for Trump - - - Rockland, New York + 36,500 votes for Trump + Rockland, New York 63,830 votes for Trump - 50,926 votes for Biden - - - Saint Lawrence, New York + 50,926 votes for Biden + Saint Lawrence, New York 21,862 votes for Trump - 13,036 votes for Biden - - - Saratoga, New York + 13,036 votes for Biden + Saratoga, New York 55,248 votes for Trump - 49,697 votes for Biden - - - Schenectady, New York + 49,697 votes for Biden + Schenectady, New York 31,685 votes for Biden - 27,544 votes for Trump - - - Schoharie, New York + 27,544 votes for Trump + Schoharie, New York 9,010 votes for Trump - 4,006 votes for Biden - - - Schuyler, New York + 4,006 votes for Biden + Schuyler, New York 5,620 votes for Trump - 3,902 votes for Biden - - - Seneca, New York + 3,902 votes for Biden + Seneca, New York 7,582 votes for Trump - 5,076 votes for Biden - - - Staten Island, New York + 5,076 votes for Biden + Staten Island, New York 110,094 votes for Trump - 67,223 votes for Biden - - - Steuben, New York + 67,223 votes for Biden + Steuben, New York 26,781 votes for Trump - 11,299 votes for Biden - - - Suffolk, New York + 11,299 votes for Biden + Suffolk, New York 333,617 votes for Trump - 259,463 votes for Biden - - - Sullivan, New York + 259,463 votes for Biden + Sullivan, New York 15,555 votes for Trump - 10,995 votes for Biden - - - Tioga, New York + 10,995 votes for Biden + Tioga, New York 14,616 votes for Trump - 9,498 votes for Biden - - - Tompkins, New York + 9,498 votes for Biden + Tompkins, New York 22,624 votes for Biden - 9,640 votes for Trump - - - Ulster, New York + 9,640 votes for Trump + Ulster, New York 42,606 votes for Biden - 33,580 votes for Trump - - - Warren, New York + 33,580 votes for Trump + Warren, New York 15,200 votes for Trump - 11,811 votes for Biden - - - Washington, New York + 11,811 votes for Biden + Washington, New York 14,577 votes for Trump - 8,537 votes for Biden - - - Wayne, New York + 8,537 votes for Biden + Wayne, New York 23,734 votes for Trump - 12,799 votes for Biden - - - Westchester, New York + 12,799 votes for Biden + Westchester, New York 220,963 votes for Biden - 126,013 votes for Trump - - - Wyoming, New York + 126,013 votes for Trump + Wyoming, New York 13,897 votes for Trump - 5,073 votes for Biden - - - Yates, New York + 5,073 votes for Biden + Yates, New York 6,208 votes for Trump - 4,217 votes for Biden - - - Arkansas, Arkansas + 4,217 votes for Biden + Arkansas, Arkansas 4,304 votes for Trump - 1,818 votes for Biden - - - Ashley, Arkansas + 1,818 votes for Biden + Ashley, Arkansas 5,548 votes for Trump - 2,125 votes for Biden - - - Baxter, Arkansas + 2,125 votes for Biden + Baxter, Arkansas 15,836 votes for Trump - 4,635 votes for Biden - - - Benton, Arkansas + 4,635 votes for Biden + Benton, Arkansas 73,965 votes for Trump - 42,249 votes for Biden - - - Boone, Arkansas + 42,249 votes for Biden + Boone, Arkansas 13,652 votes for Trump - 3,064 votes for Biden - - - Bradley, Arkansas + 3,064 votes for Biden + Bradley, Arkansas 2,335 votes for Trump - 1,214 votes for Biden - - - Calhoun, Arkansas + 1,214 votes for Biden + Calhoun, Arkansas 1,636 votes for Trump - 479 votes for Biden - - - Carroll, Arkansas + 479 votes for Biden + Carroll, Arkansas 7,424 votes for Trump - 4,023 votes for Biden - - - Chicot, Arkansas + 4,023 votes for Biden + Chicot, Arkansas 2,260 votes for Biden - 1,752 votes for Trump - - - Clark, Arkansas + 1,752 votes for Trump + Clark, Arkansas 4,616 votes for Trump - 3,438 votes for Biden - - - Clay, Arkansas + 3,438 votes for Biden + Clay, Arkansas 4,086 votes for Trump - 962 votes for Biden - - - Cleburne, Arkansas + 962 votes for Biden + Cleburne, Arkansas 10,328 votes for Trump - 1,988 votes for Biden - - - Cleveland, Arkansas + 1,988 votes for Biden + Cleveland, Arkansas 2,867 votes for Trump - 651 votes for Biden - - - Columbia, Arkansas + 651 votes for Biden + Columbia, Arkansas 5,500 votes for Trump - 2,814 votes for Biden - - - Conway, Arkansas + 2,814 votes for Biden + Conway, Arkansas 5,694 votes for Trump - 2,615 votes for Biden - - - Craighead, Arkansas + 2,615 votes for Biden + Craighead, Arkansas 25,558 votes for Trump - 11,921 votes for Biden - - - Crawford, Arkansas + 11,921 votes for Biden + Crawford, Arkansas 18,607 votes for Trump - 4,959 votes for Biden - - - Crittenden, Arkansas + 4,959 votes for Biden + Crittenden, Arkansas 8,325 votes for Biden - 7,244 votes for Trump - - - Cross, Arkansas + 7,244 votes for Trump + Cross, Arkansas 4,946 votes for Trump - 1,772 votes for Biden - - - Dallas, Arkansas + 1,772 votes for Biden + Dallas, Arkansas 1,573 votes for Trump - 963 votes for Biden - - - Desha, Arkansas + 963 votes for Biden + Desha, Arkansas 2,016 votes for Biden - 1,921 votes for Trump - - - Drew, Arkansas + 1,921 votes for Trump + Drew, Arkansas 4,349 votes for Trump - 2,426 votes for Biden - - - Faulkner, Arkansas + 2,426 votes for Biden + Faulkner, Arkansas 34,421 votes for Trump - 18,347 votes for Biden - - - Franklin, Arkansas + 18,347 votes for Biden + Franklin, Arkansas 5,677 votes for Trump - 1,300 votes for Biden - - - Fulton, Arkansas + 1,300 votes for Biden + Fulton, Arkansas 3,961 votes for Trump - 1,035 votes for Biden - - - Garland, Arkansas + 1,035 votes for Biden + Garland, Arkansas 29,069 votes for Trump - 14,045 votes for Biden - - - Grant, Arkansas + 14,045 votes for Biden + Grant, Arkansas 6,794 votes for Trump - 1,268 votes for Biden - - - Greene, Arkansas + 1,268 votes for Biden + Greene, Arkansas 12,651 votes for Trump - 3,045 votes for Biden - - - Hempstead, Arkansas + 3,045 votes for Biden + Hempstead, Arkansas 4,470 votes for Trump - 2,138 votes for Biden - - - Hot Spring, Arkansas + 2,138 votes for Biden + Hot Spring, Arkansas 9,202 votes for Trump - 3,082 votes for Biden - - - Howard, Arkansas + 3,082 votes for Biden + Howard, Arkansas 3,367 votes for Trump - 1,340 votes for Biden - - - Independence, Arkansas + 1,340 votes for Biden + Independence, Arkansas 11,250 votes for Trump - 2,806 votes for Biden - - - Izard, Arkansas + 2,806 votes for Biden + Izard, Arkansas 4,631 votes for Trump - 1,021 votes for Biden - - - Jackson, Arkansas + 1,021 votes for Biden + Jackson, Arkansas 3,593 votes for Trump - 1,365 votes for Biden - - - Jefferson, Arkansas + 1,365 votes for Biden + Jefferson, Arkansas 14,882 votes for Biden - 9,500 votes for Trump - - - Johnson, Arkansas + 9,500 votes for Trump + Johnson, Arkansas 6,938 votes for Trump - 2,283 votes for Biden - - - Lafayette, Arkansas + 2,283 votes for Biden + Lafayette, Arkansas 1,757 votes for Trump - 839 votes for Biden - - - Lawrence, Arkansas + 839 votes for Biden + Lawrence, Arkansas 4,569 votes for Trump - 1,080 votes for Biden - - - Lee, Arkansas + 1,080 votes for Biden + Lee, Arkansas 1,423 votes for Biden - 1,286 votes for Trump - - - Lincoln, Arkansas + 1,286 votes for Trump + Lincoln, Arkansas 2,729 votes for Trump - 1,032 votes for Biden - - - Little River, Arkansas + 1,032 votes for Biden + Little River, Arkansas 3,714 votes for Trump - 1,226 votes for Biden - - - Logan, Arkansas + 1,226 votes for Biden + Logan, Arkansas 6,441 votes for Trump - 1,544 votes for Biden - - - Lonoke, Arkansas + 1,544 votes for Biden + Lonoke, Arkansas 22,884 votes for Trump - 6,684 votes for Biden - - - Madison, Arkansas + 6,684 votes for Biden + Madison, Arkansas 5,658 votes for Trump - 1,563 votes for Biden - - - Marion, Arkansas + 1,563 votes for Biden + Marion, Arkansas 5,783 votes for Trump - 1,531 votes for Biden - - - Miller, Arkansas + 1,531 votes for Biden + Miller, Arkansas 11,920 votes for Trump - 4,245 votes for Biden - - - Mississippi, Arkansas + 4,245 votes for Biden + Mississippi, Arkansas 7,262 votes for Trump - 4,542 votes for Biden - - - Monroe, Arkansas + 4,542 votes for Biden + Monroe, Arkansas 1,545 votes for Trump - 1,146 votes for Biden - - - Montgomery, Arkansas + 1,146 votes for Biden + Montgomery, Arkansas 3,046 votes for Trump - 731 votes for Biden - - - Nevada, Arkansas + 731 votes for Biden + Nevada, Arkansas 1,275 votes for Trump - 775 votes for Biden - - - Newton, Arkansas + 775 votes for Biden + Newton, Arkansas 3,192 votes for Trump - 709 votes for Biden - - - Ouachita, Arkansas + 709 votes for Biden + Ouachita, Arkansas 5,294 votes for Trump - 3,995 votes for Biden - - - Perry, Arkansas + 3,995 votes for Biden + Perry, Arkansas 3,479 votes for Trump - 1,012 votes for Biden - - - Phillips, Arkansas + 1,012 votes for Biden + Phillips, Arkansas 3,623 votes for Biden - 2,417 votes for Trump - - - Pike, Arkansas + 2,417 votes for Trump + Pike, Arkansas 3,519 votes for Trump - 644 votes for Biden - - - Poinsett, Arkansas + 644 votes for Biden + Poinsett, Arkansas 5,918 votes for Trump - 1,424 votes for Biden - - - Polk, Arkansas + 1,424 votes for Biden + Polk, Arkansas 7,035 votes for Trump - 1,246 votes for Biden - - - Pope, Arkansas + 1,246 votes for Biden + Pope, Arkansas 18,081 votes for Trump - 5,772 votes for Biden - - - Prairie, Arkansas + 5,772 votes for Biden + Prairie, Arkansas 2,786 votes for Trump - 654 votes for Biden - - - Pulaski, Arkansas + 654 votes for Biden + Pulaski, Arkansas 101,947 votes for Biden - 63,687 votes for Trump - - - Randolph, Arkansas + 63,687 votes for Trump + Randolph, Arkansas 5,355 votes for Trump - 1,215 votes for Biden - - - Saint Francis, Arkansas + 1,215 votes for Biden + Saint Francis, Arkansas 3,604 votes for Biden - 3,242 votes for Trump - - - Saline, Arkansas + 3,242 votes for Trump + Saline, Arkansas 39,556 votes for Trump - 16,060 votes for Biden - - - Scott, Arkansas + 16,060 votes for Biden + Scott, Arkansas 2,962 votes for Trump - 483 votes for Biden - - - Searcy, Arkansas + 483 votes for Biden + Searcy, Arkansas 3,365 votes for Trump - 588 votes for Biden - - - Sebastian, Arkansas + 588 votes for Biden + Sebastian, Arkansas 31,198 votes for Trump - 14,487 votes for Biden - - - Sevier, Arkansas + 14,487 votes for Biden + Sevier, Arkansas 3,884 votes for Trump - 1,116 votes for Biden - - - Sharp, Arkansas + 1,116 votes for Biden + Sharp, Arkansas 5,938 votes for Trump - 1,398 votes for Biden - - - Stone, Arkansas + 1,398 votes for Biden + Stone, Arkansas 4,616 votes for Trump - 1,180 votes for Biden - - - Union, Arkansas + 1,180 votes for Biden + Union, Arkansas 10,478 votes for Trump - 5,584 votes for Biden - - - Van Buren, Arkansas + 5,584 votes for Biden + Van Buren, Arkansas 6,034 votes for Trump - 1,593 votes for Biden - - - Washington, Arkansas + 1,593 votes for Biden + Washington, Arkansas 47,504 votes for Trump - 43,824 votes for Biden - - - White, Arkansas + 43,824 votes for Biden + White, Arkansas 24,182 votes for Trump - 5,978 votes for Biden - - - Woodruff, Arkansas + 5,978 votes for Biden + Woodruff, Arkansas 1,543 votes for Trump - 856 votes for Biden - - - Yell, Arkansas + 856 votes for Biden + Yell, Arkansas 5,226 votes for Trump - 1,284 votes for Biden - - - Adair, Oklahoma + 1,284 votes for Biden + Adair, Oklahoma 5,585 votes for Trump - 1,387 votes for Biden - - - Alfalfa, Oklahoma + 1,387 votes for Biden + Alfalfa, Oklahoma 1,978 votes for Trump - 232 votes for Biden - - - Atoka, Oklahoma + 232 votes for Biden + Atoka, Oklahoma 4,557 votes for Trump - 765 votes for Biden - - - Beaver, Oklahoma + 765 votes for Biden + Beaver, Oklahoma 1,968 votes for Trump - 190 votes for Biden - - - Beckham, Oklahoma + 190 votes for Biden + Beckham, Oklahoma 6,767 votes for Trump - 1,048 votes for Biden - - - Blaine, Oklahoma + 1,048 votes for Biden + Blaine, Oklahoma 3,136 votes for Trump - 688 votes for Biden - - - Bryan, Oklahoma + 688 votes for Biden + Bryan, Oklahoma 12,344 votes for Trump - 3,323 votes for Biden - - - Caddo, Oklahoma + 3,323 votes for Biden + Caddo, Oklahoma 7,013 votes for Trump - 2,670 votes for Biden - - - Canadian, Oklahoma + 2,670 votes for Biden + Canadian, Oklahoma 43,550 votes for Trump - 16,742 votes for Biden - - - Carter, Oklahoma + 16,742 votes for Biden + Carter, Oklahoma 14,699 votes for Trump - 4,470 votes for Biden - - - Cherokee, Oklahoma + 4,470 votes for Biden + Cherokee, Oklahoma 11,223 votes for Trump - 6,027 votes for Biden - - - Choctaw, Oklahoma + 6,027 votes for Biden + Choctaw, Oklahoma 4,698 votes for Trump - 1,082 votes for Biden - - - Cimarron, Oklahoma + 1,082 votes for Biden + Cimarron, Oklahoma 970 votes for Trump - 70 votes for Biden - - - Cleveland, Oklahoma + 70 votes for Biden + Cleveland, Oklahoma 66,677 votes for Trump - 49,827 votes for Biden - - - Coal, Oklahoma + 49,827 votes for Biden + Coal, Oklahoma 2,091 votes for Trump - 374 votes for Biden - - - Comanche, Oklahoma + 374 votes for Biden + Comanche, Oklahoma 20,905 votes for Trump - 13,747 votes for Biden - - - Cotton, Oklahoma + 13,747 votes for Biden + Cotton, Oklahoma 2,117 votes for Trump - 393 votes for Biden - - - Craig, Oklahoma + 393 votes for Biden + Craig, Oklahoma 4,686 votes for Trump - 1,217 votes for Biden - - - Creek, Oklahoma + 1,217 votes for Biden + Creek, Oklahoma 23,294 votes for Trump - 6,577 votes for Biden - - - Custer, Oklahoma + 6,577 votes for Biden + Custer, Oklahoma 8,060 votes for Trump - 2,369 votes for Biden - - - Delaware, Oklahoma + 2,369 votes for Biden + Delaware, Oklahoma 13,557 votes for Trump - 3,472 votes for Biden - - - Dewey, Oklahoma + 3,472 votes for Biden + Dewey, Oklahoma 2,124 votes for Trump - 214 votes for Biden - - - Ellis, Oklahoma + 214 votes for Biden + Ellis, Oklahoma 1,688 votes for Trump - 162 votes for Biden - - - Garfield, Oklahoma + 162 votes for Biden + Garfield, Oklahoma 16,970 votes for Trump - 4,919 votes for Biden - - - Garvin, Oklahoma + 4,919 votes for Biden + Garvin, Oklahoma 8,878 votes for Trump - 1,865 votes for Biden - - - Grady, Oklahoma + 1,865 votes for Biden + Grady, Oklahoma 18,538 votes for Trump - 4,144 votes for Biden - - - Grant, Oklahoma + 4,144 votes for Biden + Grant, Oklahoma 1,916 votes for Trump - 280 votes for Biden - - - Greer, Oklahoma + 280 votes for Biden + Greer, Oklahoma 1,605 votes for Trump - 328 votes for Biden - - - Harmon, Oklahoma + 328 votes for Biden + Harmon, Oklahoma 747 votes for Trump - 177 votes for Biden - - - Harper, Oklahoma + 177 votes for Biden + Harper, Oklahoma 1,327 votes for Trump - 136 votes for Biden - - - Haskell, Oklahoma + 136 votes for Biden + Haskell, Oklahoma 4,165 votes for Trump - 783 votes for Biden - - - Hughes, Oklahoma + 783 votes for Biden + Hughes, Oklahoma 3,875 votes for Trump - 919 votes for Biden - - - Jackson, Oklahoma + 919 votes for Biden + Jackson, Oklahoma 6,392 votes for Trump - 1,646 votes for Biden - - - Jefferson, Oklahoma + 1,646 votes for Biden + Jefferson, Oklahoma 2,026 votes for Trump - 319 votes for Biden - - - Johnston, Oklahoma + 319 votes for Biden + Johnston, Oklahoma 3,441 votes for Trump - 738 votes for Biden - - - Kay, Oklahoma + 738 votes for Biden + Kay, Oklahoma 12,834 votes for Trump - 4,040 votes for Biden - - - Kingfisher, Oklahoma + 4,040 votes for Biden + Kingfisher, Oklahoma 5,521 votes for Trump - 854 votes for Biden - - - Kiowa, Oklahoma + 854 votes for Biden + Kiowa, Oklahoma 2,673 votes for Trump - 699 votes for Biden - - - Latimer, Oklahoma + 699 votes for Biden + Latimer, Oklahoma 3,437 votes for Trump - 762 votes for Biden - - - LeFlore, Oklahoma + 762 votes for Biden + LeFlore, Oklahoma 15,213 votes for Trump - 3,299 votes for Biden - - - Lincoln, Oklahoma + 3,299 votes for Biden + Lincoln, Oklahoma 12,013 votes for Trump - 2,609 votes for Biden - - - Logan, Oklahoma + 2,609 votes for Biden + Logan, Oklahoma 15,608 votes for Trump - 5,455 votes for Biden - - - Love, Oklahoma + 5,455 votes for Biden + Love, Oklahoma 3,305 votes for Trump - 711 votes for Biden - - - Major, Oklahoma + 711 votes for Biden + Major, Oklahoma 3,084 votes for Trump - 320 votes for Biden - - - Marshall, Oklahoma + 320 votes for Biden + Marshall, Oklahoma 4,891 votes for Trump - 1,100 votes for Biden - - - Mayes, Oklahoma + 1,100 votes for Biden + Mayes, Oklahoma 12,749 votes for Trump - 3,581 votes for Biden - - - McClain, Oklahoma + 3,581 votes for Biden + McClain, Oklahoma 15,295 votes for Trump - 3,582 votes for Biden - - - McCurtain, Oklahoma + 3,582 votes for Biden + McCurtain, Oklahoma 9,485 votes for Trump - 1,858 votes for Biden - - - McIntosh, Oklahoma + 1,858 votes for Biden + McIntosh, Oklahoma 6,172 votes for Trump - 2,031 votes for Biden - - - Murray, Oklahoma + 2,031 votes for Biden + Murray, Oklahoma 4,612 votes for Trump - 1,156 votes for Biden - - - Muskogee, Oklahoma + 1,156 votes for Biden + Muskogee, Oklahoma 16,526 votes for Trump - 8,027 votes for Biden - - - Noble, Oklahoma + 8,027 votes for Biden + Noble, Oklahoma 3,821 votes for Trump - 1,003 votes for Biden - - - Nowata, Oklahoma + 1,003 votes for Biden + Nowata, Oklahoma 3,610 votes for Trump - 712 votes for Biden - - - Okfuskee, Oklahoma + 712 votes for Biden + Okfuskee, Oklahoma 3,058 votes for Trump - 896 votes for Biden - - - Oklahoma, Oklahoma + 896 votes for Biden + Oklahoma, Oklahoma 145,050 votes for Trump - 141,724 votes for Biden - - - Okmulgee, Oklahoma + 141,724 votes for Biden + Okmulgee, Oklahoma 9,668 votes for Trump - 4,357 votes for Biden - - - Osage, Oklahoma + 4,357 votes for Biden + Osage, Oklahoma 14,121 votes for Trump - 6,002 votes for Biden - - - Ottawa, Oklahoma + 6,002 votes for Biden + Ottawa, Oklahoma 8,545 votes for Trump - 2,686 votes for Biden - - - Pawnee, Oklahoma + 2,686 votes for Biden + Pawnee, Oklahoma 5,267 votes for Trump - 1,363 votes for Biden - - - Payne, Oklahoma + 1,363 votes for Biden + Payne, Oklahoma 17,813 votes for Trump - 10,904 votes for Biden - - - Pittsburg, Oklahoma + 10,904 votes for Biden + Pittsburg, Oklahoma 13,851 votes for Trump - 3,768 votes for Biden - - - Pontotoc, Oklahoma + 3,768 votes for Biden + Pontotoc, Oklahoma 10,805 votes for Trump - 4,117 votes for Biden - - - Pottawatomie, Oklahoma + 4,117 votes for Biden + Pottawatomie, Oklahoma 20,240 votes for Trump - 7,275 votes for Biden - - - Pushmataha, Oklahoma + 7,275 votes for Biden + Pushmataha, Oklahoma 4,016 votes for Trump - 668 votes for Biden - - - Roger Mills, Oklahoma + 668 votes for Biden + Roger Mills, Oklahoma 1,629 votes for Trump - 168 votes for Biden - - - Rogers, Oklahoma + 168 votes for Biden + Rogers, Oklahoma 34,031 votes for Trump - 9,589 votes for Biden - - - Seminole, Oklahoma + 9,589 votes for Biden + Seminole, Oklahoma 6,011 votes for Trump - 2,150 votes for Biden - - - Sequoyah, Oklahoma + 2,150 votes for Biden + Sequoyah, Oklahoma 12,113 votes for Trump - 3,035 votes for Biden - - - Stephens, Oklahoma + 3,035 votes for Biden + Stephens, Oklahoma 15,560 votes for Trump - 3,154 votes for Biden - - - Texas, Oklahoma + 3,154 votes for Biden + Texas, Oklahoma 4,505 votes for Trump - 894 votes for Biden - - - Tillman, Oklahoma + 894 votes for Biden + Tillman, Oklahoma 2,076 votes for Trump - 597 votes for Biden - - - Tulsa, Oklahoma + 597 votes for Biden + Tulsa, Oklahoma 150,574 votes for Trump - 108,996 votes for Biden - - - Wagoner, Oklahoma + 108,996 votes for Biden + Wagoner, Oklahoma 26,165 votes for Trump - 8,464 votes for Biden - - - Washington, Oklahoma + 8,464 votes for Biden + Washington, Oklahoma 17,076 votes for Trump - 5,790 votes for Biden - - - Washita, Oklahoma + 5,790 votes for Biden + Washita, Oklahoma 4,086 votes for Trump - 598 votes for Biden - - - Woods, Oklahoma + 598 votes for Biden + Woods, Oklahoma 2,993 votes for Trump - 591 votes for Biden - - - Woodward, Oklahoma + 591 votes for Biden + Woodward, Oklahoma 6,611 votes for Trump - 1,005 votes for Biden - - - Adams, Nebraska + 1,005 votes for Biden + Adams, Nebraska 10,085 votes for Trump - 4,213 votes for Biden - - - Antelope, Nebraska + 4,213 votes for Biden + Antelope, Nebraska 3,093 votes for Trump - 452 votes for Biden - - - Arthur, Nebraska + 452 votes for Biden + Arthur, Nebraska 260 votes for Trump - 21 votes for Biden - - - Banner, Nebraska + 21 votes for Biden + Banner, Nebraska 362 votes for Trump - 43 votes for Biden - - - Blaine, Nebraska + 43 votes for Biden + Blaine, Nebraska 280 votes for Trump - 35 votes for Biden - - - Boone, Nebraska + 35 votes for Biden + Boone, Nebraska 2,653 votes for Trump - 499 votes for Biden - - - Box Butte, Nebraska + 499 votes for Biden + Box Butte, Nebraska 4,002 votes for Trump - 1,051 votes for Biden - - - Boyd, Nebraska + 1,051 votes for Biden + Boyd, Nebraska 1,010 votes for Trump - 135 votes for Biden - - - Brown, Nebraska + 135 votes for Biden + Brown, Nebraska 1,470 votes for Trump - 191 votes for Biden - - - Buffalo, Nebraska + 191 votes for Biden + Buffalo, Nebraska 16,640 votes for Trump - 6,350 votes for Biden - - - Burt, Nebraska + 6,350 votes for Biden + Burt, Nebraska 2,580 votes for Trump - 1,063 votes for Biden - - - Butler, Nebraska + 1,063 votes for Biden + Butler, Nebraska 3,526 votes for Trump - 869 votes for Biden - - - Cass, Nebraska + 869 votes for Biden + Cass, Nebraska 10,121 votes for Trump - 4,737 votes for Biden - - - Cedar, Nebraska + 4,737 votes for Biden + Cedar, Nebraska 4,174 votes for Trump - 725 votes for Biden - - - Chase, Nebraska + 725 votes for Biden + Chase, Nebraska 1,740 votes for Trump - 226 votes for Biden - - - Cherry, Nebraska + 226 votes for Biden + Cherry, Nebraska 2,844 votes for Trump - 373 votes for Biden - - - Cheyenne, Nebraska + 373 votes for Biden + Cheyenne, Nebraska 3,813 votes for Trump - 855 votes for Biden - - - Clay, Nebraska + 855 votes for Biden + Clay, Nebraska 2,848 votes for Trump - 632 votes for Biden - - - Colfax, Nebraska + 632 votes for Biden + Colfax, Nebraska 2,636 votes for Trump - 1,025 votes for Biden - - - Cuming, Nebraska + 1,025 votes for Biden + Cuming, Nebraska 3,507 votes for Trump - 870 votes for Biden - - - Custer, Nebraska + 870 votes for Biden + Custer, Nebraska 4,996 votes for Trump - 768 votes for Biden - - - Dakota, Nebraska + 768 votes for Biden + Dakota, Nebraska 3,926 votes for Trump - 2,744 votes for Biden - - - Dawes, Nebraska + 2,744 votes for Biden + Dawes, Nebraska 2,931 votes for Trump - 1,082 votes for Biden - - - Dawson, Nebraska + 1,082 votes for Biden + Dawson, Nebraska 6,524 votes for Trump - 2,497 votes for Biden - - - Deuel, Nebraska + 2,497 votes for Biden + Deuel, Nebraska 871 votes for Trump - 141 votes for Biden - - - Dixon, Nebraska + 141 votes for Biden + Dixon, Nebraska 2,335 votes for Trump - 651 votes for Biden - - - Dodge, Nebraska + 651 votes for Biden + Dodge, Nebraska 10,963 votes for Trump - 5,526 votes for Biden - - - Douglas, Nebraska + 5,526 votes for Biden + Douglas, Nebraska 150,309 votes for Biden - 119,117 votes for Trump - - - Dundy, Nebraska + 119,117 votes for Trump + Dundy, Nebraska 883 votes for Trump - 105 votes for Biden - - - Fillmore, Nebraska + 105 votes for Biden + Fillmore, Nebraska 2,359 votes for Trump - 693 votes for Biden - - - Franklin, Nebraska + 693 votes for Biden + Franklin, Nebraska 1,434 votes for Trump - 276 votes for Biden - - - Frontier, Nebraska + 276 votes for Biden + Frontier, Nebraska 1,229 votes for Trump - 189 votes for Biden - - - Furnas, Nebraska + 189 votes for Biden + Furnas, Nebraska 2,163 votes for Trump - 399 votes for Biden - - - Gage, Nebraska + 399 votes for Biden + Gage, Nebraska 7,445 votes for Trump - 3,385 votes for Biden - - - Garden, Nebraska + 3,385 votes for Biden + Garden, Nebraska 1,016 votes for Trump - 161 votes for Biden - - - Garfield, Nebraska + 161 votes for Biden + Garfield, Nebraska 925 votes for Trump - 133 votes for Biden - - - Gosper, Nebraska + 133 votes for Biden + Gosper, Nebraska 893 votes for Trump - 215 votes for Biden - - - Grant, Nebraska + 215 votes for Biden + Grant, Nebraska 375 votes for Trump - 20 votes for Biden - - - Greeley, Nebraska + 20 votes for Biden + Greeley, Nebraska 1,016 votes for Trump - 229 votes for Biden - - - Hall, Nebraska + 229 votes for Biden + Hall, Nebraska 16,189 votes for Trump - 7,681 votes for Biden - - - Hamilton, Nebraska + 7,681 votes for Biden + Hamilton, Nebraska 4,297 votes for Trump - 1,117 votes for Biden - - - Harlan, Nebraska + 1,117 votes for Biden + Harlan, Nebraska 1,615 votes for Trump - 282 votes for Biden - - - Hayes, Nebraska + 282 votes for Biden + Hayes, Nebraska 494 votes for Trump - 34 votes for Biden - - - Hitchcock, Nebraska + 34 votes for Biden + Hitchcock, Nebraska 1,264 votes for Trump - 175 votes for Biden - - - Holt, Nebraska + 175 votes for Biden + Holt, Nebraska 4,769 votes for Trump - 686 votes for Biden - - - Hooker, Nebraska + 686 votes for Biden + Hooker, Nebraska 376 votes for Trump - 59 votes for Biden - - - Howard, Nebraska + 59 votes for Biden + Howard, Nebraska 2,786 votes for Trump - 648 votes for Biden - - - Jefferson, Nebraska + 648 votes for Biden + Jefferson, Nebraska 2,616 votes for Trump - 1,016 votes for Biden - - - Johnson, Nebraska + 1,016 votes for Biden + Johnson, Nebraska 1,518 votes for Trump - 647 votes for Biden - - - Kearney, Nebraska + 647 votes for Biden + Kearney, Nebraska 2,822 votes for Trump - 701 votes for Biden - - - Keith, Nebraska + 701 votes for Biden + Keith, Nebraska 3,544 votes for Trump - 763 votes for Biden - - - Keya Paha, Nebraska + 763 votes for Biden + Keya Paha, Nebraska 476 votes for Trump - 49 votes for Biden - - - Kimball, Nebraska + 49 votes for Biden + Kimball, Nebraska 1,553 votes for Trump - 267 votes for Biden - - - Knox, Nebraska + 267 votes for Biden + Knox, Nebraska 3,721 votes for Trump - 905 votes for Biden - - - Lancaster, Nebraska + 905 votes for Biden + Lancaster, Nebraska 82,293 votes for Biden - 70,092 votes for Trump - - - Lincoln, Nebraska + 70,092 votes for Trump + Lincoln, Nebraska 13,071 votes for Trump - 3,692 votes for Biden - - - Logan, Nebraska + 3,692 votes for Biden + Logan, Nebraska 407 votes for Trump - 38 votes for Biden - - - Loup, Nebraska + 38 votes for Biden + Loup, Nebraska 370 votes for Trump - 75 votes for Biden - - - Madison, Nebraska + 75 votes for Biden + Madison, Nebraska 11,678 votes for Trump - 3,393 votes for Biden - - - McPherson, Nebraska + 3,393 votes for Biden + McPherson, Nebraska 275 votes for Trump - 17 votes for Biden - - - Merrick, Nebraska + 17 votes for Biden + Merrick, Nebraska 3,407 votes for Trump - 740 votes for Biden - - - Morrill, Nebraska + 740 votes for Biden + Morrill, Nebraska 2,113 votes for Trump - 386 votes for Biden - - - Nance, Nebraska + 386 votes for Biden + Nance, Nebraska 1,437 votes for Trump - 359 votes for Biden - - - Nemaha, Nebraska + 359 votes for Biden + Nemaha, Nebraska 2,428 votes for Trump - 921 votes for Biden - - - Nuckolls, Nebraska + 921 votes for Biden + Nuckolls, Nebraska 1,857 votes for Trump - 409 votes for Biden - - - Otoe, Nebraska + 409 votes for Biden + Otoe, Nebraska 5,649 votes for Trump - 2,490 votes for Biden - - - Pawnee, Nebraska + 2,490 votes for Biden + Pawnee, Nebraska 1,071 votes for Trump - 322 votes for Biden - - - Perkins, Nebraska + 322 votes for Biden + Perkins, Nebraska 1,321 votes for Trump - 199 votes for Biden - - - Phelps, Nebraska + 199 votes for Biden + Phelps, Nebraska 4,157 votes for Trump - 752 votes for Biden - - - Pierce, Nebraska + 752 votes for Biden + Pierce, Nebraska 3,462 votes for Trump - 480 votes for Biden - - - Platte, Nebraska + 480 votes for Biden + Platte, Nebraska 11,836 votes for Trump - 3,208 votes for Biden - - - Polk, Nebraska + 3,208 votes for Biden + Polk, Nebraska 2,286 votes for Trump - 527 votes for Biden - - - Red Willow, Nebraska + 527 votes for Biden + Red Willow, Nebraska 4,525 votes for Trump - 811 votes for Biden - - - Richardson, Nebraska + 811 votes for Biden + Richardson, Nebraska 3,073 votes for Trump - 996 votes for Biden - - - Rock, Nebraska + 996 votes for Biden + Rock, Nebraska 744 votes for Trump - 84 votes for Biden - - - Saline, Nebraska + 84 votes for Biden + Saline, Nebraska 3,631 votes for Trump - 1,986 votes for Biden - - - Sarpy, Nebraska + 1,986 votes for Biden + Sarpy, Nebraska 51,518 votes for Trump - 41,029 votes for Biden - - - Saunders, Nebraska + 41,029 votes for Biden + Saunders, Nebraska 9,108 votes for Trump - 3,331 votes for Biden - - - Scotts Bluff, Nebraska + 3,331 votes for Biden + Scotts Bluff, Nebraska 10,952 votes for Trump - 4,196 votes for Biden - - - Seward, Nebraska + 4,196 votes for Biden + Seward, Nebraska 6,490 votes for Trump - 2,438 votes for Biden - - - Sheridan, Nebraska + 2,438 votes for Biden + Sheridan, Nebraska 2,292 votes for Trump - 340 votes for Biden - - - Sherman, Nebraska + 340 votes for Biden + Sherman, Nebraska 1,322 votes for Trump - 343 votes for Biden - - - Sioux, Nebraska + 343 votes for Biden + Sioux, Nebraska 642 votes for Trump - 72 votes for Biden - - - Stanton, Nebraska + 72 votes for Biden + Stanton, Nebraska 2,561 votes for Trump - 532 votes for Biden - - - Thayer, Nebraska + 532 votes for Biden + Thayer, Nebraska 2,308 votes for Trump - 624 votes for Biden - - - Thomas, Nebraska + 624 votes for Biden + Thomas, Nebraska 377 votes for Trump - 45 votes for Biden - - - Thurston, Nebraska + 45 votes for Biden + Thurston, Nebraska 1,180 votes for Trump - 1,122 votes for Biden - - - Valley, Nebraska + 1,122 votes for Biden + Valley, Nebraska 1,901 votes for Trump - 412 votes for Biden - - - Washington, Nebraska + 412 votes for Biden + Washington, Nebraska 8,583 votes for Trump - 3,554 votes for Biden - - - Wayne, Nebraska + 3,554 votes for Biden + Wayne, Nebraska 3,055 votes for Trump - 1,022 votes for Biden - - - Webster, Nebraska + 1,022 votes for Biden + Webster, Nebraska 1,511 votes for Trump - 335 votes for Biden - - - Wheeler, Nebraska + 335 votes for Biden + Wheeler, Nebraska 438 votes for Trump - 59 votes for Biden - - - York, Nebraska + 59 votes for Biden + York, Nebraska 5,296 votes for Trump - 1,619 votes for Biden - - - Abbeville, South Carolina + 1,619 votes for Biden + Abbeville, South Carolina 8,215 votes for Trump - 4,101 votes for Biden - - - Aiken, South Carolina + 4,101 votes for Biden + Aiken, South Carolina 51,589 votes for Trump - 32,275 votes for Biden - - - Allendale, South Carolina + 32,275 votes for Biden + Allendale, South Carolina 2,718 votes for Biden - 835 votes for Trump - - - Anderson, South Carolina + 835 votes for Trump + Anderson, South Carolina 67,565 votes for Trump - 27,169 votes for Biden - - - Bamberg, South Carolina + 27,169 votes for Biden + Bamberg, South Carolina 4,010 votes for Biden - 2,417 votes for Trump - - - Barnwell, South Carolina + 2,417 votes for Trump + Barnwell, South Carolina 5,492 votes for Trump - 4,720 votes for Biden - - - Beaufort, South Carolina + 4,720 votes for Biden + Beaufort, South Carolina 53,194 votes for Trump - 43,419 votes for Biden - - - Berkeley, South Carolina + 43,419 votes for Biden + Berkeley, South Carolina 57,397 votes for Trump - 45,223 votes for Biden - - - Calhoun, South Carolina + 45,223 votes for Biden + Calhoun, South Carolina 4,305 votes for Trump - 3,905 votes for Biden - - - Charleston, South Carolina + 3,905 votes for Biden + Charleston, South Carolina 121,485 votes for Biden - 93,297 votes for Trump - - - Cherokee, South Carolina + 93,297 votes for Trump + Cherokee, South Carolina 18,043 votes for Trump - 6,983 votes for Biden - - - Chester, South Carolina + 6,983 votes for Biden + Chester, South Carolina 8,660 votes for Trump - 6,941 votes for Biden - - - Chesterfield, South Carolina + 6,941 votes for Biden + Chesterfield, South Carolina 11,297 votes for Trump - 7,431 votes for Biden - - - Clarendon, South Carolina + 7,431 votes for Biden + Clarendon, South Carolina 8,361 votes for Trump - 8,250 votes for Biden - - - Colleton, South Carolina + 8,250 votes for Biden + Colleton, South Carolina 10,440 votes for Trump - 8,602 votes for Biden - - - Darlington, South Carolina + 8,602 votes for Biden + Darlington, South Carolina 16,832 votes for Trump - 15,220 votes for Biden - - - Dillon, South Carolina + 15,220 votes for Biden + Dillon, South Carolina 6,582 votes for Trump - 6,436 votes for Biden - - - Dorchester, South Carolina + 6,436 votes for Biden + Dorchester, South Carolina 41,913 votes for Trump - 33,824 votes for Biden - - - Edgefield, South Carolina + 33,824 votes for Biden + Edgefield, South Carolina 8,184 votes for Trump - 4,953 votes for Biden - - - Fairfield, South Carolina + 4,953 votes for Biden + Fairfield, South Carolina 7,382 votes for Biden - 4,625 votes for Trump - - - Florence, South Carolina + 4,625 votes for Trump + Florence, South Carolina 32,615 votes for Trump - 31,153 votes for Biden - - - Georgetown, South Carolina + 31,153 votes for Biden + Georgetown, South Carolina 20,487 votes for Trump - 15,822 votes for Biden - - - Greenville, South Carolina + 15,822 votes for Biden + Greenville, South Carolina 150,021 votes for Trump - 103,030 votes for Biden - - - Greenwood, South Carolina + 103,030 votes for Biden + Greenwood, South Carolina 19,431 votes for Trump - 12,145 votes for Biden - - - Hampton, South Carolina + 12,145 votes for Biden + Hampton, South Carolina 5,323 votes for Biden - 3,906 votes for Trump - - - Horry, South Carolina + 3,906 votes for Trump + Horry, South Carolina 118,821 votes for Trump - 59,180 votes for Biden - - - Jasper, South Carolina + 59,180 votes for Biden + Jasper, South Carolina 7,185 votes for Biden - 7,078 votes for Trump - - - Kershaw, South Carolina + 7,078 votes for Trump + Kershaw, South Carolina 20,471 votes for Trump - 12,699 votes for Biden - - - Lancaster, South Carolina + 12,699 votes for Biden + Lancaster, South Carolina 30,312 votes for Trump - 18,937 votes for Biden - - - Laurens, South Carolina + 18,937 votes for Biden + Laurens, South Carolina 20,004 votes for Trump - 10,159 votes for Biden - - - Lee, South Carolina + 10,159 votes for Biden + Lee, South Carolina 5,329 votes for Biden - 3,008 votes for Trump - - - Lexington, South Carolina + 3,008 votes for Trump + Lexington, South Carolina 92,817 votes for Trump - 49,301 votes for Biden - - - Marion, South Carolina + 49,301 votes for Biden + Marion, South Carolina 8,872 votes for Biden - 5,711 votes for Trump - - - Marlboro, South Carolina + 5,711 votes for Trump + Marlboro, South Carolina 6,290 votes for Biden - 5,044 votes for Trump - - - McCormick, South Carolina + 5,044 votes for Trump + McCormick, South Carolina 2,958 votes for Trump - 2,687 votes for Biden - - - Newberry, South Carolina + 2,687 votes for Biden + Newberry, South Carolina 11,443 votes for Trump - 6,958 votes for Biden - - - Oconee, South Carolina + 6,958 votes for Biden + Oconee, South Carolina 29,698 votes for Trump - 10,414 votes for Biden - - - Orangeburg, South Carolina + 10,414 votes for Biden + Orangeburg, South Carolina 27,295 votes for Biden - 13,603 votes for Trump - - - Pickens, South Carolina + 13,603 votes for Trump + Pickens, South Carolina 42,907 votes for Trump - 13,645 votes for Biden - - - Richland, South Carolina + 13,645 votes for Biden + Richland, South Carolina 132,570 votes for Biden - 58,313 votes for Trump - - - Saluda, South Carolina + 58,313 votes for Trump + Saluda, South Carolina 6,210 votes for Trump - 2,963 votes for Biden - - - Spartanburg, South Carolina + 2,963 votes for Biden + Spartanburg, South Carolina 93,560 votes for Trump - 52,926 votes for Biden - - - Sumter, South Carolina + 52,926 votes for Biden + Sumter, South Carolina 27,379 votes for Biden - 21,000 votes for Trump - - - Union, South Carolina + 21,000 votes for Trump + Union, South Carolina 8,183 votes for Trump - 4,935 votes for Biden - - - Williamsburg, South Carolina + 4,935 votes for Biden + Williamsburg, South Carolina 10,289 votes for Biden - 5,532 votes for Trump - - - York, South Carolina + 5,532 votes for Trump + York, South Carolina 82,727 votes for Trump - 59,008 votes for Biden - - - Ada, Idaho + 59,008 votes for Biden + Ada, Idaho 130,699 votes for Trump - 120,539 votes for Biden - - - Adams, Idaho + 120,539 votes for Biden + Adams, Idaho 1,941 votes for Trump - 591 votes for Biden - - - Bannock, Idaho + 591 votes for Biden + Bannock, Idaho 23,331 votes for Trump - 14,682 votes for Biden - - - Bear Lake, Idaho + 14,682 votes for Biden + Bear Lake, Idaho 2,914 votes for Trump - 350 votes for Biden - - - Benewah, Idaho + 350 votes for Biden + Benewah, Idaho 3,878 votes for Trump - 977 votes for Biden - - - Bingham, Idaho + 977 votes for Biden + Bingham, Idaho 15,295 votes for Trump - 4,124 votes for Biden - - - Blaine, Idaho + 4,124 votes for Biden + Blaine, Idaho 8,919 votes for Biden - 4,031 votes for Trump - - - Boise, Idaho + 4,031 votes for Trump + Boise, Idaho 3,495 votes for Trump - 1,214 votes for Biden - - - Bonner, Idaho + 1,214 votes for Biden + Bonner, Idaho 18,369 votes for Trump - 8,310 votes for Biden - - - Bonneville, Idaho + 8,310 votes for Biden + Bonneville, Idaho 37,805 votes for Trump - 14,254 votes for Biden - - - Boundary, Idaho + 14,254 votes for Biden + Boundary, Idaho 4,937 votes for Trump - 1,220 votes for Biden - - - Butte, Idaho + 1,220 votes for Biden + Butte, Idaho 1,202 votes for Trump - 188 votes for Biden - - - Camas, Idaho + 188 votes for Biden + Camas, Idaho 507 votes for Trump - 149 votes for Biden - - - Canyon, Idaho + 149 votes for Biden + Canyon, Idaho 61,759 votes for Trump - 25,881 votes for Biden - - - Caribou, Idaho + 25,881 votes for Biden + Caribou, Idaho 2,906 votes for Trump - 431 votes for Biden - - - Cassia, Idaho + 431 votes for Biden + Cassia, Idaho 7,907 votes for Trump - 1,464 votes for Biden - - - Clark, Idaho + 1,464 votes for Biden + Clark, Idaho 264 votes for Trump - 41 votes for Biden - - - Clearwater, Idaho + 41 votes for Biden + Clearwater, Idaho 3,453 votes for Trump - 877 votes for Biden - - - Custer, Idaho + 877 votes for Biden + Custer, Idaho 2,089 votes for Trump - 603 votes for Biden - - - Elmore, Idaho + 603 votes for Biden + Elmore, Idaho 7,246 votes for Trump - 2,601 votes for Biden - - - Franklin, Idaho + 2,601 votes for Biden + Franklin, Idaho 5,845 votes for Trump - 657 votes for Biden - - - Fremont, Idaho + 657 votes for Biden + Fremont, Idaho 5,548 votes for Trump - 998 votes for Biden - - - Gem, Idaho + 998 votes for Biden + Gem, Idaho 7,951 votes for Trump - 1,803 votes for Biden - - - Gooding, Idaho + 1,803 votes for Biden + Gooding, Idaho 4,659 votes for Trump - 1,256 votes for Biden - - - Idaho County, Idaho + 1,256 votes for Biden + Idaho County, Idaho 7,826 votes for Trump - 1,561 votes for Biden - - - Jefferson, Idaho + 1,561 votes for Biden + Jefferson, Idaho 12,099 votes for Trump - 1,661 votes for Biden - - - Jerome, Idaho + 1,661 votes for Biden + Jerome, Idaho 5,734 votes for Trump - 1,893 votes for Biden - - - Kootenai, Idaho + 1,893 votes for Biden + Kootenai, Idaho 62,837 votes for Trump - 24,312 votes for Biden - - - Latah, Idaho + 24,312 votes for Biden + Latah, Idaho 10,236 votes for Biden - 9,472 votes for Trump - - - Lemhi, Idaho + 9,472 votes for Trump + Lemhi, Idaho 3,592 votes for Trump - 1,032 votes for Biden - - - Lewis, Idaho + 1,032 votes for Biden + Lewis, Idaho 1,489 votes for Trump - 349 votes for Biden - - - Lincoln, Idaho + 349 votes for Biden + Lincoln, Idaho 1,469 votes for Trump - 414 votes for Biden - - - Madison, Idaho + 414 votes for Biden + Madison, Idaho 13,559 votes for Trump - 2,666 votes for Biden - - - Minidoka, Idaho + 2,666 votes for Biden + Minidoka, Idaho 6,265 votes for Trump - 1,550 votes for Biden - - - Nez Perce, Idaho + 1,550 votes for Biden + Nez Perce, Idaho 13,738 votes for Trump - 6,686 votes for Biden - - - Oneida, Idaho + 6,686 votes for Biden + Oneida, Idaho 2,148 votes for Trump - 249 votes for Biden - - - Owyhee, Idaho + 249 votes for Biden + Owyhee, Idaho 3,819 votes for Trump - 816 votes for Biden - - - Payette, Idaho + 816 votes for Biden + Payette, Idaho 8,862 votes for Trump - 2,161 votes for Biden - - - Power, Idaho + 2,161 votes for Biden + Power, Idaho 2,116 votes for Trump - 865 votes for Biden - - - Shoshone, Idaho + 865 votes for Biden + Shoshone, Idaho 4,216 votes for Trump - 1,693 votes for Biden - - - Teton, Idaho + 1,693 votes for Biden + Teton, Idaho 3,318 votes for Biden - 2,858 votes for Trump - - - Twin Falls, Idaho + 2,858 votes for Trump + Twin Falls, Idaho 25,897 votes for Trump - 9,391 votes for Biden - - - Valley, Idaho + 9,391 votes for Biden + Valley, Idaho 3,947 votes for Trump - 2,976 votes for Biden - - - Washington, Idaho + 2,976 votes for Biden + Washington, Idaho 4,154 votes for Trump - 1,073 votes for Biden - - - Belknap, New Hampshire + 1,073 votes for Biden + Belknap, New Hampshire 20,899 votes for Trump - 16,894 votes for Biden - - - Carroll, New Hampshire + 16,894 votes for Biden + Carroll, New Hampshire 16,649 votes for Biden - 16,150 votes for Trump - - - Cheshire, New Hampshire + 16,150 votes for Trump + Cheshire, New Hampshire 25,522 votes for Biden - 17,898 votes for Trump - - - Coos, New Hampshire + 17,898 votes for Trump + Coos, New Hampshire 8,617 votes for Trump - 7,640 votes for Biden - - - Grafton, New Hampshire + 7,640 votes for Biden + Grafton, New Hampshire 33,180 votes for Biden - 19,905 votes for Trump - - - Hillsborough, New Hampshire + 19,905 votes for Trump + Hillsborough, New Hampshire 122,344 votes for Biden - 104,625 votes for Trump - - - Merrimack, New Hampshire + 104,625 votes for Trump + Merrimack, New Hampshire 48,533 votes for Biden - 39,711 votes for Trump - - - Rockingham, New Hampshire + 39,711 votes for Trump + Rockingham, New Hampshire 100,064 votes for Biden - 95,858 votes for Trump - - - Strafford, New Hampshire + 95,858 votes for Trump + Strafford, New Hampshire 41,721 votes for Biden - 30,489 votes for Trump - - - Sullivan, New Hampshire + 30,489 votes for Trump + Sullivan, New Hampshire 12,390 votes for Biden - 11,508 votes for Trump - - - Adams, Ohio + 11,508 votes for Trump + Adams, Ohio 9,870 votes for Trump - 2,156 votes for Biden - - - Allen, Ohio + 2,156 votes for Biden + Allen, Ohio 32,052 votes for Trump - 13,611 votes for Biden - - - Ashland, Ohio + 13,611 votes for Biden + Ashland, Ohio 19,002 votes for Trump - 6,448 votes for Biden - - - Ashtabula, Ohio + 6,448 votes for Biden + Ashtabula, Ohio 26,890 votes for Trump - 16,497 votes for Biden - - - Athens, Ohio + 16,497 votes for Biden + Athens, Ohio 14,772 votes for Biden - 10,862 votes for Trump - - - Auglaize, Ohio + 10,862 votes for Trump + Auglaize, Ohio 20,451 votes for Trump - 4,583 votes for Biden - - - Belmont, Ohio + 4,583 votes for Biden + Belmont, Ohio 23,560 votes for Trump - 9,138 votes for Biden - - - Brown, Ohio + 9,138 votes for Biden + Brown, Ohio 16,480 votes for Trump - 4,380 votes for Biden - - - Butler, Ohio + 4,380 votes for Biden + Butler, Ohio 114,392 votes for Trump - 69,613 votes for Biden - - - Carroll, Ohio + 69,613 votes for Biden + Carroll, Ohio 10,745 votes for Trump - 3,251 votes for Biden - - - Champaign, Ohio + 3,251 votes for Biden + Champaign, Ohio 14,589 votes for Trump - 5,062 votes for Biden - - - Clark, Ohio + 5,062 votes for Biden + Clark, Ohio 39,032 votes for Trump - 24,076 votes for Biden - - - Clermont, Ohio + 24,076 votes for Biden + Clermont, Ohio 74,570 votes for Trump - 34,092 votes for Biden - - - Clinton, Ohio + 34,092 votes for Biden + Clinton, Ohio 15,488 votes for Trump - 4,697 votes for Biden - - - Columbiana, Ohio + 4,697 votes for Biden + Columbiana, Ohio 35,726 votes for Trump - 13,359 votes for Biden - - - Coshocton, Ohio + 13,359 votes for Biden + Coshocton, Ohio 11,982 votes for Trump - 4,057 votes for Biden - - - Crawford, Ohio + 4,057 votes for Biden + Crawford, Ohio 15,043 votes for Trump - 4,831 votes for Biden - - - Cuyahoga, Ohio + 4,831 votes for Biden + Cuyahoga, Ohio 416,176 votes for Biden - 202,699 votes for Trump - - - Darke, Ohio + 202,699 votes for Trump + Darke, Ohio 22,003 votes for Trump - 4,731 votes for Biden - - - Defiance, Ohio + 4,731 votes for Biden + Defiance, Ohio 12,778 votes for Trump - 5,870 votes for Biden - - - Delaware, Ohio + 5,870 votes for Biden + Delaware, Ohio 66,356 votes for Trump - 57,735 votes for Biden - - - Erie, Ohio + 57,735 votes for Biden + Erie, Ohio 21,724 votes for Trump - 17,142 votes for Biden - - - Fairfield, Ohio + 17,142 votes for Biden + Fairfield, Ohio 49,714 votes for Trump - 30,634 votes for Biden - - - Fayette, Ohio + 30,634 votes for Biden + Fayette, Ohio 9,220 votes for Trump - 2,911 votes for Biden - - - Franklin, Ohio + 2,911 votes for Biden + Franklin, Ohio 409,144 votes for Biden - 211,237 votes for Trump - - - Fulton, Ohio + 211,237 votes for Trump + Fulton, Ohio 15,731 votes for Trump - 6,664 votes for Biden - - - Gallia, Ohio + 6,664 votes for Biden + Gallia, Ohio 10,645 votes for Trump - 2,990 votes for Biden - - - Geauga, Ohio + 2,990 votes for Biden + Geauga, Ohio 33,581 votes for Trump - 20,980 votes for Biden - - - Greene, Ohio + 20,980 votes for Biden + Greene, Ohio 52,072 votes for Trump - 34,798 votes for Biden - - - Guernsey, Ohio + 34,798 votes for Biden + Guernsey, Ohio 13,407 votes for Trump - 4,577 votes for Biden - - - Hamilton, Ohio + 4,577 votes for Biden + Hamilton, Ohio 246,266 votes for Biden - 177,886 votes for Trump - - - Hancock, Ohio + 177,886 votes for Trump + Hancock, Ohio 25,796 votes for Trump - 11,535 votes for Biden - - - Hardin, Ohio + 11,535 votes for Biden + Hardin, Ohio 9,949 votes for Trump - 3,062 votes for Biden - - - Harrison, Ohio + 3,062 votes for Biden + Harrison, Ohio 5,668 votes for Trump - 1,742 votes for Biden - - - Henry, Ohio + 1,742 votes for Biden + Henry, Ohio 10,479 votes for Trump - 4,062 votes for Biden - - - Highland, Ohio + 4,062 votes for Biden + Highland, Ohio 15,369 votes for Trump - 3,741 votes for Biden - - - Hocking, Ohio + 3,741 votes for Biden + Hocking, Ohio 9,554 votes for Trump - 3,836 votes for Biden - - - Holmes, Ohio + 3,836 votes for Biden + Holmes, Ohio 10,796 votes for Trump - 1,994 votes for Biden - - - Huron, Ohio + 1,994 votes for Biden + Huron, Ohio 18,537 votes for Trump - 7,643 votes for Biden - - - Jackson, Ohio + 7,643 votes for Biden + Jackson, Ohio 10,804 votes for Trump - 3,193 votes for Biden - - - Jefferson, Ohio + 3,193 votes for Biden + Jefferson, Ohio 22,828 votes for Trump - 10,018 votes for Biden - - - Knox, Ohio + 10,018 votes for Biden + Knox, Ohio 22,340 votes for Trump - 8,589 votes for Biden - - - Lake, Ohio + 8,589 votes for Biden + Lake, Ohio 73,278 votes for Trump - 55,514 votes for Biden - - - Lawrence, Ohio + 55,514 votes for Biden + Lawrence, Ohio 19,759 votes for Trump - 7,353 votes for Biden - - - Licking, Ohio + 7,353 votes for Biden + Licking, Ohio 59,514 votes for Trump - 33,055 votes for Biden - - - Logan, Ohio + 33,055 votes for Biden + Logan, Ohio 17,625 votes for Trump - 4,990 votes for Biden - - - Lorain, Ohio + 4,990 votes for Biden + Lorain, Ohio 76,719 votes for Trump - 72,792 votes for Biden - - - Lucas, Ohio + 72,792 votes for Biden + Lucas, Ohio 115,411 votes for Biden - 81,763 votes for Trump - - - Madison, Ohio + 81,763 votes for Trump + Madison, Ohio 13,445 votes for Trump - 5,558 votes for Biden - - - Mahoning, Ohio + 5,558 votes for Biden + Mahoning, Ohio 58,601 votes for Trump - 56,346 votes for Biden - - - Marion, Ohio + 56,346 votes for Biden + Marion, Ohio 18,526 votes for Trump - 8,089 votes for Biden - - - Medina, Ohio + 8,089 votes for Biden + Medina, Ohio 64,598 votes for Trump - 39,800 votes for Biden - - - Meigs, Ohio + 39,800 votes for Biden + Meigs, Ohio 8,163 votes for Trump - 2,452 votes for Biden - - - Mercer, Ohio + 2,452 votes for Biden + Mercer, Ohio 19,145 votes for Trump - 3,981 votes for Biden - - - Miami, Ohio + 3,981 votes for Biden + Miami, Ohio 41,371 votes for Trump - 15,663 votes for Biden - - - Monroe, Ohio + 15,663 votes for Biden + Monroe, Ohio 5,392 votes for Trump - 1,597 votes for Biden - - - Montgomery, Ohio + 1,597 votes for Biden + Montgomery, Ohio 135,064 votes for Biden - 129,034 votes for Trump - - - Morgan, Ohio + 129,034 votes for Trump + Morgan, Ohio 5,041 votes for Trump - 1,725 votes for Biden - - - Morrow, Ohio + 1,725 votes for Biden + Morrow, Ohio 13,784 votes for Trump - 3,988 votes for Biden - - - Muskingum, Ohio + 3,988 votes for Biden + Muskingum, Ohio 27,334 votes for Trump - 11,755 votes for Biden - - - Noble, Ohio + 11,755 votes for Biden + Noble, Ohio 5,024 votes for Trump - 1,156 votes for Biden - - - Ottawa, Ohio + 1,156 votes for Biden + Ottawa, Ohio 14,628 votes for Trump - 9,008 votes for Biden - - - Paulding, Ohio + 9,008 votes for Biden + Paulding, Ohio 6,927 votes for Trump - 2,172 votes for Biden - - - Perry, Ohio + 2,172 votes for Biden + Perry, Ohio 11,959 votes for Trump - 4,006 votes for Biden - - - Pickaway, Ohio + 4,006 votes for Biden + Pickaway, Ohio 20,593 votes for Trump - 7,304 votes for Biden - - - Pike, Ohio + 7,304 votes for Biden + Pike, Ohio 8,872 votes for Trump - 3,051 votes for Biden - - - Portage, Ohio + 3,051 votes for Biden + Portage, Ohio 45,990 votes for Trump - 35,661 votes for Biden - - - Preble, Ohio + 35,661 votes for Biden + Preble, Ohio 16,697 votes for Trump - 4,435 votes for Biden - - - Putnam, Ohio + 4,435 votes for Biden + Putnam, Ohio 16,218 votes for Trump - 3,152 votes for Biden - - - Richland, Ohio + 3,152 votes for Biden + Richland, Ohio 41,472 votes for Trump - 17,640 votes for Biden - - - Ross, Ohio + 17,640 votes for Biden + Ross, Ohio 22,278 votes for Trump - 10,557 votes for Biden - - - Sandusky, Ohio + 10,557 votes for Biden + Sandusky, Ohio 18,487 votes for Trump - 10,391 votes for Biden - - - Scioto, Ohio + 10,391 votes for Biden + Scioto, Ohio 22,609 votes for Trump - 9,080 votes for Biden - - - Seneca, Ohio + 9,080 votes for Biden + Seneca, Ohio 16,739 votes for Trump - 8,147 votes for Biden - - - Shelby, Ohio + 8,147 votes for Biden + Shelby, Ohio 19,988 votes for Trump - 4,399 votes for Biden - - - Stark, Ohio + 4,399 votes for Biden + Stark, Ohio 111,097 votes for Trump - 75,904 votes for Biden - - - Summit, Ohio + 75,904 votes for Biden + Summit, Ohio 151,668 votes for Biden - 124,833 votes for Trump - - - Trumbull, Ohio + 124,833 votes for Trump + Trumbull, Ohio 55,194 votes for Trump - 44,519 votes for Biden - - - Tuscarawas, Ohio + 44,519 votes for Biden + Tuscarawas, Ohio 30,458 votes for Trump - 12,889 votes for Biden - - - Union, Ohio + 12,889 votes for Biden + Union, Ohio 21,669 votes for Trump - 11,141 votes for Biden - - - Van Wert, Ohio + 11,141 votes for Biden + Van Wert, Ohio 11,470 votes for Trump - 3,026 votes for Biden - - - Vinton, Ohio + 3,026 votes for Biden + Vinton, Ohio 4,525 votes for Trump - 1,306 votes for Biden - - - Warren, Ohio + 1,306 votes for Biden + Warren, Ohio 87,988 votes for Trump - 46,069 votes for Biden - - - Washington, Ohio + 46,069 votes for Biden + Washington, Ohio 21,798 votes for Trump - 9,114 votes for Biden - - - Wayne, Ohio + 9,114 votes for Biden + Wayne, Ohio 36,759 votes for Trump - 16,660 votes for Biden - - - Williams, Ohio + 16,660 votes for Biden + Williams, Ohio 13,218 votes for Trump - 4,726 votes for Biden - - - Wood, Ohio + 4,726 votes for Biden + Wood, Ohio 35,757 votes for Trump - 30,617 votes for Biden - - - Wyandot, Ohio + 30,617 votes for Biden + Wyandot, Ohio 8,248 votes for Trump - 2,690 votes for Biden - - - Aurora, South Dakota + 2,690 votes for Biden + Aurora, South Dakota 1,052 votes for Trump - 317 votes for Biden - - - Beadle, South Dakota + 317 votes for Biden + Beadle, South Dakota 4,808 votes for Trump - 2,107 votes for Biden - - - Bennett, South Dakota + 2,107 votes for Biden + Bennett, South Dakota 694 votes for Trump - 466 votes for Biden - - - Bon Homme, South Dakota + 466 votes for Biden + Bon Homme, South Dakota 2,235 votes for Trump - 721 votes for Biden - - - Brookings, South Dakota + 721 votes for Biden + Brookings, South Dakota 8,000 votes for Trump - 6,110 votes for Biden - - - Brown, South Dakota + 6,110 votes for Biden + Brown, South Dakota 10,580 votes for Trump - 6,538 votes for Biden - - - Brule, South Dakota + 6,538 votes for Biden + Brule, South Dakota 1,750 votes for Trump - 673 votes for Biden - - - Buffalo, South Dakota + 673 votes for Biden + Buffalo, South Dakota 352 votes for Biden - 183 votes for Trump - - - Butte, South Dakota + 183 votes for Trump + Butte, South Dakota 3,731 votes for Trump - 939 votes for Biden - - - Campbell, South Dakota + 939 votes for Biden + Campbell, South Dakota 747 votes for Trump - 117 votes for Biden - - - Charles Mix, South Dakota + 117 votes for Biden + Charles Mix, South Dakota 2,552 votes for Trump - 1,177 votes for Biden - - - Clark, South Dakota + 1,177 votes for Biden + Clark, South Dakota 1,373 votes for Trump - 437 votes for Biden - - - Clay, South Dakota + 437 votes for Biden + Clay, South Dakota 3,083 votes for Biden - 2,456 votes for Trump - - - Codington, South Dakota + 2,456 votes for Trump + Codington, South Dakota 8,958 votes for Trump - 3,837 votes for Biden - - - Corson, South Dakota + 3,837 votes for Biden + Corson, South Dakota 647 votes for Trump - 622 votes for Biden - - - Custer, South Dakota + 622 votes for Biden + Custer, South Dakota 3,852 votes for Trump - 1,522 votes for Biden - - - Davison, South Dakota + 1,522 votes for Biden + Davison, South Dakota 5,613 votes for Trump - 2,648 votes for Biden - - - Day, South Dakota + 2,648 votes for Biden + Day, South Dakota 1,869 votes for Trump - 1,052 votes for Biden - - - Deuel, South Dakota + 1,052 votes for Biden + Deuel, South Dakota 1,699 votes for Trump - 609 votes for Biden - - - Dewey, South Dakota + 609 votes for Biden + Dewey, South Dakota 1,131 votes for Biden - 790 votes for Trump - - - Douglas, South Dakota + 790 votes for Trump + Douglas, South Dakota 1,468 votes for Trump - 216 votes for Biden - - - Edmunds, South Dakota + 216 votes for Biden + Edmunds, South Dakota 1,538 votes for Trump - 417 votes for Biden - - - Fall River, South Dakota + 417 votes for Biden + Fall River, South Dakota 2,878 votes for Trump - 1,053 votes for Biden - - - Faulk, South Dakota + 1,053 votes for Biden + Faulk, South Dakota 964 votes for Trump - 198 votes for Biden - - - Grant, South Dakota + 198 votes for Biden + Grant, South Dakota 2,618 votes for Trump - 1,056 votes for Biden - - - Gregory, South Dakota + 1,056 votes for Biden + Gregory, South Dakota 1,771 votes for Trump - 455 votes for Biden - - - Haakon, South Dakota + 455 votes for Biden + Haakon, South Dakota 1,026 votes for Trump - 105 votes for Biden - - - Hamlin, South Dakota + 105 votes for Biden + Hamlin, South Dakota 2,372 votes for Trump - 647 votes for Biden - - - Hand, South Dakota + 647 votes for Biden + Hand, South Dakota 1,433 votes for Trump - 373 votes for Biden - - - Hanson, South Dakota + 373 votes for Biden + Hanson, South Dakota 1,793 votes for Trump - 557 votes for Biden - - - Harding, South Dakota + 557 votes for Biden + Harding, South Dakota 748 votes for Trump - 49 votes for Biden - - - Hughes, South Dakota + 49 votes for Biden + Hughes, South Dakota 5,522 votes for Trump - 2,953 votes for Biden - - - Hutchinson, South Dakota + 2,953 votes for Biden + Hutchinson, South Dakota 2,944 votes for Trump - 762 votes for Biden - - - Hyde, South Dakota + 762 votes for Biden + Hyde, South Dakota 564 votes for Trump - 136 votes for Biden - - - Jackson, South Dakota + 136 votes for Biden + Jackson, South Dakota 738 votes for Trump - 359 votes for Biden - - - Jerauld, South Dakota + 359 votes for Biden + Jerauld, South Dakota 721 votes for Trump - 270 votes for Biden - - - Jones, South Dakota + 270 votes for Biden + Jones, South Dakota 498 votes for Trump - 90 votes for Biden - - - Kingsbury, South Dakota + 90 votes for Biden + Kingsbury, South Dakota 1,904 votes for Trump - 819 votes for Biden - - - Lake, South Dakota + 819 votes for Biden + Lake, South Dakota 3,681 votes for Trump - 2,068 votes for Biden - - - Lawrence, South Dakota + 2,068 votes for Biden + Lawrence, South Dakota 8,753 votes for Trump - 4,537 votes for Biden - - - Lincoln, South Dakota + 4,537 votes for Biden + Lincoln, South Dakota 19,617 votes for Trump - 11,981 votes for Biden - - - Lyman, South Dakota + 11,981 votes for Biden + Lyman, South Dakota 1,042 votes for Trump - 525 votes for Biden - - - Marshall, South Dakota + 525 votes for Biden + Marshall, South Dakota 1,287 votes for Trump - 858 votes for Biden - - - McCook, South Dakota + 858 votes for Biden + McCook, South Dakota 2,068 votes for Trump - 769 votes for Biden - - - McPherson, South Dakota + 769 votes for Biden + McPherson, South Dakota 1,075 votes for Trump - 222 votes for Biden - - - Meade, South Dakota + 222 votes for Biden + Meade, South Dakota 9,875 votes for Trump - 3,285 votes for Biden - - - Mellette, South Dakota + 3,285 votes for Biden + Mellette, South Dakota 449 votes for Trump - 298 votes for Biden - - - Miner, South Dakota + 298 votes for Biden + Miner, South Dakota 787 votes for Trump - 320 votes for Biden - - - Minnehaha, South Dakota + 320 votes for Biden + Minnehaha, South Dakota 49,249 votes for Trump - 40,482 votes for Biden - - - Moody, South Dakota + 40,482 votes for Biden + Moody, South Dakota 1,951 votes for Trump - 1,179 votes for Biden - - - Oglala Lakota, South Dakota + 1,179 votes for Biden + Oglala Lakota, South Dakota 2,829 votes for Biden - 297 votes for Trump - - - Pennington, South Dakota + 297 votes for Trump + Pennington, South Dakota 35,063 votes for Trump - 20,606 votes for Biden - - - Perkins, South Dakota + 20,606 votes for Biden + Perkins, South Dakota 1,401 votes for Trump - 239 votes for Biden - - - Potter, South Dakota + 239 votes for Biden + Potter, South Dakota 1,139 votes for Trump - 227 votes for Biden - - - Roberts, South Dakota + 227 votes for Biden + Roberts, South Dakota 2,404 votes for Trump - 1,828 votes for Biden - - - Sanborn, South Dakota + 1,828 votes for Biden + Sanborn, South Dakota 905 votes for Trump - 257 votes for Biden - - - Spink, South Dakota + 257 votes for Biden + Spink, South Dakota 2,104 votes for Trump - 998 votes for Biden - - - Stanley, South Dakota + 998 votes for Biden + Stanley, South Dakota 1,203 votes for Trump - 421 votes for Biden - - - Sully, South Dakota + 421 votes for Biden + Sully, South Dakota 726 votes for Trump - 185 votes for Biden - - - Todd, South Dakota + 185 votes for Biden + Todd, South Dakota 1,963 votes for Biden - 532 votes for Trump - - - Tripp, South Dakota + 532 votes for Trump + Tripp, South Dakota 2,161 votes for Trump - 495 votes for Biden - - - Turner, South Dakota + 495 votes for Biden + Turner, South Dakota 3,290 votes for Trump - 1,139 votes for Biden - - - Union, South Dakota + 1,139 votes for Biden + Union, South Dakota 5,944 votes for Trump - 2,725 votes for Biden - - - Walworth, South Dakota + 2,725 votes for Biden + Walworth, South Dakota 1,966 votes for Trump - 565 votes for Biden - - - Yankton, South Dakota + 565 votes for Biden + Yankton, South Dakota 6,581 votes for Trump - 4,016 votes for Biden - - - Ziebach, South Dakota + 4,016 votes for Biden + Ziebach, South Dakota 481 votes for Biden - 404 votes for Trump - - - Addison, Vermont + 404 votes for Trump + Addison, Vermont 14,967 votes for Biden - 6,292 votes for Trump - - - Bennington, Vermont + 6,292 votes for Trump + Bennington, Vermont 12,705 votes for Biden - 7,114 votes for Trump - - - Caledonia, Vermont + 7,114 votes for Trump + Caledonia, Vermont 9,011 votes for Biden - 6,551 votes for Trump - - - Chittenden, Vermont + 6,551 votes for Trump + Chittenden, Vermont 74,961 votes for Biden - 21,017 votes for Trump - - - Essex, Vermont + 21,017 votes for Trump + Essex, Vermont 1,773 votes for Trump - 1,405 votes for Biden - - - Franklin, Vermont + 1,405 votes for Biden + Franklin, Vermont 13,611 votes for Biden - 11,274 votes for Trump - - - Grand Isle, Vermont + 11,274 votes for Trump + Grand Isle, Vermont 2,905 votes for Biden - 1,810 votes for Trump - - - Lamoille, Vermont + 1,810 votes for Trump + Lamoille, Vermont 10,240 votes for Biden - 4,163 votes for Trump - - - Orange, Vermont + 4,163 votes for Trump + Orange, Vermont 10,304 votes for Biden - 6,187 votes for Trump - - - Orleans, Vermont + 6,187 votes for Trump + Orleans, Vermont 7,147 votes for Biden - 6,512 votes for Trump - - - Rutland, Vermont + 6,512 votes for Trump + Rutland, Vermont 18,230 votes for Biden - 14,672 votes for Trump - - - Washington, Vermont + 14,672 votes for Trump + Washington, Vermont 25,191 votes for Biden - 8,928 votes for Trump - - - Windham, Vermont + 8,928 votes for Trump + Windham, Vermont 18,767 votes for Biden - 6,440 votes for Trump - - - Windsor, Vermont + 6,440 votes for Trump + Windsor, Vermont 23,376 votes for Biden - 9,971 votes for Trump - - - Adams, Indiana + 9,971 votes for Trump + Adams, Indiana 10,685 votes for Trump - 3,236 votes for Biden - - - Allen, Indiana + 3,236 votes for Biden + Allen, Indiana 92,083 votes for Trump - 73,189 votes for Biden - - - Bartholomew, Indiana + 73,189 votes for Biden + Bartholomew, Indiana 22,409 votes for Trump - 12,934 votes for Biden - - - Benton, Indiana + 12,934 votes for Biden + Benton, Indiana 3,007 votes for Trump - 1,009 votes for Biden - - - Blackford, Indiana + 1,009 votes for Biden + Blackford, Indiana 3,838 votes for Trump - 1,376 votes for Biden - - - Boone, Indiana + 1,376 votes for Biden + Boone, Indiana 22,351 votes for Trump - 15,244 votes for Biden - - - Brown, Indiana + 15,244 votes for Biden + Brown, Indiana 5,777 votes for Trump - 3,036 votes for Biden - - - Carroll, Indiana + 3,036 votes for Biden + Carroll, Indiana 7,086 votes for Trump - 2,224 votes for Biden - - - Cass, Indiana + 2,224 votes for Biden + Cass, Indiana 10,552 votes for Trump - 4,304 votes for Biden - - - Clark, Indiana + 4,304 votes for Biden + Clark, Indiana 33,656 votes for Trump - 23,088 votes for Biden - - - Clay, Indiana + 23,088 votes for Biden + Clay, Indiana 9,498 votes for Trump - 2,549 votes for Biden - - - Clinton, Indiana + 2,549 votes for Biden + Clinton, Indiana 9,334 votes for Trump - 3,361 votes for Biden - - - Crawford, Indiana + 3,361 votes for Biden + Crawford, Indiana 3,499 votes for Trump - 1,369 votes for Biden - - - Daviess, Indiana + 1,369 votes for Biden + Daviess, Indiana 9,576 votes for Trump - 2,169 votes for Biden - - - DeKalb, Indiana + 2,169 votes for Biden + DeKalb, Indiana 14,237 votes for Trump - 4,966 votes for Biden - - - Dearborn, Indiana + 4,966 votes for Biden + Dearborn, Indiana 19,528 votes for Trump - 5,446 votes for Biden - - - Decatur, Indiana + 5,446 votes for Biden + Decatur, Indiana 9,570 votes for Trump - 2,436 votes for Biden - - - Delaware, Indiana + 2,436 votes for Biden + Delaware, Indiana 26,827 votes for Trump - 20,474 votes for Biden - - - Dubois, Indiana + 20,474 votes for Biden + Dubois, Indiana 15,032 votes for Trump - 6,292 votes for Biden - - - Elkhart, Indiana + 6,292 votes for Biden + Elkhart, Indiana 46,972 votes for Trump - 26,108 votes for Biden - - - Fayette, Indiana + 26,108 votes for Biden + Fayette, Indiana 7,755 votes for Trump - 2,237 votes for Biden - - - Floyd, Indiana + 2,237 votes for Biden + Floyd, Indiana 23,400 votes for Trump - 17,511 votes for Biden - - - Fountain, Indiana + 17,511 votes for Biden + Fountain, Indiana 6,154 votes for Trump - 1,629 votes for Biden - - - Franklin, Indiana + 1,629 votes for Biden + Franklin, Indiana 9,691 votes for Trump - 2,137 votes for Biden - - - Fulton, Indiana + 2,137 votes for Biden + Fulton, Indiana 6,694 votes for Trump - 2,280 votes for Biden - - - Gibson, Indiana + 2,280 votes for Biden + Gibson, Indiana 11,817 votes for Trump - 4,027 votes for Biden - - - Grant, Indiana + 4,027 votes for Biden + Grant, Indiana 18,543 votes for Trump - 8,015 votes for Biden - - - Greene, Indiana + 8,015 votes for Biden + Greene, Indiana 11,103 votes for Trump - 3,389 votes for Biden - - - Hamilton, Indiana + 3,389 votes for Biden + Hamilton, Indiana 101,587 votes for Trump - 88,390 votes for Biden - - - Hancock, Indiana + 88,390 votes for Biden + Hancock, Indiana 28,996 votes for Trump - 12,895 votes for Biden - - - Harrison, Indiana + 12,895 votes for Biden + Harrison, Indiana 14,565 votes for Trump - 5,343 votes for Biden - - - Hendricks, Indiana + 5,343 votes for Biden + Hendricks, Indiana 53,802 votes for Trump - 32,604 votes for Biden - - - Henry, Indiana + 32,604 votes for Biden + Henry, Indiana 15,043 votes for Trump - 5,544 votes for Biden - - - Howard, Indiana + 5,544 votes for Biden + Howard, Indiana 26,400 votes for Trump - 13,270 votes for Biden - - - Huntington, Indiana + 13,270 votes for Biden + Huntington, Indiana 13,147 votes for Trump - 4,255 votes for Biden - - - Jackson, Indiana + 4,255 votes for Biden + Jackson, Indiana 14,555 votes for Trump - 4,302 votes for Biden - - - Jasper, Indiana + 4,302 votes for Biden + Jasper, Indiana 11,383 votes for Trump - 3,798 votes for Biden - - - Jay, Indiana + 3,798 votes for Biden + Jay, Indiana 6,361 votes for Trump - 1,926 votes for Biden - - - Jefferson, Indiana + 1,926 votes for Biden + Jefferson, Indiana 9,659 votes for Trump - 4,731 votes for Biden - - - Jennings, Indiana + 4,731 votes for Biden + Jennings, Indiana 9,490 votes for Trump - 2,523 votes for Biden - - - Johnson, Indiana + 2,523 votes for Biden + Johnson, Indiana 51,209 votes for Trump - 24,729 votes for Biden - - - Knox, Indiana + 24,729 votes for Biden + Knox, Indiana 11,654 votes for Trump - 4,067 votes for Biden - - - Kosciusko, Indiana + 4,067 votes for Biden + Kosciusko, Indiana 26,476 votes for Trump - 8,350 votes for Biden - - - LaGrange, Indiana + 8,350 votes for Biden + LaGrange, Indiana 8,110 votes for Trump - 2,355 votes for Biden - - - LaPorte, Indiana + 2,355 votes for Biden + LaPorte, Indiana 25,991 votes for Trump - 22,419 votes for Biden - - - Lake, Indiana + 22,419 votes for Biden + Lake, Indiana 124,801 votes for Biden - 91,733 votes for Trump - - - Lawrence, Indiana + 91,733 votes for Trump + Lawrence, Indiana 15,601 votes for Trump - 4,961 votes for Biden - - - Madison, Indiana + 4,961 votes for Biden + Madison, Indiana 31,215 votes for Trump - 19,524 votes for Biden - - - Marion, Indiana + 19,524 votes for Biden + Marion, Indiana 247,265 votes for Biden - 133,968 votes for Trump - - - Marshall, Indiana + 133,968 votes for Trump + Marshall, Indiana 13,844 votes for Trump - 5,712 votes for Biden - - - Martin, Indiana + 5,712 votes for Biden + Martin, Indiana 4,029 votes for Trump - 1,011 votes for Biden - - - Miami, Indiana + 1,011 votes for Biden + Miami, Indiana 10,925 votes for Trump - 3,235 votes for Biden - - - Monroe, Indiana + 3,235 votes for Biden + Monroe, Indiana 39,861 votes for Biden - 22,071 votes for Trump - - - Montgomery, Indiana + 22,071 votes for Trump + Montgomery, Indiana 12,659 votes for Trump - 4,213 votes for Biden - - - Morgan, Indiana + 4,213 votes for Biden + Morgan, Indiana 27,510 votes for Trump - 7,777 votes for Biden - - - Newton, Indiana + 7,777 votes for Biden + Newton, Indiana 4,942 votes for Trump - 1,509 votes for Biden - - - Noble, Indiana + 1,509 votes for Biden + Noble, Indiana 14,195 votes for Trump - 4,660 votes for Biden - - - Ohio, Indiana + 4,660 votes for Biden + Ohio, Indiana 2,392 votes for Trump - 750 votes for Biden - - - Orange, Indiana + 750 votes for Biden + Orange, Indiana 6,432 votes for Trump - 2,224 votes for Biden - - - Owen, Indiana + 2,224 votes for Biden + Owen, Indiana 7,285 votes for Trump - 2,419 votes for Biden - - - Parke, Indiana + 2,419 votes for Biden + Parke, Indiana 5,398 votes for Trump - 1,503 votes for Biden - - - Perry, Indiana + 1,503 votes for Biden + Perry, Indiana 5,343 votes for Trump - 3,202 votes for Biden - - - Pike, Indiana + 3,202 votes for Biden + Pike, Indiana 4,692 votes for Trump - 1,415 votes for Biden - - - Porter, Indiana + 1,415 votes for Biden + Porter, Indiana 45,008 votes for Trump - 39,746 votes for Biden - - - Posey, Indiana + 39,746 votes for Biden + Posey, Indiana 9,206 votes for Trump - 3,811 votes for Biden - - - Pulaski, Indiana + 3,811 votes for Biden + Pulaski, Indiana 4,246 votes for Trump - 1,463 votes for Biden - - - Putnam, Indiana + 1,463 votes for Biden + Putnam, Indiana 12,278 votes for Trump - 3,946 votes for Biden - - - Randolph, Indiana + 3,946 votes for Biden + Randolph, Indiana 8,312 votes for Trump - 2,512 votes for Biden - - - Ripley, Indiana + 2,512 votes for Biden + Ripley, Indiana 11,261 votes for Trump - 2,774 votes for Biden - - - Rush, Indiana + 2,774 votes for Biden + Rush, Indiana 6,035 votes for Trump - 1,754 votes for Biden - - - Scott, Indiana + 1,754 votes for Biden + Scott, Indiana 7,328 votes for Trump - 2,698 votes for Biden - - - Shelby, Indiana + 2,698 votes for Biden + Shelby, Indiana 14,568 votes for Trump - 5,023 votes for Biden - - - Spencer, Indiana + 5,023 votes for Biden + Spencer, Indiana 7,354 votes for Trump - 3,208 votes for Biden - - - St. Joseph, Indiana + 3,208 votes for Biden + St. Joseph, Indiana 59,870 votes for Biden - 53,152 votes for Trump - - - Starke, Indiana + 53,152 votes for Trump + Starke, Indiana 7,466 votes for Trump - 2,650 votes for Biden - - - Steuben, Indiana + 2,650 votes for Biden + Steuben, Indiana 11,322 votes for Trump - 4,509 votes for Biden - - - Sullivan, Indiana + 4,509 votes for Biden + Sullivan, Indiana 6,687 votes for Trump - 2,153 votes for Biden - - - Switzerland, Indiana + 2,153 votes for Biden + Switzerland, Indiana 3,133 votes for Trump - 964 votes for Biden - - - Tippecanoe, Indiana + 964 votes for Biden + Tippecanoe, Indiana 35,017 votes for Biden - 34,581 votes for Trump - - - Tipton, Indiana + 34,581 votes for Trump + Tipton, Indiana 6,110 votes for Trump - 1,834 votes for Biden - - - Union, Indiana + 1,834 votes for Biden + Union, Indiana 2,687 votes for Trump - 736 votes for Biden - - - Vanderburgh, Indiana + 736 votes for Biden + Vanderburgh, Indiana 41,844 votes for Trump - 34,415 votes for Biden - - - Vermillion, Indiana + 34,415 votes for Biden + Vermillion, Indiana 5,184 votes for Trump - 2,145 votes for Biden - - - Vigo, Indiana + 2,145 votes for Biden + Vigo, Indiana 24,512 votes for Trump - 18,080 votes for Biden - - - Wabash, Indiana + 18,080 votes for Biden + Wabash, Indiana 10,762 votes for Trump - 3,494 votes for Biden - - - Warren, Indiana + 3,494 votes for Biden + Warren, Indiana 3,401 votes for Trump - 974 votes for Biden - - - Warrick, Indiana + 974 votes for Biden + Warrick, Indiana 21,324 votes for Trump - 11,919 votes for Biden - - - Washington, Indiana + 11,919 votes for Biden + Washington, Indiana 9,114 votes for Trump - 2,784 votes for Biden - - - Wayne, Indiana + 2,784 votes for Biden + Wayne, Indiana 17,567 votes for Trump - 9,524 votes for Biden - - - Wells, Indiana + 9,524 votes for Biden + Wells, Indiana 10,855 votes for Trump - 2,928 votes for Biden - - - White, Indiana + 2,928 votes for Biden + White, Indiana 7,957 votes for Trump - 3,032 votes for Biden - - - Whitley, Indiana + 3,032 votes for Biden + Whitley, Indiana 12,856 votes for Trump - 4,233 votes for Biden - - - Adams, Pennsylvania + 4,233 votes for Biden + Adams, Pennsylvania 37,567 votes for Trump - 18,254 votes for Biden - - - Allegheny, Pennsylvania + 18,254 votes for Biden + Allegheny, Pennsylvania 429,065 votes for Biden - 282,324 votes for Trump - - - Armstrong, Pennsylvania + 282,324 votes for Trump + Armstrong, Pennsylvania 27,479 votes for Trump - 8,453 votes for Biden - - - Beaver, Pennsylvania + 8,453 votes for Biden + Beaver, Pennsylvania 54,108 votes for Trump - 37,747 votes for Biden - - - Bedford, Pennsylvania + 37,747 votes for Biden + Bedford, Pennsylvania 23,025 votes for Trump - 4,367 votes for Biden - - - Berks, Pennsylvania + 4,367 votes for Biden + Berks, Pennsylvania 109,727 votes for Trump - 92,892 votes for Biden - - - Blair, Pennsylvania + 92,892 votes for Biden + Blair, Pennsylvania 45,306 votes for Trump - 17,636 votes for Biden - - - Bradford, Pennsylvania + 17,636 votes for Biden + Bradford, Pennsylvania 21,586 votes for Trump - 8,044 votes for Biden - - - Bucks, Pennsylvania + 8,044 votes for Biden + Bucks, Pennsylvania 204,712 votes for Biden - 187,367 votes for Trump - - - Butler, Pennsylvania + 187,367 votes for Trump + Butler, Pennsylvania 74,279 votes for Trump - 37,379 votes for Biden - - - Cambria, Pennsylvania + 37,379 votes for Biden + Cambria, Pennsylvania 48,094 votes for Trump - 21,752 votes for Biden - - - Cameron, Pennsylvania + 21,752 votes for Biden + Cameron, Pennsylvania 1,771 votes for Trump - 634 votes for Biden - - - Carbon, Pennsylvania + 634 votes for Biden + Carbon, Pennsylvania 21,773 votes for Trump - 11,083 votes for Biden - - - Centre, Pennsylvania + 11,083 votes for Biden + Centre, Pennsylvania 40,054 votes for Biden - 36,371 votes for Trump - - - Chester, Pennsylvania + 36,371 votes for Trump + Chester, Pennsylvania 181,170 votes for Biden - 127,693 votes for Trump - - - Clarion, Pennsylvania + 127,693 votes for Trump + Clarion, Pennsylvania 14,550 votes for Trump - 4,671 votes for Biden - - - Clearfield, Pennsylvania + 4,671 votes for Biden + Clearfield, Pennsylvania 29,203 votes for Trump - 9,673 votes for Biden - - - Clinton, Pennsylvania + 9,673 votes for Biden + Clinton, Pennsylvania 11,897 votes for Trump - 5,501 votes for Biden - - - Columbia, Pennsylvania + 5,501 votes for Biden + Columbia, Pennsylvania 20,098 votes for Trump - 10,532 votes for Biden - - - Crawford, Pennsylvania + 10,532 votes for Biden + Crawford, Pennsylvania 28,002 votes for Trump - 12,610 votes for Biden - - - Cumberland, Pennsylvania + 12,610 votes for Biden + Cumberland, Pennsylvania 77,212 votes for Trump - 62,237 votes for Biden - - - Dauphin, Pennsylvania + 62,237 votes for Biden + Dauphin, Pennsylvania 78,912 votes for Biden - 66,365 votes for Trump - - - Delaware, Pennsylvania + 66,365 votes for Trump + Delaware, Pennsylvania 206,615 votes for Biden - 118,627 votes for Trump - - - Elk, Pennsylvania + 118,627 votes for Trump + Elk, Pennsylvania 12,140 votes for Trump - 4,522 votes for Biden - - - Erie, Pennsylvania + 4,522 votes for Biden + Erie, Pennsylvania 68,336 votes for Biden - 66,912 votes for Trump - - - Fayette, Pennsylvania + 66,912 votes for Trump + Fayette, Pennsylvania 39,978 votes for Trump - 19,518 votes for Biden - - - Forest, Pennsylvania + 19,518 votes for Biden + Forest, Pennsylvania 1,864 votes for Trump - 715 votes for Biden - - - Franklin, Pennsylvania + 715 votes for Biden + Franklin, Pennsylvania 57,308 votes for Trump - 22,468 votes for Biden - - - Fulton, Pennsylvania + 22,468 votes for Biden + Fulton, Pennsylvania 6,824 votes for Trump - 1,085 votes for Biden - - - Greene, Pennsylvania + 1,085 votes for Biden + Greene, Pennsylvania 12,556 votes for Trump - 4,900 votes for Biden - - - Huntingdon, Pennsylvania + 4,900 votes for Biden + Huntingdon, Pennsylvania 17,059 votes for Trump - 5,448 votes for Biden - - - Indiana, Pennsylvania + 5,448 votes for Biden + Indiana, Pennsylvania 28,087 votes for Trump - 12,634 votes for Biden - - - Jefferson, Pennsylvania + 12,634 votes for Biden + Jefferson, Pennsylvania 17,960 votes for Trump - 4,527 votes for Biden - - - Juniata, Pennsylvania + 4,527 votes for Biden + Juniata, Pennsylvania 9,649 votes for Trump - 2,253 votes for Biden - - - Lackawanna, Pennsylvania + 2,253 votes for Biden + Lackawanna, Pennsylvania 61,881 votes for Biden - 52,295 votes for Trump - - - Lancaster, Pennsylvania + 52,295 votes for Trump + Lancaster, Pennsylvania 159,902 votes for Trump - 115,294 votes for Biden - - - Lawrence, Pennsylvania + 115,294 votes for Biden + Lawrence, Pennsylvania 29,597 votes for Trump - 15,978 votes for Biden - - - Lebanon, Pennsylvania + 15,978 votes for Biden + Lebanon, Pennsylvania 46,731 votes for Trump - 23,932 votes for Biden - - - Lehigh, Pennsylvania + 23,932 votes for Biden + Lehigh, Pennsylvania 95,889 votes for Biden - 82,287 votes for Trump - - - Luzerne, Pennsylvania + 82,287 votes for Trump + Luzerne, Pennsylvania 86,929 votes for Trump - 64,873 votes for Biden - - - Lycoming, Pennsylvania + 64,873 votes for Biden + Lycoming, Pennsylvania 41,462 votes for Trump - 16,971 votes for Biden - - - McKean, Pennsylvania + 16,971 votes for Biden + McKean, Pennsylvania 14,067 votes for Trump - 5,076 votes for Biden - - - Mercer, Pennsylvania + 5,076 votes for Biden + Mercer, Pennsylvania 36,059 votes for Trump - 20,984 votes for Biden - - - Mifflin, Pennsylvania + 20,984 votes for Biden + Mifflin, Pennsylvania 16,663 votes for Trump - 4,599 votes for Biden - - - Monroe, Pennsylvania + 4,599 votes for Biden + Monroe, Pennsylvania 43,884 votes for Biden - 38,642 votes for Trump - - - Montgomery, Pennsylvania + 38,642 votes for Trump + Montgomery, Pennsylvania 318,041 votes for Biden - 184,698 votes for Trump - - - Montour, Pennsylvania + 184,698 votes for Trump + Montour, Pennsylvania 5,842 votes for Trump - 3,768 votes for Biden - - - Northampton, Pennsylvania + 3,768 votes for Biden + Northampton, Pennsylvania 84,847 votes for Biden - 83,732 votes for Trump - - - Northumberland, Pennsylvania + 83,732 votes for Trump + Northumberland, Pennsylvania 28,975 votes for Trump - 12,703 votes for Biden - - - Perry, Pennsylvania + 12,703 votes for Biden + Perry, Pennsylvania 18,293 votes for Trump - 5,950 votes for Biden - - - Philadelphia, Pennsylvania + 5,950 votes for Biden + Philadelphia, Pennsylvania 604,175 votes for Biden - 132,870 votes for Trump - - - Pike, Pennsylvania + 132,870 votes for Trump + Pike, Pennsylvania 19,241 votes for Trump - 13,052 votes for Biden - - - Potter, Pennsylvania + 13,052 votes for Biden + Potter, Pennsylvania 7,216 votes for Trump - 1,716 votes for Biden - - - Schuylkill, Pennsylvania + 1,716 votes for Biden + Schuylkill, Pennsylvania 48,100 votes for Trump - 20,425 votes for Biden - - - Snyder, Pennsylvania + 20,425 votes for Biden + Snyder, Pennsylvania 13,983 votes for Trump - 4,910 votes for Biden - - - Somerset, Pennsylvania + 4,910 votes for Biden + Somerset, Pennsylvania 31,105 votes for Trump - 8,543 votes for Biden - - - Sullivan, Pennsylvania + 8,543 votes for Biden + Sullivan, Pennsylvania 2,622 votes for Trump - 921 votes for Biden - - - Susquehanna, Pennsylvania + 921 votes for Biden + Susquehanna, Pennsylvania 14,879 votes for Trump - 6,084 votes for Biden - - - Tioga, Pennsylvania + 6,084 votes for Biden + Tioga, Pennsylvania 15,753 votes for Trump - 4,959 votes for Biden - - - Union, Pennsylvania + 4,959 votes for Biden + Union, Pennsylvania 12,356 votes for Trump - 7,475 votes for Biden - - - Venango, Pennsylvania + 7,475 votes for Biden + Venango, Pennsylvania 18,569 votes for Trump - 7,585 votes for Biden - - - Warren, Pennsylvania + 7,585 votes for Biden + Warren, Pennsylvania 14,020 votes for Trump - 5,987 votes for Biden - - - Washington, Pennsylvania + 5,987 votes for Biden + Washington, Pennsylvania 71,397 votes for Trump - 44,746 votes for Biden - - - Wayne, Pennsylvania + 44,746 votes for Biden + Wayne, Pennsylvania 18,637 votes for Trump - 9,191 votes for Biden - - - Westmoreland, Pennsylvania + 9,191 votes for Biden + Westmoreland, Pennsylvania 128,596 votes for Trump - 71,099 votes for Biden - - - Wyoming, Pennsylvania + 71,099 votes for Biden + Wyoming, Pennsylvania 9,936 votes for Trump - 4,704 votes for Biden - - - York, Pennsylvania + 4,704 votes for Biden + York, Pennsylvania 146,728 votes for Trump - 88,113 votes for Biden - - - Beaverhead, Montana + 88,113 votes for Biden + Beaverhead, Montana 3,923 votes for Trump - 1,608 votes for Biden - - - Big Horn, Montana + 1,608 votes for Biden + Big Horn, Montana 2,491 votes for Biden - 2,207 votes for Trump - - - Blaine, Montana + 2,207 votes for Trump + Blaine, Montana 1,589 votes for Biden - 1,469 votes for Trump - - - Broadwater, Montana + 1,469 votes for Trump + Broadwater, Montana 3,173 votes for Trump - 835 votes for Biden - - - Carbon, Montana + 835 votes for Biden + Carbon, Montana 4,468 votes for Trump - 2,421 votes for Biden - - - Carter, Montana + 2,421 votes for Biden + Carter, Montana 775 votes for Trump - 74 votes for Biden - - - Cascade, Montana + 74 votes for Biden + Cascade, Montana 23,314 votes for Trump - 15,456 votes for Biden - - - Chouteau, Montana + 15,456 votes for Biden + Chouteau, Montana 1,888 votes for Trump - 988 votes for Biden - - - Custer, Montana + 988 votes for Biden + Custer, Montana 4,205 votes for Trump - 1,514 votes for Biden - - - Daniels, Montana + 1,514 votes for Biden + Daniels, Montana 799 votes for Trump - 195 votes for Biden - - - Dawson, Montana + 195 votes for Biden + Dawson, Montana 3,758 votes for Trump - 962 votes for Biden - - - Deer Lodge, Montana + 962 votes for Biden + Deer Lodge, Montana 2,562 votes for Biden - 2,186 votes for Trump - - - Fallon, Montana + 2,186 votes for Trump + Fallon, Montana 1,375 votes for Trump - 172 votes for Biden - - - Fergus, Montana + 172 votes for Biden + Fergus, Montana 4,869 votes for Trump - 1,496 votes for Biden - - - Flathead, Montana + 1,496 votes for Biden + Flathead, Montana 38,321 votes for Trump - 20,274 votes for Biden - - - Gallatin, Montana + 20,274 votes for Biden + Gallatin, Montana 37,044 votes for Biden - 31,696 votes for Trump - - - Garfield, Montana + 31,696 votes for Trump + Garfield, Montana 764 votes for Trump - 41 votes for Biden - - - Glacier, Montana + 41 votes for Biden + Glacier, Montana 3,610 votes for Biden - 1,884 votes for Trump - - - Golden Valley, Montana + 1,884 votes for Trump + Golden Valley, Montana 414 votes for Trump - 78 votes for Biden - - - Granite, Montana + 78 votes for Biden + Granite, Montana 1,419 votes for Trump - 638 votes for Biden - - - Hill, Montana + 638 votes for Biden + Hill, Montana 3,957 votes for Trump - 2,981 votes for Biden - - - Jefferson, Montana + 2,981 votes for Biden + Jefferson, Montana 5,345 votes for Trump - 2,625 votes for Biden - - - Judith Basin, Montana + 2,625 votes for Biden + Judith Basin, Montana 1,040 votes for Trump - 275 votes for Biden - - - Lake, Montana + 275 votes for Biden + Lake, Montana 9,322 votes for Trump - 6,916 votes for Biden - - - Lewis and Clark, Montana + 6,916 votes for Biden + Lewis and Clark, Montana 21,409 votes for Trump - 19,743 votes for Biden - - - Liberty, Montana + 19,743 votes for Biden + Liberty, Montana 821 votes for Trump - 249 votes for Biden - - - Lincoln, Montana + 249 votes for Biden + Lincoln, Montana 8,672 votes for Trump - 2,835 votes for Biden - - - Madison, Montana + 2,835 votes for Biden + Madison, Montana 4,191 votes for Trump - 1,771 votes for Biden - - - McCone, Montana + 1,771 votes for Biden + McCone, Montana 956 votes for Trump - 155 votes for Biden - - - Meagher, Montana + 155 votes for Biden + Meagher, Montana 833 votes for Trump - 258 votes for Biden - - - Mineral, Montana + 258 votes for Biden + Mineral, Montana 1,828 votes for Trump - 686 votes for Biden - - - Missoula, Montana + 686 votes for Biden + Missoula, Montana 43,357 votes for Biden - 26,347 votes for Trump - - - Musselshell, Montana + 26,347 votes for Trump + Musselshell, Montana 2,423 votes for Trump - 413 votes for Biden - - - Park, Montana + 413 votes for Biden + Park, Montana 6,025 votes for Trump - 5,280 votes for Biden - - - Petroleum, Montana + 5,280 votes for Biden + Petroleum, Montana 298 votes for Trump - 39 votes for Biden - - - Phillips, Montana + 39 votes for Biden + Phillips, Montana 1,936 votes for Trump - 416 votes for Biden - - - Pondera, Montana + 416 votes for Biden + Pondera, Montana 2,031 votes for Trump - 903 votes for Biden - - - Powder River, Montana + 903 votes for Biden + Powder River, Montana 970 votes for Trump - 154 votes for Biden - - - Powell, Montana + 154 votes for Biden + Powell, Montana 2,347 votes for Trump - 752 votes for Biden - - - Prairie, Montana + 752 votes for Biden + Prairie, Montana 603 votes for Trump - 126 votes for Biden - - - Ravalli, Montana + 126 votes for Biden + Ravalli, Montana 19,114 votes for Trump - 8,763 votes for Biden - - - Richland, Montana + 8,763 votes for Biden + Richland, Montana 4,800 votes for Trump - 875 votes for Biden - - - Roosevelt, Montana + 875 votes for Biden + Roosevelt, Montana 1,996 votes for Trump - 1,910 votes for Biden - - - Rosebud, Montana + 1,910 votes for Biden + Rosebud, Montana 2,486 votes for Trump - 1,199 votes for Biden - - - Sanders, Montana + 1,199 votes for Biden + Sanders, Montana 5,660 votes for Trump - 1,820 votes for Biden - - - Sheridan, Montana + 1,820 votes for Biden + Sheridan, Montana 1,403 votes for Trump - 574 votes for Biden - - - Silver Bow, Montana + 574 votes for Biden + Silver Bow, Montana 10,392 votes for Biden - 7,745 votes for Trump - - - Stillwater, Montana + 7,745 votes for Trump + Stillwater, Montana 4,462 votes for Trump - 1,156 votes for Biden - - - Sweet Grass, Montana + 1,156 votes for Biden + Sweet Grass, Montana 1,840 votes for Trump - 549 votes for Biden - - - Teton, Montana + 549 votes for Biden + Teton, Montana 2,608 votes for Trump - 1,007 votes for Biden - - - Toole, Montana + 1,007 votes for Biden + Toole, Montana 1,596 votes for Trump - 467 votes for Biden - - - Treasure, Montana + 467 votes for Biden + Treasure, Montana 373 votes for Trump - 78 votes for Biden - - - Valley, Montana + 78 votes for Biden + Valley, Montana 3,135 votes for Trump - 1,030 votes for Biden - - - Wheatland, Montana + 1,030 votes for Biden + Wheatland, Montana 823 votes for Trump - 225 votes for Biden - - - Wibaux, Montana + 225 votes for Biden + Wibaux, Montana 516 votes for Trump - 77 votes for Biden - - - Yellowstone, Montana + 77 votes for Biden + Yellowstone, Montana 50,772 votes for Trump - 30,679 votes for Biden - - - Allen, Kansas + 30,679 votes for Biden + Allen, Kansas 4,155 votes for Trump - 1,559 votes for Biden - - - Anderson, Kansas + 1,559 votes for Biden + Anderson, Kansas 2,874 votes for Trump - 765 votes for Biden - - - Atchison, Kansas + 765 votes for Biden + Atchison, Kansas 4,826 votes for Trump - 2,314 votes for Biden - - - Barber, Kansas + 2,314 votes for Biden + Barber, Kansas 1,992 votes for Trump - 284 votes for Biden - - - Barton, Kansas + 284 votes for Biden + Barton, Kansas 8,480 votes for Trump - 2,302 votes for Biden - - - Bourbon, Kansas + 2,302 votes for Biden + Bourbon, Kansas 4,910 votes for Trump - 1,505 votes for Biden - - - Brown, Kansas + 1,505 votes for Biden + Brown, Kansas 3,206 votes for Trump - 1,088 votes for Biden - - - Butler, Kansas + 1,088 votes for Biden + Butler, Kansas 22,250 votes for Trump - 9,003 votes for Biden - - - Chase, Kansas + 9,003 votes for Biden + Chase, Kansas 1,114 votes for Trump - 341 votes for Biden - - - Chautauqua, Kansas + 341 votes for Biden + Chautauqua, Kansas 1,397 votes for Trump - 212 votes for Biden - - - Cherokee, Kansas + 212 votes for Biden + Cherokee, Kansas 6,622 votes for Trump - 2,163 votes for Biden - - - Cheyenne, Kansas + 2,163 votes for Biden + Cheyenne, Kansas 1,158 votes for Trump - 220 votes for Biden - - - Clark, Kansas + 220 votes for Biden + Clark, Kansas 885 votes for Trump - 143 votes for Biden - - - Clay, Kansas + 143 votes for Biden + Clay, Kansas 3,129 votes for Trump - 883 votes for Biden - - - Cloud, Kansas + 883 votes for Biden + Cloud, Kansas 3,182 votes for Trump - 893 votes for Biden - - - Coffey, Kansas + 893 votes for Biden + Coffey, Kansas 3,407 votes for Trump - 928 votes for Biden - - - Comanche, Kansas + 928 votes for Biden + Comanche, Kansas 745 votes for Trump - 126 votes for Biden - - - Cowley, Kansas + 126 votes for Biden + Cowley, Kansas 9,442 votes for Trump - 4,171 votes for Biden - - - Crawford, Kansas + 4,171 votes for Biden + Crawford, Kansas 9,752 votes for Trump - 5,971 votes for Biden - - - Decatur, Kansas + 5,971 votes for Biden + Decatur, Kansas 1,232 votes for Trump - 208 votes for Biden - - - Dickinson, Kansas + 208 votes for Biden + Dickinson, Kansas 7,045 votes for Trump - 2,040 votes for Biden - - - Doniphan, Kansas + 2,040 votes for Biden + Doniphan, Kansas 2,949 votes for Trump - 678 votes for Biden - - - Douglas, Kansas + 678 votes for Biden + Douglas, Kansas 39,436 votes for Biden - 16,737 votes for Trump - - - Edwards, Kansas + 16,737 votes for Trump + Edwards, Kansas 1,127 votes for Trump - 267 votes for Biden - - - Elk, Kansas + 267 votes for Biden + Elk, Kansas 1,130 votes for Trump - 191 votes for Biden - - - Ellis, Kansas + 191 votes for Biden + Ellis, Kansas 9,569 votes for Trump - 3,633 votes for Biden - - - Ellsworth, Kansas + 3,633 votes for Biden + Ellsworth, Kansas 2,106 votes for Trump - 646 votes for Biden - - - Finney, Kansas + 646 votes for Biden + Finney, Kansas 7,079 votes for Trump - 4,155 votes for Biden - - - Ford, Kansas + 4,155 votes for Biden + Ford, Kansas 5,763 votes for Trump - 2,926 votes for Biden - - - Franklin, Kansas + 2,926 votes for Biden + Franklin, Kansas 8,326 votes for Trump - 3,623 votes for Biden - - - Geary, Kansas + 3,623 votes for Biden + Geary, Kansas 5,193 votes for Trump - 3,825 votes for Biden - - - Gove, Kansas + 3,825 votes for Biden + Gove, Kansas 1,256 votes for Trump - 163 votes for Biden - - - Graham, Kansas + 163 votes for Biden + Graham, Kansas 1,052 votes for Trump - 222 votes for Biden - - - Grant, Kansas + 222 votes for Biden + Grant, Kansas 1,910 votes for Trump - 497 votes for Biden - - - Gray, Kansas + 497 votes for Biden + Gray, Kansas 1,871 votes for Trump - 337 votes for Biden - - - Greeley, Kansas + 337 votes for Biden + Greeley, Kansas 537 votes for Trump - 77 votes for Biden - - - Greenwood, Kansas + 77 votes for Biden + Greenwood, Kansas 2,404 votes for Trump - 562 votes for Biden - - - Hamilton, Kansas + 562 votes for Biden + Hamilton, Kansas 684 votes for Trump - 134 votes for Biden - - - Harper, Kansas + 134 votes for Biden + Harper, Kansas 2,128 votes for Trump - 453 votes for Biden - - - Harvey, Kansas + 453 votes for Biden + Harvey, Kansas 10,015 votes for Trump - 6,652 votes for Biden - - - Haskell, Kansas + 6,652 votes for Biden + Haskell, Kansas 1,103 votes for Trump - 261 votes for Biden - - - Hodgeman, Kansas + 261 votes for Biden + Hodgeman, Kansas 866 votes for Trump - 151 votes for Biden - - - Jackson, Kansas + 151 votes for Biden + Jackson, Kansas 4,435 votes for Trump - 1,852 votes for Biden - - - Jefferson, Kansas + 1,852 votes for Biden + Jefferson, Kansas 6,193 votes for Trump - 3,106 votes for Biden - - - Jewell, Kansas + 3,106 votes for Biden + Jewell, Kansas 1,369 votes for Trump - 211 votes for Biden - - - Johnson, Kansas + 211 votes for Biden + Johnson, Kansas 177,925 votes for Biden - 151,280 votes for Trump - - - Kearny, Kansas + 151,280 votes for Trump + Kearny, Kansas 1,134 votes for Trump - 255 votes for Biden - - - Kingman, Kansas + 255 votes for Biden + Kingman, Kansas 3,102 votes for Trump - 745 votes for Biden - - - Kiowa, Kansas + 745 votes for Biden + Kiowa, Kansas 957 votes for Trump - 153 votes for Biden - - - Labette, Kansas + 153 votes for Biden + Labette, Kansas 5,639 votes for Trump - 2,607 votes for Biden - - - Lane, Kansas + 2,607 votes for Biden + Lane, Kansas 757 votes for Trump - 114 votes for Biden - - - Leavenworth, Kansas + 114 votes for Biden + Leavenworth, Kansas 21,378 votes for Trump - 13,753 votes for Biden - - - Lincoln, Kansas + 13,753 votes for Biden + Lincoln, Kansas 1,273 votes for Trump - 266 votes for Biden - - - Linn, Kansas + 266 votes for Biden + Linn, Kansas 3,940 votes for Trump - 863 votes for Biden - - - Logan, Kansas + 863 votes for Biden + Logan, Kansas 1,231 votes for Trump - 185 votes for Biden - - - Lyon, Kansas + 185 votes for Biden + Lyon, Kansas 7,381 votes for Trump - 5,878 votes for Biden - - - Marion, Kansas + 5,878 votes for Biden + Marion, Kansas 4,377 votes for Trump - 1,463 votes for Biden - - - Marshall, Kansas + 1,463 votes for Biden + Marshall, Kansas 3,662 votes for Trump - 1,239 votes for Biden - - - McPherson, Kansas + 1,239 votes for Biden + McPherson, Kansas 9,562 votes for Trump - 3,977 votes for Biden - - - Meade, Kansas + 3,977 votes for Biden + Meade, Kansas 1,508 votes for Trump - 261 votes for Biden - - - Miami, Kansas + 261 votes for Biden + Miami, Kansas 12,116 votes for Trump - 5,133 votes for Biden - - - Mitchell, Kansas + 5,133 votes for Biden + Mitchell, Kansas 2,454 votes for Trump - 547 votes for Biden - - - Montgomery, Kansas + 547 votes for Biden + Montgomery, Kansas 9,768 votes for Trump - 3,147 votes for Biden - - - Morris, Kansas + 3,147 votes for Biden + Morris, Kansas 2,085 votes for Trump - 721 votes for Biden - - - Morton, Kansas + 721 votes for Biden + Morton, Kansas 1,004 votes for Trump - 147 votes for Biden - - - Nemaha, Kansas + 147 votes for Biden + Nemaha, Kansas 4,612 votes for Trump - 920 votes for Biden - - - Neosho, Kansas + 920 votes for Biden + Neosho, Kansas 4,795 votes for Trump - 1,727 votes for Biden - - - Ness, Kansas + 1,727 votes for Biden + Ness, Kansas 1,315 votes for Trump - 147 votes for Biden - - - Norton, Kansas + 147 votes for Biden + Norton, Kansas 1,977 votes for Trump - 361 votes for Biden - - - Osage, Kansas + 361 votes for Biden + Osage, Kansas 5,591 votes for Trump - 2,099 votes for Biden - - - Osborne, Kansas + 2,099 votes for Biden + Osborne, Kansas 1,590 votes for Trump - 275 votes for Biden - - - Ottawa, Kansas + 275 votes for Biden + Ottawa, Kansas 2,581 votes for Trump - 504 votes for Biden - - - Pawnee, Kansas + 504 votes for Biden + Pawnee, Kansas 2,028 votes for Trump - 635 votes for Biden - - - Phillips, Kansas + 635 votes for Biden + Phillips, Kansas 2,855 votes for Trump - 373 votes for Biden - - - Pottawatomie, Kansas + 373 votes for Biden + Pottawatomie, Kansas 9,247 votes for Trump - 3,257 votes for Biden - - - Pratt, Kansas + 3,257 votes for Biden + Pratt, Kansas 3,087 votes for Trump - 924 votes for Biden - - - Rawlins, Kansas + 924 votes for Biden + Rawlins, Kansas 1,253 votes for Trump - 214 votes for Biden - - - Reno, Kansas + 214 votes for Biden + Reno, Kansas 17,948 votes for Trump - 8,602 votes for Biden - - - Republic, Kansas + 8,602 votes for Biden + Republic, Kansas 2,172 votes for Trump - 420 votes for Biden - - - Rice, Kansas + 420 votes for Biden + Rice, Kansas 3,187 votes for Trump - 953 votes for Biden - - - Riley, Kansas + 953 votes for Biden + Riley, Kansas 11,940 votes for Biden - 11,174 votes for Trump - - - Rooks, Kansas + 11,174 votes for Trump + Rooks, Kansas 2,294 votes for Trump - 332 votes for Biden - - - Rush, Kansas + 332 votes for Biden + Rush, Kansas 1,425 votes for Trump - 291 votes for Biden - - - Russell, Kansas + 291 votes for Biden + Russell, Kansas 2,765 votes for Trump - 591 votes for Biden - - - Saline, Kansas + 591 votes for Biden + Saline, Kansas 15,313 votes for Trump - 8,022 votes for Biden - - - Scott, Kansas + 8,022 votes for Biden + Scott, Kansas 1,991 votes for Trump - 290 votes for Biden - - - Sedgwick, Kansas + 290 votes for Biden + Sedgwick, Kansas 117,653 votes for Trump - 90,820 votes for Biden - - - Seward, Kansas + 90,820 votes for Biden + Seward, Kansas 3,285 votes for Trump - 1,736 votes for Biden - - - Shawnee, Kansas + 1,736 votes for Biden + Shawnee, Kansas 42,032 votes for Biden - 39,890 votes for Trump - - - Sheridan, Kansas + 39,890 votes for Trump + Sheridan, Kansas 1,237 votes for Trump - 144 votes for Biden - - - Sherman, Kansas + 144 votes for Biden + Sherman, Kansas 2,222 votes for Trump - 386 votes for Biden - - - Smith, Kansas + 386 votes for Biden + Smith, Kansas 1,734 votes for Trump - 328 votes for Biden - - - Stafford, Kansas + 328 votes for Biden + Stafford, Kansas 1,631 votes for Trump - 355 votes for Biden - - - Stanton, Kansas + 355 votes for Biden + Stanton, Kansas 607 votes for Trump - 147 votes for Biden - - - Stevens, Kansas + 147 votes for Biden + Stevens, Kansas 1,731 votes for Trump - 233 votes for Biden - - - Sumner, Kansas + 233 votes for Biden + Sumner, Kansas 7,998 votes for Trump - 2,551 votes for Biden - - - Thomas, Kansas + 2,551 votes for Biden + Thomas, Kansas 3,106 votes for Trump - 622 votes for Biden - - - Trego, Kansas + 622 votes for Biden + Trego, Kansas 1,341 votes for Trump - 238 votes for Biden - - - Wabaunsee, Kansas + 238 votes for Biden + Wabaunsee, Kansas 2,813 votes for Trump - 956 votes for Biden - - - Wallace, Kansas + 956 votes for Biden + Wallace, Kansas 762 votes for Trump - 44 votes for Biden - - - Washington, Kansas + 44 votes for Biden + Washington, Kansas 2,332 votes for Trump - 467 votes for Biden - - - Wichita, Kansas + 467 votes for Biden + Wichita, Kansas 803 votes for Trump - 147 votes for Biden - - - Wilson, Kansas + 147 votes for Biden + Wilson, Kansas 3,111 votes for Trump - 711 votes for Biden - - - Woodson, Kansas + 711 votes for Biden + Woodson, Kansas 1,189 votes for Trump - 283 votes for Biden - - - Wyandotte, Kansas + 283 votes for Biden + Wyandotte, Kansas 35,566 votes for Biden - 18,512 votes for Trump - - - Baker, Oregon + 18,512 votes for Trump + Baker, Oregon 7,316 votes for Trump - 2,332 votes for Biden - - - Benton, Oregon + 2,332 votes for Biden + Benton, Oregon 35,780 votes for Biden - 14,853 votes for Trump - - - Clackamas, Oregon + 14,853 votes for Trump + Clackamas, Oregon 139,015 votes for Biden - 110,476 votes for Trump - - - Clatsop, Oregon + 110,476 votes for Trump + Clatsop, Oregon 12,896 votes for Biden - 10,205 votes for Trump - - - Columbia, Oregon + 10,205 votes for Trump + Columbia, Oregon 16,779 votes for Trump - 13,535 votes for Biden - - - Coos, Oregon + 13,535 votes for Biden + Coos, Oregon 21,488 votes for Trump - 14,024 votes for Biden - - - Crook, Oregon + 14,024 votes for Biden + Crook, Oregon 11,103 votes for Trump - 3,715 votes for Biden - - - Curry, Oregon + 3,715 votes for Biden + Curry, Oregon 8,481 votes for Trump - 6,056 votes for Biden - - - Deschutes, Oregon + 6,056 votes for Biden + Deschutes, Oregon 64,102 votes for Biden - 54,183 votes for Trump - - - Douglas, Oregon + 54,183 votes for Trump + Douglas, Oregon 42,513 votes for Trump - 18,780 votes for Biden - - - Gilliam, Oregon + 18,780 votes for Biden + Gilliam, Oregon 834 votes for Trump - 324 votes for Biden - - - Grant, Oregon + 324 votes for Biden + Grant, Oregon 3,544 votes for Trump - 928 votes for Biden - - - Harney, Oregon + 928 votes for Biden + Harney, Oregon 3,475 votes for Trump - 894 votes for Biden - - - Hood River, Oregon + 894 votes for Biden + Hood River, Oregon 8,764 votes for Biden - 3,955 votes for Trump - - - Jackson, Oregon + 3,955 votes for Trump + Jackson, Oregon 63,814 votes for Trump - 59,442 votes for Biden - - - Jefferson, Oregon + 59,442 votes for Biden + Jefferson, Oregon 7,044 votes for Trump - 4,306 votes for Biden - - - Josephine, Oregon + 4,306 votes for Biden + Josephine, Oregon 31,732 votes for Trump - 18,430 votes for Biden - - - Klamath, Oregon + 18,430 votes for Biden + Klamath, Oregon 25,048 votes for Trump - 10,260 votes for Biden - - - Lake, Oregon + 10,260 votes for Biden + Lake, Oregon 3,470 votes for Trump - 792 votes for Biden - - - Lane, Oregon + 792 votes for Biden + Lane, Oregon 133,924 votes for Biden - 80,144 votes for Trump - - - Lincoln, Oregon + 80,144 votes for Trump + Lincoln, Oregon 17,248 votes for Biden - 12,336 votes for Trump - - - Linn, Oregon + 12,336 votes for Trump + Linn, Oregon 43,486 votes for Trump - 26,512 votes for Biden - - - Malheur, Oregon + 26,512 votes for Biden + Malheur, Oregon 8,101 votes for Trump - 3,202 votes for Biden - - - Marion, Oregon + 3,202 votes for Biden + Marion, Oregon 80,138 votes for Biden - 78,424 votes for Trump - - - Morrow, Oregon + 78,424 votes for Trump + Morrow, Oregon 3,586 votes for Trump - 1,371 votes for Biden - - - Multnomah, Oregon + 1,371 votes for Biden + Multnomah, Oregon 366,129 votes for Biden - 82,583 votes for Trump - - - Polk, Oregon + 82,583 votes for Trump + Polk, Oregon 23,732 votes for Trump - 22,917 votes for Biden - - - Sherman, Oregon + 22,917 votes for Biden + Sherman, Oregon 921 votes for Trump - 260 votes for Biden - - - Tillamook, Oregon + 260 votes for Biden + Tillamook, Oregon 8,306 votes for Trump - 7,956 votes for Biden - - - Umatilla, Oregon + 7,956 votes for Biden + Umatilla, Oregon 21,002 votes for Trump - 10,499 votes for Biden - - - Union, Oregon + 10,499 votes for Biden + Union, Oregon 10,298 votes for Trump - 4,254 votes for Biden - - - Wallowa, Oregon + 4,254 votes for Biden + Wallowa, Oregon 3,404 votes for Trump - 1,625 votes for Biden - - - Wasco, Oregon + 1,625 votes for Biden + Wasco, Oregon 6,965 votes for Trump - 6,467 votes for Biden - - - Washington, Oregon + 6,467 votes for Biden + Washington, Oregon 209,549 votes for Biden - 98,916 votes for Trump - - - Wheeler, Oregon + 98,916 votes for Trump + Wheeler, Oregon 711 votes for Trump - 217 votes for Biden - - - Yamhill, Oregon + 217 votes for Biden + Yamhill, Oregon 29,500 votes for Trump - 27,123 votes for Biden - - - Apache, Arizona + 27,123 votes for Biden + Apache, Arizona 23,293 votes for Biden - 11,442 votes for Trump - - - Cochise, Arizona + 11,442 votes for Trump + Cochise, Arizona 35,557 votes for Trump - 23,732 votes for Biden - - - Coconino, Arizona + 23,732 votes for Biden + Coconino, Arizona 44,698 votes for Biden - 27,052 votes for Trump - - - Gila, Arizona + 27,052 votes for Trump + Gila, Arizona 18,377 votes for Trump - 8,943 votes for Biden - - - Graham, Arizona + 8,943 votes for Biden + Graham, Arizona 10,749 votes for Trump - 4,034 votes for Biden - - - Greenlee, Arizona + 4,034 votes for Biden + Greenlee, Arizona 2,433 votes for Trump - 1,182 votes for Biden - - - La Paz, Arizona + 1,182 votes for Biden + La Paz, Arizona 5,129 votes for Trump - 2,236 votes for Biden - - - Maricopa, Arizona + 2,236 votes for Biden + Maricopa, Arizona 1,040,774 votes for Biden - 995,665 votes for Trump - - - Mohave, Arizona + 995,665 votes for Trump + Mohave, Arizona 78,535 votes for Trump - 24,831 votes for Biden - - - Navajo, Arizona + 24,831 votes for Biden + Navajo, Arizona 27,657 votes for Trump - 23,383 votes for Biden - - - Pima, Arizona + 23,383 votes for Biden + Pima, Arizona 304,981 votes for Biden - 207,758 votes for Trump - - - Pinal, Arizona + 207,758 votes for Trump + Pinal, Arizona 107,077 votes for Trump - 75,106 votes for Biden - - - Santa Cruz, Arizona + 75,106 votes for Biden + Santa Cruz, Arizona 13,138 votes for Biden - 6,194 votes for Trump - - - Yavapai, Arizona + 6,194 votes for Trump + Yavapai, Arizona 91,527 votes for Trump - 49,602 votes for Biden - - - Yuma, Arizona + 49,602 votes for Biden + Yuma, Arizona 36,534 votes for Trump - 32,210 votes for Biden - - - Autauga, Alabama + 32,210 votes for Biden + Autauga, Alabama 19,764 votes for Trump - 7,450 votes for Biden - - - Baldwin, Alabama + 7,450 votes for Biden + Baldwin, Alabama 83,055 votes for Trump - 24,344 votes for Biden - - - Barbour, Alabama + 24,344 votes for Biden + Barbour, Alabama 5,605 votes for Trump - 4,772 votes for Biden - - - Bibb, Alabama + 4,772 votes for Biden + Bibb, Alabama 7,508 votes for Trump - 1,982 votes for Biden - - - Blount, Alabama + 1,982 votes for Biden + Blount, Alabama 24,595 votes for Trump - 2,627 votes for Biden - - - Bullock, Alabama + 2,627 votes for Biden + Bullock, Alabama 3,439 votes for Biden - 1,143 votes for Trump - - - Butler, Alabama + 1,143 votes for Trump + Butler, Alabama 5,448 votes for Trump - 3,953 votes for Biden - - - Calhoun, Alabama + 3,953 votes for Biden + Calhoun, Alabama 34,964 votes for Trump - 15,118 votes for Biden - - - Chambers, Alabama + 15,118 votes for Biden + Chambers, Alabama 8,748 votes for Trump - 6,356 votes for Biden - - - Cherokee, Alabama + 6,356 votes for Biden + Cherokee, Alabama 10,562 votes for Trump - 1,619 votes for Biden - - - Chilton, Alabama + 1,619 votes for Biden + Chilton, Alabama 16,052 votes for Trump - 3,056 votes for Biden - - - Choctaw, Alabama + 3,056 votes for Biden + Choctaw, Alabama 4,294 votes for Trump - 3,126 votes for Biden - - - Clarke, Alabama + 3,126 votes for Biden + Clarke, Alabama 7,310 votes for Trump - 5,730 votes for Biden - - - Clay, Alabama + 5,730 votes for Biden + Clay, Alabama 5,589 votes for Trump - 1,262 votes for Biden - - - Cleburne, Alabama + 1,262 votes for Biden + Cleburne, Alabama 6,472 votes for Trump - 672 votes for Biden - - - Coffee, Alabama + 672 votes for Biden + Coffee, Alabama 16,832 votes for Trump - 5,050 votes for Biden - - - Colbert, Alabama + 5,050 votes for Biden + Colbert, Alabama 17,311 votes for Trump - 7,057 votes for Biden - - - Conecuh, Alabama + 7,057 votes for Biden + Conecuh, Alabama 3,435 votes for Trump - 2,951 votes for Biden - - - Coosa, Alabama + 2,951 votes for Biden + Coosa, Alabama 3,626 votes for Trump - 1,794 votes for Biden - - - Covington, Alabama + 1,794 votes for Biden + Covington, Alabama 14,579 votes for Trump - 2,717 votes for Biden - - - Crenshaw, Alabama + 2,717 votes for Biden + Crenshaw, Alabama 4,864 votes for Trump - 1,700 votes for Biden - - - Cullman, Alabama + 1,700 votes for Biden + Cullman, Alabama 36,804 votes for Trump - 4,454 votes for Biden - - - Dale, Alabama + 4,454 votes for Biden + Dale, Alabama 14,281 votes for Trump - 5,154 votes for Biden - - - Dallas, Alabama + 5,154 votes for Biden + Dallas, Alabama 12,228 votes for Biden - 5,523 votes for Trump - - - DeKalb, Alabama + 5,523 votes for Trump + DeKalb, Alabama 24,744 votes for Trump - 4,271 votes for Biden - - - Elmore, Alabama + 4,271 votes for Biden + Elmore, Alabama 30,089 votes for Trump - 10,304 votes for Biden - - - Escambia, Alabama + 10,304 votes for Biden + Escambia, Alabama 10,844 votes for Trump - 4,894 votes for Biden - - - Etowah, Alabama + 4,894 votes for Biden + Etowah, Alabama 35,343 votes for Trump - 11,487 votes for Biden - - - Fayette, Alabama + 11,487 votes for Biden + Fayette, Alabama 7,295 votes for Trump - 1,390 votes for Biden - - - Franklin, Alabama + 1,390 votes for Biden + Franklin, Alabama 10,364 votes for Trump - 2,085 votes for Biden - - - Geneva, Alabama + 2,085 votes for Biden + Geneva, Alabama 10,844 votes for Trump - 1,592 votes for Biden - - - Greene, Alabama + 1,592 votes for Biden + Greene, Alabama 3,880 votes for Biden - 875 votes for Trump - - - Hale, Alabama + 875 votes for Trump + Hale, Alabama 4,687 votes for Biden - 3,190 votes for Trump - - - Henry, Alabama + 3,190 votes for Trump + Henry, Alabama 6,593 votes for Trump - 2,589 votes for Biden - - - Houston, Alabama + 2,589 votes for Biden + Houston, Alabama 32,384 votes for Trump - 12,738 votes for Biden - - - Jackson, Alabama + 12,738 votes for Biden + Jackson, Alabama 19,644 votes for Trump - 3,709 votes for Biden - - - Jefferson, Alabama + 3,709 votes for Biden + Jefferson, Alabama 180,936 votes for Biden - 138,443 votes for Trump - - - Lamar, Alabama + 138,443 votes for Trump + Lamar, Alabama 6,168 votes for Trump - 978 votes for Biden - - - Lauderdale, Alabama + 978 votes for Biden + Lauderdale, Alabama 31,578 votes for Trump - 11,872 votes for Biden - - - Lawrence, Alabama + 11,872 votes for Biden + Lawrence, Alabama 12,266 votes for Trump - 3,544 votes for Biden - - - Lee, Alabama + 3,544 votes for Biden + Lee, Alabama 42,019 votes for Trump - 27,600 votes for Biden - - - Limestone, Alabama + 27,600 votes for Biden + Limestone, Alabama 34,337 votes for Trump - 13,510 votes for Biden - - - Lowndes, Alabama + 13,510 votes for Biden + Lowndes, Alabama 4,968 votes for Biden - 1,835 votes for Trump - - - Macon, Alabama + 1,835 votes for Trump + Macon, Alabama 7,084 votes for Biden - 1,539 votes for Trump - - - Madison, Alabama + 1,539 votes for Trump + Madison, Alabama 102,395 votes for Trump - 86,885 votes for Biden - - - Marengo, Alabama + 86,885 votes for Biden + Marengo, Alabama 5,476 votes for Biden - 5,337 votes for Trump - - - Marion, Alabama + 5,337 votes for Trump + Marion, Alabama 12,190 votes for Trump - 1,457 votes for Biden - - - Marshall, Alabama + 1,457 votes for Biden + Marshall, Alabama 33,094 votes for Trump - 5,880 votes for Biden - - - Mobile, Alabama + 5,880 votes for Biden + Mobile, Alabama 100,605 votes for Trump - 78,754 votes for Biden - - - Monroe, Alabama + 78,754 votes for Biden + Monroe, Alabama 6,129 votes for Trump - 4,425 votes for Biden - - - Montgomery, Alabama + 4,425 votes for Biden + Montgomery, Alabama 64,065 votes for Biden - 33,122 votes for Trump - - - Morgan, Alabama + 33,122 votes for Trump + Morgan, Alabama 39,504 votes for Trump - 13,159 votes for Biden - - - Perry, Alabama + 13,159 votes for Biden + Perry, Alabama 3,849 votes for Biden - 1,336 votes for Trump - - - Pickens, Alabama + 1,336 votes for Trump + Pickens, Alabama 5,590 votes for Trump - 4,017 votes for Biden - - - Pike, Alabama + 4,017 votes for Biden + Pike, Alabama 8,020 votes for Trump - 5,613 votes for Biden - - - Randolph, Alabama + 5,613 votes for Biden + Randolph, Alabama 8,548 votes for Trump - 2,203 votes for Biden - - - Russell, Alabama + 2,203 votes for Biden + Russell, Alabama 11,078 votes for Biden - 9,796 votes for Trump - - - Shelby, Alabama + 9,796 votes for Trump + Shelby, Alabama 79,428 votes for Trump - 33,036 votes for Biden - - - St. Clair, Alabama + 33,036 votes for Biden + St. Clair, Alabama 36,119 votes for Trump - 7,698 votes for Biden - - - Sumter, Alabama + 7,698 votes for Biden + Sumter, Alabama 4,639 votes for Biden - 1,598 votes for Trump - - - Talladega, Alabama + 1,598 votes for Trump + Talladega, Alabama 22,210 votes for Trump - 13,092 votes for Biden - - - Tallapoosa, Alabama + 13,092 votes for Biden + Tallapoosa, Alabama 14,905 votes for Trump - 5,815 votes for Biden - - - Tuscaloosa, Alabama + 5,815 votes for Biden + Tuscaloosa, Alabama 50,961 votes for Trump - 37,514 votes for Biden - - - Walker, Alabama + 37,514 votes for Biden + Walker, Alabama 25,947 votes for Trump - 4,826 votes for Biden - - - Washington, Alabama + 4,826 votes for Biden + Washington, Alabama 6,554 votes for Trump - 2,253 votes for Biden - - - Wilcox, Alabama + 2,253 votes for Biden + Wilcox, Alabama 4,036 votes for Biden - 1,826 votes for Trump - - - Winston, Alabama + 1,826 votes for Trump + Winston, Alabama 10,187 votes for Trump - 974 votes for Biden - - - Atlantic, New Jersey + 974 votes for Biden + Atlantic, New Jersey 73,289 votes for Biden - 64,054 votes for Trump - - - Bergen, New Jersey + 64,054 votes for Trump + Bergen, New Jersey 285,811 votes for Biden - 204,277 votes for Trump - - - Burlington, New Jersey + 204,277 votes for Trump + Burlington, New Jersey 145,987 votes for Biden - 96,583 votes for Trump - - - Camden, New Jersey + 96,583 votes for Trump + Camden, New Jersey 174,575 votes for Biden - 86,024 votes for Trump - - - Cape May, New Jersey + 86,024 votes for Trump + Cape May, New Jersey 33,005 votes for Trump - 23,837 votes for Biden - - - Cumberland, New Jersey + 23,837 votes for Biden + Cumberland, New Jersey 32,689 votes for Biden - 28,904 votes for Trump - - - Essex, New Jersey + 28,904 votes for Trump + Essex, New Jersey 237,981 votes for Biden - 68,038 votes for Trump - - - Gloucester, New Jersey + 68,038 votes for Trump + Gloucester, New Jersey 86,702 votes for Biden - 83,340 votes for Trump - - - Hudson, New Jersey + 83,340 votes for Trump + Hudson, New Jersey 181,452 votes for Biden - 65,698 votes for Trump - - - Hunterdon, New Jersey + 65,698 votes for Trump + Hunterdon, New Jersey 42,203 votes for Trump - 38,658 votes for Biden - - - Mercer, New Jersey + 38,658 votes for Biden + Mercer, New Jersey 112,845 votes for Biden - 47,788 votes for Trump - - - Middlesex, New Jersey + 47,788 votes for Trump + Middlesex, New Jersey 208,902 votes for Biden - 130,801 votes for Trump - - - Monmouth, New Jersey + 130,801 votes for Trump + Monmouth, New Jersey 189,359 votes for Trump - 179,245 votes for Biden - - - Morris, New Jersey + 179,245 votes for Biden + Morris, New Jersey 151,948 votes for Biden - 139,057 votes for Trump - - - Ocean, New Jersey + 139,057 votes for Trump + Ocean, New Jersey 203,613 votes for Trump - 113,359 votes for Biden - - - Passaic, New Jersey + 113,359 votes for Biden + Passaic, New Jersey 118,112 votes for Biden - 84,873 votes for Trump - - - Salem, New Jersey + 84,873 votes for Trump + Salem, New Jersey 18,042 votes for Trump - 13,722 votes for Biden - - - Somerset, New Jersey + 13,722 votes for Biden + Somerset, New Jersey 103,875 votes for Biden - 67,335 votes for Trump - - - Sussex, New Jersey + 67,335 votes for Trump + Sussex, New Jersey 51,566 votes for Trump - 34,417 votes for Biden - - - Union, New Jersey + 34,417 votes for Biden + Union, New Jersey 170,240 votes for Biden - 80,000 votes for Trump - - - Warren, New Jersey + 80,000 votes for Trump + Warren, New Jersey 32,998 votes for Trump - 23,861 votes for Biden - - - Hawaii, Hawaii + 23,861 votes for Biden + Hawaii, Hawaii 58,683 votes for Biden - 26,851 votes for Trump - - - Honolulu, Hawaii + 26,851 votes for Trump + Honolulu, Hawaii 238,869 votes for Biden - 136,259 votes for Trump - - - Kauai, Hawaii + 136,259 votes for Trump + Kauai, Hawaii 21,217 votes for Biden - 11,579 votes for Trump - - - Maui, Hawaii + 11,579 votes for Trump + Maui, Hawaii 47,301 votes for Biden - 22,111 votes for Trump - - - Barnstable, Massachusetts + 22,111 votes for Trump + Barnstable, Massachusetts 90,617 votes for Biden - 54,759 votes for Trump - - - Berkshire, Massachusetts + 54,759 votes for Trump + Berkshire, Massachusetts 50,864 votes for Biden - 17,713 votes for Trump - - - Bristol, Massachusetts + 17,713 votes for Trump + Bristol, Massachusetts 150,063 votes for Biden - 118,085 votes for Trump - - - Dukes, Massachusetts + 118,085 votes for Trump + Dukes, Massachusetts 9,763 votes for Biden - 2,588 votes for Trump - - - Essex, Massachusetts + 2,588 votes for Trump + Essex, Massachusetts 262,332 votes for Biden - 142,822 votes for Trump - - - Franklin, Massachusetts + 142,822 votes for Trump + Franklin, Massachusetts 29,048 votes for Biden - 10,875 votes for Trump - - - Hampden, Massachusetts + 10,875 votes for Trump + Hampden, Massachusetts 123,985 votes for Biden - 85,879 votes for Trump - - - Hampshire, Massachusetts + 85,879 votes for Trump + Hampshire, Massachusetts 61,555 votes for Biden - 21,807 votes for Trump - - - Middlesex, Massachusetts + 21,807 votes for Trump + Middlesex, Massachusetts 599,370 votes for Biden - 223,374 votes for Trump - - - Nantucket, Massachusetts + 223,374 votes for Trump + Nantucket, Massachusetts 5,234 votes for Biden - 1,912 votes for Trump - - - Norfolk, Massachusetts + 1,912 votes for Trump + Norfolk, Massachusetts 268,378 votes for Biden - 123,839 votes for Trump - - - Plymouth, Massachusetts + 123,839 votes for Trump + Plymouth, Massachusetts 171,347 votes for Biden - 120,192 votes for Trump - - - Suffolk, Massachusetts + 120,192 votes for Trump + Suffolk, Massachusetts 252,661 votes for Biden - 55,699 votes for Trump - - - Worcester, Massachusetts + 55,699 votes for Trump + Worcester, Massachusetts 243,957 votes for Biden - 169,758 votes for Trump - - - Carson City, Nevada + 169,758 votes for Trump + Carson City, Nevada 16,113 votes for Trump - 12,735 votes for Biden - - - Churchill, Nevada + 12,735 votes for Biden + Churchill, Nevada 9,372 votes for Trump - 3,051 votes for Biden - - - Clark, Nevada + 3,051 votes for Biden + Clark, Nevada 521,852 votes for Biden - 430,930 votes for Trump - - - Douglas, Nevada + 430,930 votes for Trump + Douglas, Nevada 21,630 votes for Trump - 11,571 votes for Biden - - - Elko, Nevada + 11,571 votes for Biden + Elko, Nevada 16,741 votes for Trump - 4,557 votes for Biden - - - Esmeralda, Nevada + 4,557 votes for Biden + Esmeralda, Nevada 400 votes for Trump - 74 votes for Biden - - - Eureka, Nevada + 74 votes for Biden + Eureka, Nevada 895 votes for Trump - 105 votes for Biden - - - Humboldt, Nevada + 105 votes for Biden + Humboldt, Nevada 5,877 votes for Trump - 1,689 votes for Biden - - - Lander, Nevada + 1,689 votes for Biden + Lander, Nevada 2,198 votes for Trump - 496 votes for Biden - - - Lincoln, Nevada + 496 votes for Biden + Lincoln, Nevada 2,067 votes for Trump - 330 votes for Biden - - - Lyon, Nevada + 330 votes for Biden + Lyon, Nevada 20,914 votes for Trump - 8,473 votes for Biden - - - Mineral, Nevada + 8,473 votes for Biden + Mineral, Nevada 1,423 votes for Trump - 829 votes for Biden - - - Nye, Nevada + 829 votes for Biden + Nye, Nevada 17,528 votes for Trump - 7,288 votes for Biden - - - Pershing, Nevada + 7,288 votes for Biden + Pershing, Nevada 1,731 votes for Trump - 547 votes for Biden - - - Storey, Nevada + 547 votes for Biden + Storey, Nevada 1,908 votes for Trump - 902 votes for Biden - - - Washoe, Nevada + 902 votes for Biden + Washoe, Nevada 128,128 votes for Biden - 116,760 votes for Trump - - - White Pine, Nevada + 116,760 votes for Trump + White Pine, Nevada 3,403 votes for Trump - 859 votes for Biden - - - Bernalillo, New Mexico + 859 votes for Biden + Bernalillo, New Mexico 193,756 votes for Biden - 116,135 votes for Trump - - - Catron, New Mexico + 116,135 votes for Trump + Catron, New Mexico 1,698 votes for Trump - 595 votes for Biden - - - Chaves, New Mexico + 595 votes for Biden + Chaves, New Mexico 15,656 votes for Trump - 6,381 votes for Biden - - - Cibola, New Mexico + 6,381 votes for Biden + Cibola, New Mexico 4,745 votes for Biden - 3,975 votes for Trump - - - Colfax, New Mexico + 3,975 votes for Trump + Colfax, New Mexico 3,271 votes for Trump - 2,611 votes for Biden - - - Curry, New Mexico + 2,611 votes for Biden + Curry, New Mexico 10,444 votes for Trump - 4,307 votes for Biden - - - DeBaca, New Mexico + 4,307 votes for Biden + DeBaca, New Mexico 656 votes for Trump - 231 votes for Biden - - - Dona Ana, New Mexico + 231 votes for Biden + Dona Ana, New Mexico 47,958 votes for Biden - 32,800 votes for Trump - - - Eddy, New Mexico + 32,800 votes for Trump + Eddy, New Mexico 17,454 votes for Trump - 5,424 votes for Biden - - - Grant, New Mexico + 5,424 votes for Biden + Grant, New Mexico 7,590 votes for Biden - 6,553 votes for Trump - - - Guadalupe, New Mexico + 6,553 votes for Trump + Guadalupe, New Mexico 1,234 votes for Biden - 917 votes for Trump - - - Harding, New Mexico + 917 votes for Trump + Harding, New Mexico 319 votes for Trump - 179 votes for Biden - - - Hidalgo, New Mexico + 179 votes for Biden + Hidalgo, New Mexico 1,117 votes for Trump - 821 votes for Biden - - - Lea, New Mexico + 821 votes for Biden + Lea, New Mexico 16,531 votes for Trump - 4,061 votes for Biden - - - Lincoln, New Mexico + 4,061 votes for Biden + Lincoln, New Mexico 6,942 votes for Trump - 3,194 votes for Biden - - - Los Alamos, New Mexico + 3,194 votes for Biden + Los Alamos, New Mexico 7,554 votes for Biden - 4,278 votes for Trump - - - Luna, New Mexico + 4,278 votes for Trump + Luna, New Mexico 4,407 votes for Trump - 3,565 votes for Biden - - - McKinley, New Mexico + 3,565 votes for Biden + McKinley, New Mexico 17,969 votes for Biden - 7,782 votes for Trump - - - Mora, New Mexico + 7,782 votes for Trump + Mora, New Mexico 1,744 votes for Biden - 902 votes for Trump - - - Otero, New Mexico + 902 votes for Trump + Otero, New Mexico 14,521 votes for Trump - 8,485 votes for Biden - - - Quay, New Mexico + 8,485 votes for Biden + Quay, New Mexico 2,634 votes for Trump - 1,170 votes for Biden - - - Rio Arriba, New Mexico + 1,170 votes for Biden + Rio Arriba, New Mexico 10,990 votes for Biden - 5,408 votes for Trump - - - Roosevelt, New Mexico + 5,408 votes for Trump + Roosevelt, New Mexico 4,634 votes for Trump - 1,802 votes for Biden - - - San Juan, New Mexico + 1,802 votes for Biden + San Juan, New Mexico 32,874 votes for Trump - 18,081 votes for Biden - - - San Miguel, New Mexico + 18,081 votes for Biden + San Miguel, New Mexico 7,888 votes for Biden - 3,421 votes for Trump - - - Sandoval, New Mexico + 3,421 votes for Trump + Sandoval, New Mexico 40,588 votes for Biden - 34,174 votes for Trump - - - Santa Fe, New Mexico + 34,174 votes for Trump + Santa Fe, New Mexico 62,530 votes for Biden - 18,329 votes for Trump - - - Sierra, New Mexico + 18,329 votes for Trump + Sierra, New Mexico 3,542 votes for Trump - 2,265 votes for Biden - - - Socorro, New Mexico + 2,265 votes for Biden + Socorro, New Mexico 3,722 votes for Biden - 3,255 votes for Trump - - - Taos, New Mexico + 3,255 votes for Trump + Taos, New Mexico 13,030 votes for Biden - 3,663 votes for Trump - - - Torrance, New Mexico + 3,663 votes for Trump + Torrance, New Mexico 4,772 votes for Trump - 2,344 votes for Biden - - - Union, New Mexico + 2,344 votes for Biden + Union, New Mexico 1,388 votes for Trump - 383 votes for Biden - - - Valencia, New Mexico + 383 votes for Biden + Valencia, New Mexico 17,363 votes for Trump - 14,263 votes for Biden - - - Adams, Colorado + 14,263 votes for Biden + Adams, Colorado 134,202 votes for Biden - 95,657 votes for Trump - - - Alamosa, Colorado + 95,657 votes for Trump + Alamosa, Colorado 3,813 votes for Trump - 3,759 votes for Biden - - - Arapahoe, Colorado + 3,759 votes for Biden + Arapahoe, Colorado 213,673 votes for Biden - 127,356 votes for Trump - - - Archuleta, Colorado + 127,356 votes for Trump + Archuleta, Colorado 5,189 votes for Trump - 3,738 votes for Biden - - - Baca, Colorado + 3,738 votes for Biden + Baca, Colorado 1,866 votes for Trump - 317 votes for Biden - - - Bent, Colorado + 317 votes for Biden + Bent, Colorado 1,503 votes for Trump - 732 votes for Biden - - - Boulder, Colorado + 732 votes for Biden + Boulder, Colorado 159,089 votes for Biden - 42,501 votes for Trump - - - Broomfield, Colorado + 42,501 votes for Trump + Broomfield, Colorado 29,077 votes for Biden - 16,295 votes for Trump - - - Chaffee, Colorado + 16,295 votes for Trump + Chaffee, Colorado 7,160 votes for Biden - 6,222 votes for Trump - - - Cheyenne, Colorado + 6,222 votes for Trump + Cheyenne, Colorado 993 votes for Trump - 131 votes for Biden - - - Clear Creek, Colorado + 131 votes for Biden + Clear Creek, Colorado 3,603 votes for Biden - 2,753 votes for Trump - - - Conejos, Colorado + 2,753 votes for Trump + Conejos, Colorado 2,286 votes for Trump - 1,959 votes for Biden - - - Costilla, Colorado + 1,959 votes for Biden + Costilla, Colorado 1,311 votes for Biden - 741 votes for Trump - - - Crowley, Colorado + 741 votes for Trump + Crowley, Colorado 1,271 votes for Trump - 437 votes for Biden - - - Custer, Colorado + 437 votes for Biden + Custer, Colorado 2,471 votes for Trump - 1,111 votes for Biden - - - Delta, Colorado + 1,111 votes for Biden + Delta, Colorado 13,081 votes for Trump - 5,887 votes for Biden - - - Denver, Colorado + 5,887 votes for Biden + Denver, Colorado 313,292 votes for Biden - 71,617 votes for Trump - - - Dolores, Colorado + 71,617 votes for Trump + Dolores, Colorado 1,089 votes for Trump - 341 votes for Biden - - - Douglas, Colorado + 341 votes for Biden + Douglas, Colorado 121,270 votes for Trump - 104,653 votes for Biden - - - Eagle, Colorado + 104,653 votes for Biden + Eagle, Colorado 18,588 votes for Biden - 9,891 votes for Trump - - - El Paso, Colorado + 9,891 votes for Trump + El Paso, Colorado 202,560 votes for Trump - 161,636 votes for Biden - - - Elbert, Colorado + 161,636 votes for Biden + Elbert, Colorado 14,027 votes for Trump - 4,490 votes for Biden - - - Fremont, Colorado + 4,490 votes for Biden + Fremont, Colorado 17,517 votes for Trump - 7,369 votes for Biden - - - Garfield, Colorado + 7,369 votes for Biden + Garfield, Colorado 15,427 votes for Biden - 14,717 votes for Trump - - - Gilpin, Colorado + 14,717 votes for Trump + Gilpin, Colorado 2,222 votes for Biden - 1,833 votes for Trump - - - Grand, Colorado + 1,833 votes for Trump + Grand, Colorado 4,883 votes for Trump - 4,709 votes for Biden - - - Gunnison, Colorado + 4,709 votes for Biden + Gunnison, Colorado 6,976 votes for Biden - 3,599 votes for Trump - - - Hinsdale, Colorado + 3,599 votes for Trump + Hinsdale, Colorado 353 votes for Trump - 255 votes for Biden - - - Huerfano, Colorado + 255 votes for Biden + Huerfano, Colorado 2,203 votes for Trump - 2,076 votes for Biden - - - Jackson, Colorado + 2,076 votes for Biden + Jackson, Colorado 681 votes for Trump - 175 votes for Biden - - - Jefferson, Colorado + 175 votes for Biden + Jefferson, Colorado 218,393 votes for Biden - 148,414 votes for Trump - - - Kiowa, Colorado + 148,414 votes for Trump + Kiowa, Colorado 795 votes for Trump - 98 votes for Biden - - - Kit Carson, Colorado + 98 votes for Biden + Kit Carson, Colorado 3,143 votes for Trump - 662 votes for Biden - - - La Plata, Colorado + 662 votes for Biden + La Plata, Colorado 20,548 votes for Biden - 14,233 votes for Trump - - - Lake, Colorado + 14,233 votes for Trump + Lake, Colorado 2,303 votes for Biden - 1,497 votes for Trump - - - Larimer, Colorado + 1,497 votes for Trump + Larimer, Colorado 126,117 votes for Biden - 91,488 votes for Trump - - - Las Animas, Colorado + 91,488 votes for Trump + Las Animas, Colorado 4,284 votes for Trump - 3,497 votes for Biden - - - Lincoln, Colorado + 3,497 votes for Biden + Lincoln, Colorado 2,135 votes for Trump - 470 votes for Biden - - - Logan, Colorado + 470 votes for Biden + Logan, Colorado 8,087 votes for Trump - 2,218 votes for Biden - - - Mesa, Colorado + 2,218 votes for Biden + Mesa, Colorado 56,888 votes for Trump - 31,533 votes for Biden - - - Mineral, Colorado + 31,533 votes for Biden + Mineral, Colorado 427 votes for Trump - 317 votes for Biden - - - Moffat, Colorado + 317 votes for Biden + Moffat, Colorado 5,670 votes for Trump - 1,203 votes for Biden - - - Montezuma, Colorado + 1,203 votes for Biden + Montezuma, Colorado 9,306 votes for Trump - 5,836 votes for Biden - - - Montrose, Colorado + 5,836 votes for Biden + Montrose, Colorado 16,770 votes for Trump - 7,687 votes for Biden - - - Morgan, Colorado + 7,687 votes for Biden + Morgan, Colorado 9,593 votes for Trump - 3,876 votes for Biden - - - Otero, Colorado + 3,876 votes for Biden + Otero, Colorado 5,756 votes for Trump - 3,605 votes for Biden - - - Ouray, Colorado + 3,605 votes for Biden + Ouray, Colorado 2,365 votes for Biden - 1,577 votes for Trump - - - Park, Colorado + 1,577 votes for Trump + Park, Colorado 6,990 votes for Trump - 4,903 votes for Biden - - - Phillips, Colorado + 4,903 votes for Biden + Phillips, Colorado 1,958 votes for Trump - 486 votes for Biden - - - Pitkin, Colorado + 486 votes for Biden + Pitkin, Colorado 8,989 votes for Biden - 2,780 votes for Trump - - - Prowers, Colorado + 2,780 votes for Trump + Prowers, Colorado 4,008 votes for Trump - 1,458 votes for Biden - - - Pueblo, Colorado + 1,458 votes for Biden + Pueblo, Colorado 43,772 votes for Biden - 42,252 votes for Trump - - - Rio Blanco, Colorado + 42,252 votes for Trump + Rio Blanco, Colorado 3,061 votes for Trump - 561 votes for Biden - - - Rio Grande, Colorado + 561 votes for Biden + Rio Grande, Colorado 3,660 votes for Trump - 2,495 votes for Biden - - - Routt, Colorado + 2,495 votes for Biden + Routt, Colorado 10,582 votes for Biden - 5,925 votes for Trump - - - Saguache, Colorado + 5,925 votes for Trump + Saguache, Colorado 1,884 votes for Biden - 1,413 votes for Trump - - - San Juan, Colorado + 1,413 votes for Trump + San Juan, Colorado 342 votes for Biden - 202 votes for Trump - - - San Miguel, Colorado + 202 votes for Trump + San Miguel, Colorado 3,923 votes for Biden - 1,136 votes for Trump - - - Sedgwick, Colorado + 1,136 votes for Trump + Sedgwick, Colorado 1,121 votes for Trump - 301 votes for Biden - - - Summit, Colorado + 301 votes for Biden + Summit, Colorado 12,620 votes for Biden - 5,319 votes for Trump - - - Teller, Colorado + 5,319 votes for Trump + Teller, Colorado 11,241 votes for Trump - 5,278 votes for Biden - - - Washington, Colorado + 5,278 votes for Biden + Washington, Colorado 2,595 votes for Trump - 369 votes for Biden - - - Weld, Colorado + 369 votes for Biden + Weld, Colorado 96,133 votes for Trump - 66,050 votes for Biden - - - Yuma, Colorado + 66,050 votes for Biden + Yuma, Colorado 4,107 votes for Trump - 785 votes for Biden - - - Bristol, Rhode Island + 785 votes for Biden + Bristol, Rhode Island 18,050 votes for Biden - 9,745 votes for Trump - - - Kent, Rhode Island + 9,745 votes for Trump + Kent, Rhode Island 49,112 votes for Biden - 41,999 votes for Trump - - - Newport, Rhode Island + 41,999 votes for Trump + Newport, Rhode Island 29,485 votes for Biden - 15,722 votes for Trump - - - Providence, Rhode Island + 15,722 votes for Trump + Providence, Rhode Island 164,997 votes for Biden - 102,546 votes for Trump - - - Washington, Rhode Island + 102,546 votes for Trump + Washington, Rhode Island 44,548 votes for Biden - 29,818 votes for Trump - - - Albany, Wyoming + 29,818 votes for Trump + Albany, Wyoming 9,092 votes for Biden - 8,579 votes for Trump - - - Big Horn, Wyoming + 8,579 votes for Trump + Big Horn, Wyoming 4,806 votes for Trump - 788 votes for Biden - - - Campbell, Wyoming + 788 votes for Biden + Campbell, Wyoming 16,975 votes for Trump - 1,935 votes for Biden - - - Carbon, Wyoming + 1,935 votes for Biden + Carbon, Wyoming 5,014 votes for Trump - 1,427 votes for Biden - - - Converse, Wyoming + 1,427 votes for Biden + Converse, Wyoming 5,917 votes for Trump - 861 votes for Biden - - - Crook, Wyoming + 861 votes for Biden + Crook, Wyoming 3,651 votes for Trump - 378 votes for Biden - - - Fremont, Wyoming + 378 votes for Biden + Fremont, Wyoming 12,007 votes for Trump - 5,519 votes for Biden - - - Goshen, Wyoming + 5,519 votes for Biden + Goshen, Wyoming 4,878 votes for Trump - 1,203 votes for Biden - - - Hot Springs, Wyoming + 1,203 votes for Biden + Hot Springs, Wyoming 1,999 votes for Trump - 482 votes for Biden - - - Johnson, Wyoming + 482 votes for Biden + Johnson, Wyoming 3,881 votes for Trump - 897 votes for Biden - - - Laramie, Wyoming + 897 votes for Biden + Laramie, Wyoming 27,891 votes for Trump - 15,217 votes for Biden - - - Lincoln, Wyoming + 15,217 votes for Biden + Lincoln, Wyoming 8,643 votes for Trump - 1,509 votes for Biden - - - Natrona, Wyoming + 1,509 votes for Biden + Natrona, Wyoming 25,271 votes for Trump - 8,530 votes for Biden - - - Niobrara, Wyoming + 8,530 votes for Biden + Niobrara, Wyoming 1,118 votes for Trump - 155 votes for Biden - - - Park, Wyoming + 155 votes for Biden + Park, Wyoming 12,813 votes for Trump - 3,410 votes for Biden - - - Platte, Wyoming + 3,410 votes for Biden + Platte, Wyoming 3,898 votes for Trump - 890 votes for Biden - - - Sheridan, Wyoming + 890 votes for Biden + Sheridan, Wyoming 11,843 votes for Trump - 4,043 votes for Biden - - - Sublette, Wyoming + 4,043 votes for Biden + Sublette, Wyoming 3,957 votes for Trump - 882 votes for Biden - - - Sweetwater, Wyoming + 882 votes for Biden + Sweetwater, Wyoming 12,229 votes for Trump - 3,823 votes for Biden - - - Teton, Wyoming + 3,823 votes for Biden + Teton, Wyoming 9,848 votes for Biden - 4,341 votes for Trump - - - Uinta, Wyoming + 4,341 votes for Trump + Uinta, Wyoming 7,496 votes for Trump - 1,591 votes for Biden - - - Washakie, Wyoming + 1,591 votes for Biden + Washakie, Wyoming 3,245 votes for Trump - 651 votes for Biden - - - Weston, Wyoming + 651 votes for Biden + Weston, Wyoming 3,107 votes for Trump - 360 votes for Biden - - - Fairfield, Connecticut + 360 votes for Biden + Fairfield, Connecticut 296,239 votes for Biden - 167,905 votes for Trump - - - Hartford, Connecticut + 167,905 votes for Trump + Hartford, Connecticut 284,341 votes for Biden - 159,370 votes for Trump - - - Litchfield, Connecticut + 159,370 votes for Trump + Litchfield, Connecticut 55,609 votes for Trump - 50,164 votes for Biden - - - Middlesex, Connecticut + 50,164 votes for Biden + Middlesex, Connecticut 56,848 votes for Biden - 40,665 votes for Trump - - - New Haven, Connecticut + 40,665 votes for Trump + New Haven, Connecticut 242,628 votes for Biden - 170,354 votes for Trump - - - New London, Connecticut + 170,354 votes for Trump + New London, Connecticut 79,459 votes for Biden - 57,110 votes for Trump - - - Tolland, Connecticut + 57,110 votes for Trump + Tolland, Connecticut 44,006 votes for Biden - 34,819 votes for Trump - - - Windham, Connecticut + 34,819 votes for Trump + Windham, Connecticut 29,141 votes for Trump - 26,702 votes for Biden - - - Beaver, Utah + 26,702 votes for Biden + Beaver, Utah 2,695 votes for Trump - 357 votes for Biden - - - Box Elder, Utah + 357 votes for Biden + Box Elder, Utah 21,548 votes for Trump - 4,473 votes for Biden - - - Cache, Utah + 4,473 votes for Biden + Cache, Utah 38,032 votes for Trump - 16,650 votes for Biden - - - Carbon, Utah + 16,650 votes for Biden + Carbon, Utah 6,693 votes for Trump - 2,392 votes for Biden - - - Daggett, Utah + 2,392 votes for Biden + Daggett, Utah 496 votes for Trump - 111 votes for Biden - - - Davis, Utah + 111 votes for Biden + Davis, Utah 104,095 votes for Trump - 57,396 votes for Biden - - - Duchesne, Utah + 57,396 votes for Biden + Duchesne, Utah 7,513 votes for Trump - 843 votes for Biden - - - Emery, Utah + 843 votes for Biden + Emery, Utah 4,207 votes for Trump - 572 votes for Biden - - - Garfield, Utah + 572 votes for Biden + Garfield, Utah 2,158 votes for Trump - 514 votes for Biden - - - Grand, Utah + 514 votes for Biden + Grand, Utah 2,806 votes for Biden - 2,248 votes for Trump - - - Iron, Utah + 2,248 votes for Trump + Iron, Utah 18,989 votes for Trump - 4,892 votes for Biden - - - Juab, Utah + 4,892 votes for Biden + Juab, Utah 5,087 votes for Trump - 645 votes for Biden - - - Kane, Utah + 645 votes for Biden + Kane, Utah 2,998 votes for Trump - 1,083 votes for Biden - - - Millard, Utah + 1,083 votes for Biden + Millard, Utah 5,404 votes for Trump - 624 votes for Biden - - - Morgan, Utah + 624 votes for Biden + Morgan, Utah 5,181 votes for Trump - 1,086 votes for Biden - - - Piute, Utah + 1,086 votes for Biden + Piute, Utah 773 votes for Trump - 86 votes for Biden - - - Rich, Utah + 86 votes for Biden + Rich, Utah 1,157 votes for Trump - 180 votes for Biden - - - Salt Lake, Utah + 180 votes for Biden + Salt Lake, Utah 289,906 votes for Biden - 230,174 votes for Trump - - - San Juan, Utah + 230,174 votes for Trump + San Juan, Utah 3,535 votes for Trump - 3,113 votes for Biden - - - Sanpete, Utah + 3,113 votes for Biden + Sanpete, Utah 10,459 votes for Trump - 1,794 votes for Biden - - - Sevier, Utah + 1,794 votes for Biden + Sevier, Utah 9,052 votes for Trump - 1,084 votes for Biden - - - Summit, Utah + 1,084 votes for Biden + Summit, Utah 15,244 votes for Biden - 10,252 votes for Trump - - - Tooele, Utah + 10,252 votes for Trump + Tooele, Utah 21,014 votes for Trump - 8,943 votes for Biden - - - Uintah, Utah + 8,943 votes for Biden + Uintah, Utah 13,261 votes for Trump - 1,663 votes for Biden - - - Utah, Utah + 1,663 votes for Biden + Utah, Utah 192,812 votes for Trump - 76,033 votes for Biden - - - Wasatch, Utah + 76,033 votes for Biden + Wasatch, Utah 10,795 votes for Trump - 6,187 votes for Biden - - - Washington, Utah + 6,187 votes for Biden + Washington, Utah 67,294 votes for Trump - 20,530 votes for Biden - - - Wayne, Utah + 20,530 votes for Biden + Wayne, Utah 1,229 votes for Trump - 365 votes for Biden - - - Weber, Utah + 365 votes for Biden + Weber, Utah 65,949 votes for Trump - 40,695 votes for Biden - - - Kent, Delaware + 40,695 votes for Biden + Kent, Delaware 44,552 votes for Biden - 41,009 votes for Trump - - - New Castle, Delaware + 41,009 votes for Trump + New Castle, Delaware 195,034 votes for Biden - 88,364 votes for Trump - - - Sussex, Delaware + 88,364 votes for Trump + Sussex, Delaware 71,230 votes for Trump - 56,682 votes for Biden - - - Ward 1, District Of Columbia + 56,682 votes for Biden + Ward 1, District Of Columbia 38,037 votes for Biden - 1,703 votes for Trump - - - Ward 2, District Of Columbia + 1,703 votes for Trump + Ward 2, District Of Columbia 28,185 votes for Biden - 2,874 votes for Trump - - - Ward 3, District Of Columbia + 2,874 votes for Trump + Ward 3, District Of Columbia 38,436 votes for Biden - 3,638 votes for Trump - - - Ward 4, District Of Columbia + 3,638 votes for Trump + Ward 4, District Of Columbia 41,604 votes for Biden - 1,885 votes for Trump - - - Ward 5, District Of Columbia + 1,885 votes for Trump + Ward 5, District Of Columbia 42,453 votes for Biden - 1,725 votes for Trump - - - Ward 6, District Of Columbia + 1,725 votes for Trump + Ward 6, District Of Columbia 52,357 votes for Biden - 4,176 votes for Trump - - - Ward 7, District Of Columbia + 4,176 votes for Trump + Ward 7, District Of Columbia 35,861 votes for Biden - 1,116 votes for Trump - - - Ward 8, District Of Columbia + 1,116 votes for Trump + Ward 8, District Of Columbia 30,332 votes for Biden - 1,055 votes for Trump - + 1,055 votes for Trump \ No newline at end of file diff --git a/test/output/usPresidentialForecast2016.svg b/test/output/usPresidentialForecast2016.svg index f315910e32..8a5152197e 100644 --- a/test/output/usPresidentialForecast2016.svg +++ b/test/output/usPresidentialForecast2016.svg @@ -13,45 +13,43 @@ white-space: pre; } - - - 0.0 - - - 0.5 - - - 1.0 - - - 1.5 - - - 2.0 - - - 2.5 - ↑ probability (%) + + + + + + + - - - 0 - - - 100 - - - 200 - - - 300 - - - 400 - - - 500 - Electoral votes for Hillary Clinton → + + 0.0 + 0.5 + 1.0 + 1.5 + 2.0 + 2.5 + + + ↑ probability (%) + + + + + + + + + + + 0 + 100 + 200 + 300 + 400 + 500 + + + Electoral votes for Hillary Clinton → diff --git a/test/output/usRetailSales.svg b/test/output/usRetailSales.svg index dd055b46a8..cd35ad6208 100644 --- a/test/output/usRetailSales.svg +++ b/test/output/usRetailSales.svg @@ -13,75 +13,66 @@ white-space: pre; } - - - - 0 - - - - 50 - - - - 100 - - - - 150 - - - - 200 - - - - 250 - - - - 300 - - - - 350 - - - - 400 - - - - 450 - - - - 500 - - - - 550 - U.S. retail monthly sales (in billions, seasonally-adjusted) + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 0 + 50 + 100 + 150 + 200 + 250 + 300 + 350 + 400 + 450 + 500 + 550 + + + U.S. retail monthly sales (in billions, seasonally-adjusted) + + + + + + + + - - - 1995 - - - 2000 - - - 2005 - - - 2010 - - - 2015 - - - 2020 - + + 1995 + 2000 + 2005 + 2010 + 2015 + 2020 diff --git a/test/output/usStateCapitals.svg b/test/output/usStateCapitals.svg index 798a352e4e..ab45896cbb 100644 --- a/test/output/usStateCapitals.svg +++ b/test/output/usStateCapitals.svg @@ -126,5 +126,56 @@ - MontgomeryAlabamaJuneauAlaskaPhoenixArizonaLittle RockArkansasSacramentoCaliforniaDenverColoradoHartfordConnecticutDoverDelawareHonoluluHawaiiTallahasseeFloridaAtlantaGeorgiaBoiseIdahoSpringfieldIllinoisIndianapolisIndianaDes MoinesIowaTopekaKansasFrankfortKentuckyBaton RougeLouisianaAugustaMaineAnnapolisMarylandBostonMassachusettsLansingMichiganSt. PaulMinnesotaJacksonMississippiJefferson CityMissouriHelenaMontanaLincolnNebraskaCarson CityNevadaConcordNew HampshireTrentonNew JerseySanta FeNew MexicoRaleighNorth CarolinaBismarckNorth DakotaAlbanyNew YorkColumbusOhioOklahoma CityOklahomaSalemOregonHarrisburgPennsylvaniaProvidenceRhode IslandColumbiaSouth CarolinaPierreSouth DakotaNashvilleTennesseeAustinTexasSalt Lake CityUtahMontpelierVermontRichmondVirginiaOlympiaWashingtonCharlestonWest VirginiaMadisonWisconsinCheyenneWyoming + + MontgomeryAlabama + JuneauAlaska + PhoenixArizona + Little RockArkansas + SacramentoCalifornia + DenverColorado + HartfordConnecticut + DoverDelaware + HonoluluHawaii + TallahasseeFlorida + AtlantaGeorgia + BoiseIdaho + SpringfieldIllinois + IndianapolisIndiana + Des MoinesIowa + TopekaKansas + FrankfortKentucky + Baton RougeLouisiana + AugustaMaine + AnnapolisMaryland + BostonMassachusetts + LansingMichigan + St. PaulMinnesota + JacksonMississippi + Jefferson CityMissouri + HelenaMontana + LincolnNebraska + Carson CityNevada + ConcordNew Hampshire + TrentonNew Jersey + Santa FeNew Mexico + RaleighNorth Carolina + BismarckNorth Dakota + AlbanyNew York + ColumbusOhio + Oklahoma CityOklahoma + SalemOregon + HarrisburgPennsylvania + ProvidenceRhode Island + ColumbiaSouth Carolina + PierreSouth Dakota + NashvilleTennessee + AustinTexas + Salt Lake CityUtah + MontpelierVermont + RichmondVirginia + OlympiaWashington + CharlestonWest Virginia + MadisonWisconsin + CheyenneWyoming + \ No newline at end of file diff --git a/test/output/usStateCapitalsVoronoi.svg b/test/output/usStateCapitalsVoronoi.svg index af7b6051b0..12cb75ac9e 100644 --- a/test/output/usStateCapitalsVoronoi.svg +++ b/test/output/usStateCapitalsVoronoi.svg @@ -70,150 +70,54 @@ - - Alabama - - - Arizona - - - Arkansas - - - California - - - Colorado - - - Connecticut - - - Delaware - - - Florida - - - Georgia - - - Idaho - - - Illinois - - - Indiana - - - Iowa - - - Kansas - - - Kentucky - - - Louisiana - - - Maine - - - Maryland - - - Massachusetts - - - Michigan - - - Minnesota - - - Mississippi - - - Missouri - - - Montana - - - Nebraska - - - Nevada - - - New Hampshire - - - New Jersey - - - New Mexico - - - North Carolina - - - North Dakota - - - New York - - - Ohio - - - Oklahoma - - - Oregon - - - Pennsylvania - - - Rhode Island - - - South Carolina - - - South Dakota - - - Tennessee - - - Texas - - - Utah - - - Vermont - - - Virginia - - - Washington - - - West Virginia - - - Wisconsin - - - Wyoming - + Alabama + Arizona + Arkansas + California + Colorado + Connecticut + Delaware + Florida + Georgia + Idaho + Illinois + Indiana + Iowa + Kansas + Kentucky + Louisiana + Maine + Maryland + Massachusetts + Michigan + Minnesota + Mississippi + Missouri + Montana + Nebraska + Nevada + New Hampshire + New Jersey + New Mexico + North Carolina + North Dakota + New York + Ohio + Oklahoma + Oregon + Pennsylvania + Rhode Island + South Carolina + South Dakota + Tennessee + Texas + Utah + Vermont + Virginia + Washington + West Virginia + Wisconsin + Wyoming diff --git a/test/output/usStatePopulationChange.svg b/test/output/usStatePopulationChange.svg index 3c1f50deb2..6e8d70587c 100644 --- a/test/output/usStatePopulationChange.svg +++ b/test/output/usStatePopulationChange.svg @@ -13,253 +13,203 @@ white-space: pre; } - - - - Texas - - - - Florida - - - - California - - - - North Carolina - - - - Georgia - - - - Washington - - - - Arizona - - - - Colorado - - - - Virginia - - - - South Carolina - - - - Tennessee - - - - Utah - - - - Massachusetts - - - - Oregon - - - - Nevada - - - - Minnesota - - - - Maryland - - - - Indiana - - - - Idaho - - - - Oklahoma - - - - Ohio - - - - Missouri - - - - Wisconsin - - - - Kentucky - - - - Alabama - - - - Louisiana - - - - Iowa - - - - Nebraska - - - - District of Columbia - - - - Michigan - - - - Arkansas - - - - Pennsylvania - - - - New Jersey - - - - North Dakota - - - - Montana - - - - Delaware - - - - New York - - - - South Dakota - - - - Kansas - - - - Hawaii - - - - New Hampshire - - - - New Mexico - - - - Alaska - - - - Maine - - - - Wyoming - - - - Mississippi - - - - Rhode Island - - - - Vermont - - - - Connecticut - - - - West Virginia - - - - Illinois - - - - Puerto Rico - + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + - - - - −0.5 - - - - +0.0 - - - - +0.5 - - - - +1.0 - - - - +1.5 - - - - +2.0 - - - - +2.5 - - - - +3.0 - - - - +3.5 - ← decrease · Change in population, 2010–2019 (millions) · increase → + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Texas + Florida + California + North Carolina + Georgia + Washington + Arizona + Colorado + Virginia + South Carolina + Tennessee + Utah + Massachusetts + Oregon + Nevada + Minnesota + Maryland + Indiana + Idaho + Oklahoma + Ohio + Missouri + Wisconsin + Kentucky + Alabama + Louisiana + Iowa + Nebraska + District of Columbia + Michigan + Arkansas + Pennsylvania + New Jersey + North Dakota + Montana + Delaware + New York + South Dakota + Kansas + Hawaii + New Hampshire + New Mexico + Alaska + Maine + Wyoming + Mississippi + Rhode Island + Vermont + Connecticut + West Virginia + Illinois + Puerto Rico + + + + + + + + + + + + + + + + + + + + + + + + + −0.5 + +0.0 + +0.5 + +1.0 + +1.5 + +2.0 + +2.5 + +3.0 + +3.5 + + + ← decrease · Change in population, 2010–2019 (millions) · increase → diff --git a/test/output/vectorField.svg b/test/output/vectorField.svg index 88496fed04..ed580e1a40 100644 --- a/test/output/vectorField.svg +++ b/test/output/vectorField.svg @@ -13,69 +13,53 @@ white-space: pre; } - - - 0.0 - - - 0.5 - - - 1.0 - - - 1.5 - - - 2.0 - - - 2.5 - - - 3.0 - - - 3.5 - - - 4.0 - - - 4.5 - - - 5.0 - - - 5.5 - - - 6.0 - + + + + + + + + + + + + + + - - - 0 - - - 1 - - - 2 - - - 3 - - - 4 - - - 5 - - - 6 - + + 0.0 + 0.5 + 1.0 + 1.5 + 2.0 + 2.5 + 3.0 + 3.5 + 4.0 + 4.5 + 5.0 + 5.5 + 6.0 + + + + + + + + + + + + 0 + 1 + 2 + 3 + 4 + 5 + 6 diff --git a/test/output/vectorFrame.svg b/test/output/vectorFrame.svg index 7b8dff39fb..d8569825ac 100644 --- a/test/output/vectorFrame.svg +++ b/test/output/vectorFrame.svg @@ -26,5 +26,7 @@ - Ο + + Ο + \ No newline at end of file diff --git a/test/output/volcano.svg b/test/output/volcano.svg index 0157da5ae5..efd682c486 100644 --- a/test/output/volcano.svg +++ b/test/output/volcano.svg @@ -13,75 +13,57 @@ white-space: pre; } - - - 0 - - - 5 - - - 10 - - - 15 - - - 20 - - - 25 - - - 30 - - - 35 - - - 40 - - - 45 - - - 50 - - - 55 - - - 60 - + + + + + + + + + + + + + + - - - 0 - - - 10 - - - 20 - - - 30 - - - 40 - - - 50 - - - 60 - - - 70 - - - 80 - + + 0 + 5 + 10 + 15 + 20 + 25 + 30 + 35 + 40 + 45 + 50 + 55 + 60 + + + + + + + + + + + + + + 0 + 10 + 20 + 30 + 40 + 50 + 60 + 70 + 80 diff --git a/test/output/volcanoContour.svg b/test/output/volcanoContour.svg index 98f191ffbf..111ae25bba 100644 --- a/test/output/volcanoContour.svg +++ b/test/output/volcanoContour.svg @@ -13,75 +13,57 @@ white-space: pre; } - - - 0 - - - 5 - - - 10 - - - 15 - - - 20 - - - 25 - - - 30 - - - 35 - - - 40 - - - 45 - - - 50 - - - 55 - - - 60 - + + + + + + + + + + + + + + - - - 0 - - - 10 - - - 20 - - - 30 - - - 40 - - - 50 - - - 60 - - - 70 - - - 80 - + + 0 + 5 + 10 + 15 + 20 + 25 + 30 + 35 + 40 + 45 + 50 + 55 + 60 + + + + + + + + + + + + + + 0 + 10 + 20 + 30 + 40 + 50 + 60 + 70 + 80 diff --git a/test/output/volcanoTerrain.svg b/test/output/volcanoTerrain.svg index b86d570511..08569b17cb 100644 --- a/test/output/volcanoTerrain.svg +++ b/test/output/volcanoTerrain.svg @@ -13,75 +13,57 @@ white-space: pre; } - - - 0 - - - 5 - - - 10 - - - 15 - - - 20 - - - 25 - - - 30 - - - 35 - - - 40 - - - 45 - - - 50 - - - 55 - - - 60 - + + + + + + + + + + + + + + - - - 0 - - - 10 - - - 20 - - - 30 - - - 40 - - - 50 - - - 60 - - - 70 - - - 80 - + + 0 + 5 + 10 + 15 + 20 + 25 + 30 + 35 + 40 + 45 + 50 + 55 + 60 + + + + + + + + + + + + + + 0 + 10 + 20 + 30 + 40 + 50 + 60 + 70 + 80 diff --git a/test/output/walmarts.html b/test/output/walmarts.html index 6bea5b4cfc..b705ef6d31 100644 --- a/test/output/walmarts.html +++ b/test/output/walmarts.html @@ -16,18 +16,23 @@ - 1970 + + 1970 - 1980 + + 1980 - 1990 + + 1990 - 2000 + + 2000 - First year opened + + First year opened - - 1978-09-05 - - - 1992-06-02 - - - 1983-10-04 - - - 1983-10-18 - - - 1993-02-02 - - - 1989-04-03 - - - 1977-07-01 - - - 1990-09-04 - - - 1993-01-05 - - - 1970-11-01 - - - 1990-11-14 - - - 1992-04-01 - - - 1992-09-01 - - - 1982-10-05 - - - 1982-09-21 - - - 1986-03-04 - - - 1991-07-02 - - - 1992-11-25 - - - 1983-10-18 - - - 1989-02-02 - - - 1990-10-01 - - - 1991-09-11 - - - 1992-08-04 - - - 1979-08-21 - - - 1989-08-31 - - - 1991-09-11 - - - 1974-07-01 - - - 1981-09-29 - - - 1981-07-04 - - - 1983-03-01 - - - 1985-12-31 - - - 1985-10-22 - - - 1988-08-16 - - - 1992-08-04 - - - 1995-08-22 - - - 1987-05-12 - - - 1993-02-02 - - - 1975-07-01 - - - 1979-03-06 - - - 1979-11-20 - - - 1988-06-30 - - - 1989-10-31 - - - 1994-01-04 - - - 1967-10-01 - - - 1974-10-01 - - - 1980-04-15 - - - 1981-07-04 - - - 1987-05-12 - - - 1991-06-04 - - - 1979-10-30 - - - 1980-08-12 - - - 1980-09-30 - - - 1983-05-17 - - - 1981-07-04 - - - 1983-11-29 - - - 1981-07-04 - - - 1981-07-04 - - - 1985-07-16 - - - 1987-06-02 - - - 1990-12-03 - - - 1990-05-30 - - - 1990-10-29 - - - 1991-11-05 - - - 1968-11-01 - - - 1971-11-01 - - - 1980-11-18 - - - 1981-07-04 - - - 1986-03-18 - - - 1989-04-03 - - - 1990-05-30 - - - 1990-06-27 - - - 1990-10-29 - - - 1990-08-01 - - - 1991-04-02 - - - 1992-02-04 - - - 1994-10-18 - - - 1962-07-01 - - - 1969-04-01 - - - 1984-02-01 - - - 1984-08-21 - - - 1981-07-04 - - - 1981-07-04 - - - 1981-07-04 - - - 1981-07-04 - - - 1989-10-31 - - - 1989-12-30 - - - 1990-01-31 - - - 1989-11-16 - - - 1991-11-05 - - - 1992-08-04 - - - 1971-09-01 - - - 1973-02-01 - - - 1974-04-01 - - - 1975-02-01 - - - 1975-08-01 - - - 1981-07-04 - - - 1981-11-03 - - - 1981-07-04 - - - 1984-10-16 - - - 1986-08-19 - - - 1987-08-18 - - - 1988-06-30 - - - 1989-04-03 - - - 1989-04-03 - - - 1990-01-31 - - - 1991-01-30 - - - 1991-11-05 - - - 1991-10-01 - - - 1991-06-04 - - - 1992-02-04 - - - 1992-08-04 - - - 1993-06-01 - - - 1971-11-01 - - - 1974-08-01 - - - 1976-07-01 - - - 1979-10-30 - - - 1979-10-30 - - - 1980-07-29 - - - 1981-07-04 - - - 1982-10-05 - - - 1981-07-04 - - - 1981-07-04 - - - 1984-10-16 - - - 1983-07-01 - - - 1981-07-04 - - - 1985-11-12 - - - 1984-10-23 - - - 1984-10-16 - - - 1984-10-16 - - - 1985-06-04 - - - 1986-04-29 - - - 1986-11-18 - - - 1987-03-31 - - - 1987-11-17 - - - 1988-09-01 - - - 1990-01-31 - - - 1992-02-04 - - - 1991-11-05 - - - 1992-08-04 - - - 1992-09-30 - - - 1993-08-31 - - - 1993-10-26 - - - 1965-08-01 - - - 1967-10-01 - - - 1970-11-01 - - - 1971-08-01 - - - 1972-07-01 - - - 1972-11-01 - - - 1976-04-01 - - - 1975-11-01 - - - 1978-03-14 - - - 1977-07-01 - - - 1977-07-01 - - - 1978-03-28 - - - 1978-05-16 - - - 1979-07-10 - - - 1979-11-13 - - - 1980-10-14 - - - 1980-11-18 - - - 1981-07-04 - - - 1982-11-16 - - - 1981-07-04 - - - 1981-07-04 - - - 1983-05-17 - - - 1983-05-17 - - - 1981-07-04 - - - 1981-07-04 - - - 1981-07-04 - - - 1985-02-05 - - - 1984-05-01 - - - 1985-07-02 - - - 1986-03-11 - - - 1986-06-10 - - - 1986-07-15 - - - 1986-09-09 - - - 1988-03-08 - - - 1989-08-01 - - - 1989-02-02 - - - 1989-04-03 - - - 1989-06-29 - - - 1989-11-16 - - - 1989-12-30 - - - 1991-01-30 - - - 1991-10-01 - - - 1991-11-05 - - - 1991-11-05 - - - 1992-08-04 - - - 1993-03-02 - - - 1992-09-30 - - - 1993-03-02 - - - 1994-01-04 - - - 1993-10-19 - - - 1964-08-01 - - - 1983-08-16 - - - 1968-03-01 - - - 1969-04-01 - - - 1972-02-01 - - - 1972-06-01 - - - 1975-03-01 - - - 1974-08-01 - - - 1979-06-01 - - - 1979-02-13 - - - 1979-03-27 - - - 1979-06-26 - - - 1979-08-21 - - - 1979-10-30 - - - 1981-02-10 - - - 1981-02-10 - - - 1981-03-31 - - - 1981-08-04 - - - 1982-05-18 - - - 1982-11-16 - - - 1982-10-05 - - - 1984-08-02 - - - 1983-05-17 - - - 1981-07-04 - - - 1983-11-29 - - - 1981-07-04 - - - 1981-07-04 - - - 1985-08-30 - - - 1986-11-18 - - - 1988-03-08 - - - 1988-02-02 - - - 1988-06-02 - - - 1988-11-17 - - - 1989-12-30 - - - 1990-01-31 - - - 1990-12-03 - - - 1990-08-01 - - - 1992-06-02 - - - 1991-11-05 - - - 1992-03-03 - - - 1992-06-30 - - - 1992-06-30 - - - 1992-09-30 - - - 1992-11-02 - - - 1993-02-02 - - - 1993-11-02 - - - 1994-07-26 - - - 1995-01-03 - - - 1998-01-26 - - - 1968-03-01 - - - 1968-07-01 - - - 1972-10-01 - - - 1970-03-01 - - - 1971-12-09 - - - 1975-06-01 - - - 1975-04-01 - - - 1975-11-01 - - - 1975-07-01 - - - 1976-05-01 - - - 1976-06-01 - - - 1977-03-01 - - - 1977-02-01 - - - 1977-02-01 - - - 1977-04-01 - - - 1977-07-01 - - - 1979-08-28 - - - 1979-10-29 - - - 1980-02-26 - - - 1979-11-27 - - - 1980-07-01 - - - 1980-11-18 - - - 1981-09-29 - - - 1982-08-03 - - - 1982-04-20 - - - 1983-05-03 - - - 1983-07-01 - - - 1983-08-16 - - - 1983-05-03 - - - 1984-03-06 - - - 1985-10-08 - - - 1985-05-14 - - - 1981-07-04 - - - 1984-10-16 - - - 1984-06-05 - - - 1986-01-21 - - - 1986-09-02 - - - 1985-11-12 - - - 1985-10-29 - - - 1986-01-21 - - - 1985-10-22 - - - 1986-09-16 - - - 1986-11-18 - - - 1987-09-01 - - - 1987-08-04 - - - 1989-06-01 - - - 1989-10-02 - - - 1989-09-16 - - - 1989-10-31 - - - 1989-08-01 - - - 1991-01-30 - - - 1990-08-01 - - - 1991-01-30 - - - 1991-04-02 - - - 1991-01-30 - - - 1991-10-01 - - - 1991-11-05 - - - 1993-01-05 - - - 1993-02-02 - - - 1993-02-02 - - - 1993-03-31 - - - 1993-10-26 - - - 1969-11-01 - - - 1971-02-01 - - - 1971-02-01 - - - 1971-10-01 - - - 1973-02-01 - - - 1982-08-17 - - - 1974-08-01 - - - 1974-07-01 - - - 1976-04-01 - - - 1976-04-01 - - - 1976-05-01 - - - 1976-10-01 - - - 1977-03-01 - - - 1977-06-01 - - - 1977-10-01 - - - 1985-05-21 - - - 1979-08-07 - - - 1978-03-21 - - - 1979-05-15 - - - 1979-10-23 - - - 1980-10-13 - - - 1980-11-11 - - - 1981-10-20 - - - 1981-06-02 - - - 1981-12-01 - - - 1981-07-04 - - - 1982-08-31 - - - 1982-08-31 - - - 1984-03-06 - - - 1982-11-02 - - - 1984-08-02 - - - 1983-08-16 - - - 1983-07-01 - - - 1981-07-04 - - - 1983-10-04 - - - 1984-07-17 - - - 1981-07-04 - - - 1985-01-22 - - - 1984-04-03 - - - 1984-11-13 - - - 1985-09-10 - - - 1985-07-16 - - - 1985-07-16 - - - 1985-12-31 - - - 1985-08-20 - - - 1986-02-04 - - - 1986-11-18 - - - 1987-03-03 - - - 1988-02-02 - - - 1988-06-02 - - - 1988-10-11 - - - 1988-08-16 - - - 1989-06-01 - - - 1989-02-02 - - - 1989-08-31 - - - 1989-08-01 - - - 1989-12-30 - - - 1989-08-01 - - - 1989-11-16 - - - 1989-10-31 - - - 1990-08-01 - - - 1991-10-01 - - - 1990-06-27 - - - 1990-10-29 - - - 1990-10-29 - - - 1991-01-30 - - - 1991-01-30 - - - 1991-01-30 - - - 1991-06-04 - - - 1992-02-04 - - - 1992-06-02 - - - 1992-08-04 - - - 1992-08-04 - - - 1992-08-04 - - - 1993-03-02 - - - 1992-11-02 - - - 1993-01-05 - - - 1993-04-30 - - - 1993-10-26 - - - 1993-06-01 - - - 1993-10-26 - - - 1993-07-27 - - - 1994-01-04 - - - 1994-08-31 - - - 1997-01-29 - - - 1995-01-03 - - - 1995-05-31 - - - 1997-01-29 - - - 1997-06-18 - - - 1970-10-01 - - - 1971-06-01 - - - 1972-10-01 - - - 1973-08-01 - - - 1974-09-01 - - - 1975-02-01 - - - 1976-02-01 - - - 1976-09-01 - - - 1977-11-01 - - - 1977-07-01 - - - 1978-09-12 - - - 1980-11-18 - - - 1984-10-30 - - - 1981-03-03 - - - 1983-10-04 - - - 1982-09-21 - - - 1985-05-14 - - - 1983-06-07 - - - 1983-06-07 - - - 1983-07-01 - - - 1984-08-31 - - - 1984-04-03 - - - 1984-08-31 - - - 1984-10-02 - - - 1981-07-04 - - - 1981-07-04 - - - 1981-07-04 - - - 1984-10-02 - - - 1985-01-22 - - - 1985-07-16 - - - 1985-04-30 - - - 1985-10-08 - - - 1985-06-04 - - - 1985-07-02 - - - 1985-09-17 - - - 1985-11-12 - - - 1986-03-05 - - - 1986-06-17 - - - 1987-03-03 - - - 1988-04-12 - - - 1989-02-02 - - - 1989-08-01 - - - 1989-02-02 - - - 1989-06-01 - - - 1990-01-31 - - - 1990-01-31 - - - 1990-04-02 - - - 1990-05-30 - - - 1990-01-31 - - - 1990-05-30 - - - 1990-04-30 - - - 1990-06-27 - - - 1990-12-31 - - - 1990-04-02 - - - 1990-10-29 - - - 1990-10-29 - - - 1990-12-03 - - - 1990-12-31 - - - 1990-12-03 - - - 1991-04-30 - - - 1991-07-02 - - - 1991-07-31 - - - 1991-04-02 - - - 1991-11-05 - - - 1992-09-01 - - - 1992-11-02 - - - 1988-01-01 - - - 1992-11-02 - - - 1993-01-05 - - - 1992-09-30 - - - 1992-09-30 - - - 1993-01-05 - - - 1992-11-02 - - - 1993-04-30 - - - 1994-01-04 - - - 1994-01-04 - - - 1993-10-19 - - - 1994-10-26 - - - 1994-10-26 - - - 1996-05-29 - - - 1995-11-01 - - - 1995-12-30 - - - 1995-12-28 - - - 1998-06-17 - - - 1997-06-18 - - - 2000-08-16 - - - 2000-08-16 - - - 2004-01-21 - - - 1976-08-01 - - - 1976-10-01 - - - 1977-11-01 - - - 1978-10-10 - - - 1981-03-10 - - - 1981-11-03 - - - 1982-08-17 - - - 1984-04-03 - - - 1982-11-16 - - - 1982-08-17 - - - 1983-10-16 - - - 1984-10-16 - - - 1983-11-15 - - - 1984-04-03 - - - 1985-02-05 - - - 1984-08-02 - - - 1984-10-30 - - - 1985-02-05 - - - 1981-07-04 - - - 1985-04-30 - - - 1985-07-16 - - - 1985-07-02 - - - 1985-10-16 - - - 1985-07-02 - - - 1985-10-01 - - - 1986-03-04 - - - 1986-03-05 - - - 1986-03-05 - - - 1986-01-21 - - - 1986-03-04 - - - 1986-03-11 - - - 1986-06-03 - - - 1986-07-15 - - - 1986-03-18 - - - 1986-07-08 - - - 1986-03-05 - - - 1986-03-11 - - - 1986-09-16 - - - 1986-08-05 - - - 1987-02-03 - - - 1986-09-16 - - - 1986-09-09 - - - 1987-02-03 - - - 1987-04-28 - - - 1987-07-14 - - - 1987-06-30 - - - 1988-03-01 - - - 1988-05-03 - - - 1988-11-01 - - - 1988-04-07 - - - 1988-05-03 - - - 1988-11-01 - - - 1988-10-03 - - - 1989-04-03 - - - 1989-05-02 - - - 1989-02-02 - - - 1989-06-01 - - - 1989-06-01 - - - 1989-06-01 - - - 1989-10-31 - - - 1990-01-31 - - - 1989-12-30 - - - 1990-01-31 - - - 1990-04-02 - - - 1990-01-31 - - - 1990-01-31 - - - 1990-04-02 - - - 1990-08-01 - - - 1991-01-30 - - - 1990-08-01 - - - 1990-06-27 - - - 1990-08-01 - - - 1990-08-01 - - - 1991-01-30 - - - 1990-08-01 - - - 1990-10-29 - - - 1990-10-01 - - - 1990-12-03 - - - 1990-10-29 - - - 1990-10-01 - - - 1990-12-31 - - - 1990-12-03 - - - 1990-11-14 - - - 1990-12-03 - - - 1990-12-31 - - - 1991-01-30 - - - 1991-01-30 - - - 1991-01-30 - - - 1991-01-30 - - - 1991-11-05 - - - 1991-04-02 - - - 1991-04-02 - - - 1991-04-02 - - - 1991-07-02 - - - 1991-07-31 - - - 1991-12-31 - - - 1992-03-03 - - - 1991-11-05 - - - 1992-03-03 - - - 1992-04-01 - - - 1992-06-02 - - - 1992-09-30 - - - 1992-09-01 - - - 1992-11-02 - - - 1992-11-02 - - - 1993-01-05 - - - 1992-11-02 - - - 1992-11-25 - - - 1993-01-05 - - - 1992-11-02 - - - 1992-11-02 - - - 1993-01-05 - - - 1993-02-02 - - - 1993-06-30 - - - 1993-02-02 - - - 1992-11-02 - - - 1993-03-31 - - - 1993-04-30 - - - 1993-03-31 - - - 1993-04-30 - - - 1993-08-31 - - - 1994-01-04 - - - 1993-06-01 - - - 1993-08-31 - - - 1993-10-26 - - - 1993-10-26 - - - 1994-05-17 - - - 1993-10-26 - - - 1994-03-30 - - - 1994-01-25 - - - 1995-01-03 - - - 1994-09-27 - - - 1994-03-22 - - - 1994-10-26 - - - 1994-03-30 - - - 1995-12-30 - - - 1995-06-28 - - - 1995-01-03 - - - 1998-07-15 - - - 1997-01-29 - - - 1995-11-01 - - - 1998-08-19 - - - 1996-08-28 - - - 2001-03-14 - - - 1996-06-26 - - - 1996-04-02 - - - 2001-01-24 - - - 1996-10-29 - - - 1996-07-23 - - - 1996-10-29 - - - 1997-01-29 - - - 1997-08-13 - - - 1998-01-26 - - - 1998-01-26 - - - 1998-01-26 - - - 1998-01-26 - - - 1998-07-15 - - - 1999-01-27 - - - 1998-10-14 - - - 1998-10-14 - - - 2000-05-17 - - - 2000-01-26 - - - 2001-02-28 - - - 2002-02-20 - - - 2002-02-20 - - - 2005-09-14 - - - 2002-01-23 - - - 2003-05-21 - - - 2003-08-20 - - - 2004-01-21 - - - 2004-01-21 - - - 2003-10-29 - - - 2004-10-27 - - - 2005-05-18 - - - 2005-01-26 - - - 2006-01-31 - + 1978-09-05 + 1992-06-02 + 1983-10-04 + 1983-10-18 + 1993-02-02 + 1989-04-03 + 1977-07-01 + 1990-09-04 + 1993-01-05 + 1970-11-01 + 1990-11-14 + 1992-04-01 + 1992-09-01 + 1982-10-05 + 1982-09-21 + 1986-03-04 + 1991-07-02 + 1992-11-25 + 1983-10-18 + 1989-02-02 + 1990-10-01 + 1991-09-11 + 1992-08-04 + 1979-08-21 + 1989-08-31 + 1991-09-11 + 1974-07-01 + 1981-09-29 + 1981-07-04 + 1983-03-01 + 1985-12-31 + 1985-10-22 + 1988-08-16 + 1992-08-04 + 1995-08-22 + 1987-05-12 + 1993-02-02 + 1975-07-01 + 1979-03-06 + 1979-11-20 + 1988-06-30 + 1989-10-31 + 1994-01-04 + 1967-10-01 + 1974-10-01 + 1980-04-15 + 1981-07-04 + 1987-05-12 + 1991-06-04 + 1979-10-30 + 1980-08-12 + 1980-09-30 + 1983-05-17 + 1981-07-04 + 1983-11-29 + 1981-07-04 + 1981-07-04 + 1985-07-16 + 1987-06-02 + 1990-12-03 + 1990-05-30 + 1990-10-29 + 1991-11-05 + 1968-11-01 + 1971-11-01 + 1980-11-18 + 1981-07-04 + 1986-03-18 + 1989-04-03 + 1990-05-30 + 1990-06-27 + 1990-10-29 + 1990-08-01 + 1991-04-02 + 1992-02-04 + 1994-10-18 + 1962-07-01 + 1969-04-01 + 1984-02-01 + 1984-08-21 + 1981-07-04 + 1981-07-04 + 1981-07-04 + 1981-07-04 + 1989-10-31 + 1989-12-30 + 1990-01-31 + 1989-11-16 + 1991-11-05 + 1992-08-04 + 1971-09-01 + 1973-02-01 + 1974-04-01 + 1975-02-01 + 1975-08-01 + 1981-07-04 + 1981-11-03 + 1981-07-04 + 1984-10-16 + 1986-08-19 + 1987-08-18 + 1988-06-30 + 1989-04-03 + 1989-04-03 + 1990-01-31 + 1991-01-30 + 1991-11-05 + 1991-10-01 + 1991-06-04 + 1992-02-04 + 1992-08-04 + 1993-06-01 + 1971-11-01 + 1974-08-01 + 1976-07-01 + 1979-10-30 + 1979-10-30 + 1980-07-29 + 1981-07-04 + 1982-10-05 + 1981-07-04 + 1981-07-04 + 1984-10-16 + 1983-07-01 + 1981-07-04 + 1985-11-12 + 1984-10-23 + 1984-10-16 + 1984-10-16 + 1985-06-04 + 1986-04-29 + 1986-11-18 + 1987-03-31 + 1987-11-17 + 1988-09-01 + 1990-01-31 + 1992-02-04 + 1991-11-05 + 1992-08-04 + 1992-09-30 + 1993-08-31 + 1993-10-26 + 1965-08-01 + 1967-10-01 + 1970-11-01 + 1971-08-01 + 1972-07-01 + 1972-11-01 + 1976-04-01 + 1975-11-01 + 1978-03-14 + 1977-07-01 + 1977-07-01 + 1978-03-28 + 1978-05-16 + 1979-07-10 + 1979-11-13 + 1980-10-14 + 1980-11-18 + 1981-07-04 + 1982-11-16 + 1981-07-04 + 1981-07-04 + 1983-05-17 + 1983-05-17 + 1981-07-04 + 1981-07-04 + 1981-07-04 + 1985-02-05 + 1984-05-01 + 1985-07-02 + 1986-03-11 + 1986-06-10 + 1986-07-15 + 1986-09-09 + 1988-03-08 + 1989-08-01 + 1989-02-02 + 1989-04-03 + 1989-06-29 + 1989-11-16 + 1989-12-30 + 1991-01-30 + 1991-10-01 + 1991-11-05 + 1991-11-05 + 1992-08-04 + 1993-03-02 + 1992-09-30 + 1993-03-02 + 1994-01-04 + 1993-10-19 + 1964-08-01 + 1983-08-16 + 1968-03-01 + 1969-04-01 + 1972-02-01 + 1972-06-01 + 1975-03-01 + 1974-08-01 + 1979-06-01 + 1979-02-13 + 1979-03-27 + 1979-06-26 + 1979-08-21 + 1979-10-30 + 1981-02-10 + 1981-02-10 + 1981-03-31 + 1981-08-04 + 1982-05-18 + 1982-11-16 + 1982-10-05 + 1984-08-02 + 1983-05-17 + 1981-07-04 + 1983-11-29 + 1981-07-04 + 1981-07-04 + 1985-08-30 + 1986-11-18 + 1988-03-08 + 1988-02-02 + 1988-06-02 + 1988-11-17 + 1989-12-30 + 1990-01-31 + 1990-12-03 + 1990-08-01 + 1992-06-02 + 1991-11-05 + 1992-03-03 + 1992-06-30 + 1992-06-30 + 1992-09-30 + 1992-11-02 + 1993-02-02 + 1993-11-02 + 1994-07-26 + 1995-01-03 + 1998-01-26 + 1968-03-01 + 1968-07-01 + 1972-10-01 + 1970-03-01 + 1971-12-09 + 1975-06-01 + 1975-04-01 + 1975-11-01 + 1975-07-01 + 1976-05-01 + 1976-06-01 + 1977-03-01 + 1977-02-01 + 1977-02-01 + 1977-04-01 + 1977-07-01 + 1979-08-28 + 1979-10-29 + 1980-02-26 + 1979-11-27 + 1980-07-01 + 1980-11-18 + 1981-09-29 + 1982-08-03 + 1982-04-20 + 1983-05-03 + 1983-07-01 + 1983-08-16 + 1983-05-03 + 1984-03-06 + 1985-10-08 + 1985-05-14 + 1981-07-04 + 1984-10-16 + 1984-06-05 + 1986-01-21 + 1986-09-02 + 1985-11-12 + 1985-10-29 + 1986-01-21 + 1985-10-22 + 1986-09-16 + 1986-11-18 + 1987-09-01 + 1987-08-04 + 1989-06-01 + 1989-10-02 + 1989-09-16 + 1989-10-31 + 1989-08-01 + 1991-01-30 + 1990-08-01 + 1991-01-30 + 1991-04-02 + 1991-01-30 + 1991-10-01 + 1991-11-05 + 1993-01-05 + 1993-02-02 + 1993-02-02 + 1993-03-31 + 1993-10-26 + 1969-11-01 + 1971-02-01 + 1971-02-01 + 1971-10-01 + 1973-02-01 + 1982-08-17 + 1974-08-01 + 1974-07-01 + 1976-04-01 + 1976-04-01 + 1976-05-01 + 1976-10-01 + 1977-03-01 + 1977-06-01 + 1977-10-01 + 1985-05-21 + 1979-08-07 + 1978-03-21 + 1979-05-15 + 1979-10-23 + 1980-10-13 + 1980-11-11 + 1981-10-20 + 1981-06-02 + 1981-12-01 + 1981-07-04 + 1982-08-31 + 1982-08-31 + 1984-03-06 + 1982-11-02 + 1984-08-02 + 1983-08-16 + 1983-07-01 + 1981-07-04 + 1983-10-04 + 1984-07-17 + 1981-07-04 + 1985-01-22 + 1984-04-03 + 1984-11-13 + 1985-09-10 + 1985-07-16 + 1985-07-16 + 1985-12-31 + 1985-08-20 + 1986-02-04 + 1986-11-18 + 1987-03-03 + 1988-02-02 + 1988-06-02 + 1988-10-11 + 1988-08-16 + 1989-06-01 + 1989-02-02 + 1989-08-31 + 1989-08-01 + 1989-12-30 + 1989-08-01 + 1989-11-16 + 1989-10-31 + 1990-08-01 + 1991-10-01 + 1990-06-27 + 1990-10-29 + 1990-10-29 + 1991-01-30 + 1991-01-30 + 1991-01-30 + 1991-06-04 + 1992-02-04 + 1992-06-02 + 1992-08-04 + 1992-08-04 + 1992-08-04 + 1993-03-02 + 1992-11-02 + 1993-01-05 + 1993-04-30 + 1993-10-26 + 1993-06-01 + 1993-10-26 + 1993-07-27 + 1994-01-04 + 1994-08-31 + 1997-01-29 + 1995-01-03 + 1995-05-31 + 1997-01-29 + 1997-06-18 + 1970-10-01 + 1971-06-01 + 1972-10-01 + 1973-08-01 + 1974-09-01 + 1975-02-01 + 1976-02-01 + 1976-09-01 + 1977-11-01 + 1977-07-01 + 1978-09-12 + 1980-11-18 + 1984-10-30 + 1981-03-03 + 1983-10-04 + 1982-09-21 + 1985-05-14 + 1983-06-07 + 1983-06-07 + 1983-07-01 + 1984-08-31 + 1984-04-03 + 1984-08-31 + 1984-10-02 + 1981-07-04 + 1981-07-04 + 1981-07-04 + 1984-10-02 + 1985-01-22 + 1985-07-16 + 1985-04-30 + 1985-10-08 + 1985-06-04 + 1985-07-02 + 1985-09-17 + 1985-11-12 + 1986-03-05 + 1986-06-17 + 1987-03-03 + 1988-04-12 + 1989-02-02 + 1989-08-01 + 1989-02-02 + 1989-06-01 + 1990-01-31 + 1990-01-31 + 1990-04-02 + 1990-05-30 + 1990-01-31 + 1990-05-30 + 1990-04-30 + 1990-06-27 + 1990-12-31 + 1990-04-02 + 1990-10-29 + 1990-10-29 + 1990-12-03 + 1990-12-31 + 1990-12-03 + 1991-04-30 + 1991-07-02 + 1991-07-31 + 1991-04-02 + 1991-11-05 + 1992-09-01 + 1992-11-02 + 1988-01-01 + 1992-11-02 + 1993-01-05 + 1992-09-30 + 1992-09-30 + 1993-01-05 + 1992-11-02 + 1993-04-30 + 1994-01-04 + 1994-01-04 + 1993-10-19 + 1994-10-26 + 1994-10-26 + 1996-05-29 + 1995-11-01 + 1995-12-30 + 1995-12-28 + 1998-06-17 + 1997-06-18 + 2000-08-16 + 2000-08-16 + 2004-01-21 + 1976-08-01 + 1976-10-01 + 1977-11-01 + 1978-10-10 + 1981-03-10 + 1981-11-03 + 1982-08-17 + 1984-04-03 + 1982-11-16 + 1982-08-17 + 1983-10-16 + 1984-10-16 + 1983-11-15 + 1984-04-03 + 1985-02-05 + 1984-08-02 + 1984-10-30 + 1985-02-05 + 1981-07-04 + 1985-04-30 + 1985-07-16 + 1985-07-02 + 1985-10-16 + 1985-07-02 + 1985-10-01 + 1986-03-04 + 1986-03-05 + 1986-03-05 + 1986-01-21 + 1986-03-04 + 1986-03-11 + 1986-06-03 + 1986-07-15 + 1986-03-18 + 1986-07-08 + 1986-03-05 + 1986-03-11 + 1986-09-16 + 1986-08-05 + 1987-02-03 + 1986-09-16 + 1986-09-09 + 1987-02-03 + 1987-04-28 + 1987-07-14 + 1987-06-30 + 1988-03-01 + 1988-05-03 + 1988-11-01 + 1988-04-07 + 1988-05-03 + 1988-11-01 + 1988-10-03 + 1989-04-03 + 1989-05-02 + 1989-02-02 + 1989-06-01 + 1989-06-01 + 1989-06-01 + 1989-10-31 + 1990-01-31 + 1989-12-30 + 1990-01-31 + 1990-04-02 + 1990-01-31 + 1990-01-31 + 1990-04-02 + 1990-08-01 + 1991-01-30 + 1990-08-01 + 1990-06-27 + 1990-08-01 + 1990-08-01 + 1991-01-30 + 1990-08-01 + 1990-10-29 + 1990-10-01 + 1990-12-03 + 1990-10-29 + 1990-10-01 + 1990-12-31 + 1990-12-03 + 1990-11-14 + 1990-12-03 + 1990-12-31 + 1991-01-30 + 1991-01-30 + 1991-01-30 + 1991-01-30 + 1991-11-05 + 1991-04-02 + 1991-04-02 + 1991-04-02 + 1991-07-02 + 1991-07-31 + 1991-12-31 + 1992-03-03 + 1991-11-05 + 1992-03-03 + 1992-04-01 + 1992-06-02 + 1992-09-30 + 1992-09-01 + 1992-11-02 + 1992-11-02 + 1993-01-05 + 1992-11-02 + 1992-11-25 + 1993-01-05 + 1992-11-02 + 1992-11-02 + 1993-01-05 + 1993-02-02 + 1993-06-30 + 1993-02-02 + 1992-11-02 + 1993-03-31 + 1993-04-30 + 1993-03-31 + 1993-04-30 + 1993-08-31 + 1994-01-04 + 1993-06-01 + 1993-08-31 + 1993-10-26 + 1993-10-26 + 1994-05-17 + 1993-10-26 + 1994-03-30 + 1994-01-25 + 1995-01-03 + 1994-09-27 + 1994-03-22 + 1994-10-26 + 1994-03-30 + 1995-12-30 + 1995-06-28 + 1995-01-03 + 1998-07-15 + 1997-01-29 + 1995-11-01 + 1998-08-19 + 1996-08-28 + 2001-03-14 + 1996-06-26 + 1996-04-02 + 2001-01-24 + 1996-10-29 + 1996-07-23 + 1996-10-29 + 1997-01-29 + 1997-08-13 + 1998-01-26 + 1998-01-26 + 1998-01-26 + 1998-01-26 + 1998-07-15 + 1999-01-27 + 1998-10-14 + 1998-10-14 + 2000-05-17 + 2000-01-26 + 2001-02-28 + 2002-02-20 + 2002-02-20 + 2005-09-14 + 2002-01-23 + 2003-05-21 + 2003-08-20 + 2004-01-21 + 2004-01-21 + 2003-10-29 + 2004-10-27 + 2005-05-18 + 2005-01-26 + 2006-01-31 \ No newline at end of file diff --git a/test/output/walmartsDecades.svg b/test/output/walmartsDecades.svg index 40c243f292..d2183b4cca 100644 --- a/test/output/walmartsDecades.svg +++ b/test/output/walmartsDecades.svg @@ -13,24 +13,10 @@ white-space: pre; } - - - 1960’s - - - 1970’s - - - 1980’s - - - 1990’s - - - 2000’s - - + + 1960’s + @@ -42,6 +28,9 @@ + + 1970’s + @@ -53,6 +42,9 @@ + + 1980’s + @@ -64,6 +56,9 @@ + + 1990’s + @@ -75,6 +70,9 @@ + + 2000’s + diff --git a/test/output/walmartsDensityUnprojected.svg b/test/output/walmartsDensityUnprojected.svg index 397a906ffb..0de93fa6ed 100644 --- a/test/output/walmartsDensityUnprojected.svg +++ b/test/output/walmartsDensityUnprojected.svg @@ -13,101 +13,92 @@ white-space: pre; } - - - - 26 - - - - 28 - - - - 30 - - - - 32 - - - - 34 - - - - 36 - - - - 38 - - - - 40 - - - - 42 - - - - 44 - - - - 46 - - - - 48 - ↑ latitude + + + + + + + + + + + + + - - - - −120 - - - - −115 - - - - −110 - - - - −105 - - - - −100 - - - - −95 - - - - −90 - - - - −85 - - - - −80 - - - - −75 - - - - −70 - longitude → + + + + + + + + + + + + + + + + 26 + 28 + 30 + 32 + 34 + 36 + 38 + 40 + 42 + 44 + 46 + 48 + + + ↑ latitude + + + + + + + + + + + + + + + + + + + + + + + + + + + + + −120 + −115 + −110 + −105 + −100 + −95 + −90 + −85 + −80 + −75 + −70 + + + longitude → diff --git a/test/output/wealthBritainBar.svg b/test/output/wealthBritainBar.svg index d95e1901ec..3221eb8040 100644 --- a/test/output/wealthBritainBar.svg +++ b/test/output/wealthBritainBar.svg @@ -13,40 +13,34 @@ white-space: pre; } - - - 0 - - - 10 - - - 20 - - - 30 - - - 40 - - - 50 - - - 60 - - - 70 - - - 80 - - - 90 - - - 100 - wealth → + + + + + + + + + + + + + + + 0 + 10 + 20 + 30 + 40 + 50 + 60 + 70 + 80 + 90 + 100 + + + wealth → @@ -54,7 +48,12 @@ - 16-34’s35-54’s55-74’sOver 75’s + + 16-34’s + 35-54’s + 55-74’s + Over 75’s + diff --git a/test/output/wealthBritainProportionPlot.svg b/test/output/wealthBritainProportionPlot.svg index 9156c228cc..9a3f249de3 100644 --- a/test/output/wealthBritainProportionPlot.svg +++ b/test/output/wealthBritainProportionPlot.svg @@ -13,13 +13,9 @@ white-space: pre; } - - - Share of population - - - Share of wealth - + + Share of population + Share of wealth @@ -27,7 +23,22 @@ - 30%33%28%9% - 3%32%52%13% - 16-34’s35-54’s55-74’sOver 75’s + + 30% + 33% + 28% + 9% + + + 3% + 32% + 52% + 13% + + + 16-34’s + 35-54’s + 55-74’s + Over 75’s + \ No newline at end of file diff --git a/test/output/wordCloud.svg b/test/output/wordCloud.svg index d1f79af495..5dae37b342 100644 --- a/test/output/wordCloud.svg +++ b/test/output/wordCloud.svg @@ -13,5 +13,254 @@ white-space: pre; } - a (69)about (7)account (2)ago (2)air (2)all (23)almost (3)aloft (2)always (2)am (4)among (2)an (4)and (73)any (2)are (5)as (26)at (5)be (9)because (4)been (2)before (3)begin (2)being (4)besides (2)better (2)between (2)broiled (3)but (15)by (8)can (6)cannot (2)captain (2)care (2)chief (2)city (2)come (3)commodore (2)content (2)cook (3)could (2)country (2)crowds (2)deck (2)deep (2)did (5)distant (2)do (8)does (2)down (6)each (2)else (2)ever (5)every (4)exactly (2)fates (2)find (2)first (4)fixed (2)for (16)forecastle (2)from (11)get (6)glory (2)go (12)going (4)grand (3)great (3)grow (2)hand (3)have (8)having (2)he (10)head (4)healthy (2)here (5)high (4)hill (2)him (3)himself (2)his (10)how (3)however (2)hunks (2)i (43)if (9)image (3)in (48)into (9)is (34)ishmael (2)it (33)its (2)just (2)land (6)lead (2)leaders (2)leaves (2)let (2)like (6)little (4)long (2)look (2)magic (2)make (2)man (3)mast (2)may (3)me (25)meadow (2)mean (2)meaning (2)men (4)metaphysical (2)miles (3)money (4)more (6)most (5)motives (2)much (4)must (4)my (14)myself (3)never (5)no (6)not (11)nothing (3)now (5)ocean (2)of (81)off (3)officer (2)old (6)on (12)once (2)one (10)or (10)order (2)other (5)others (2)ourselves (2)out (3)over (2)own (2)paid (2)part (7)particular (2)parts (3)passenger (4)passengers (3)pay (2)paying (3)perhaps (2)phantom (2)plunged (2)point (2)previous (2)purse (3)requires (2)respectfully (2)reveries (2)right (3)robust (2)round (2)sail (2)sailor (5)same (5)say (3)schoolmaster (2)scores (2)sea (13)seas (2)see (6)set (3)shepherds (2)ship (3)ships (3)should (3)sight (2)sleep (2)so (4)some (11)something (3)sort (3)soul (3)spar (2)stand (5)still (3)stream (2)streets (2)strong (2)such (5)take (6)tell (4)than (4)that (31)the (124)their (4)them (5)themselves (2)then (5)there (16)these (4)they (12)thing (2)things (4)think (2)thinks (2)this (17)those (4)though (7)thousand (2)thousands (2)thump (2)time (6)to (53)two (4)under (2)unless (2)up (4)upon (9)voyage (6)warehouses (2)was (8)water (8)way (6)we (3)well (2)were (7)whale (3)whaling (5)what (9)when (5)whenever (5)where (2)which (4)who (5)why (7)wild (2)will (6)winds (3)with (13)without (3)world (4)would (4)yet (4)yonder (2)you (23)your (6) + + a (69) + about (7) + account (2) + ago (2) + air (2) + all (23) + almost (3) + aloft (2) + always (2) + am (4) + among (2) + an (4) + and (73) + any (2) + are (5) + as (26) + at (5) + be (9) + because (4) + been (2) + before (3) + begin (2) + being (4) + besides (2) + better (2) + between (2) + broiled (3) + but (15) + by (8) + can (6) + cannot (2) + captain (2) + care (2) + chief (2) + city (2) + come (3) + commodore (2) + content (2) + cook (3) + could (2) + country (2) + crowds (2) + deck (2) + deep (2) + did (5) + distant (2) + do (8) + does (2) + down (6) + each (2) + else (2) + ever (5) + every (4) + exactly (2) + fates (2) + find (2) + first (4) + fixed (2) + for (16) + forecastle (2) + from (11) + get (6) + glory (2) + go (12) + going (4) + grand (3) + great (3) + grow (2) + hand (3) + have (8) + having (2) + he (10) + head (4) + healthy (2) + here (5) + high (4) + hill (2) + him (3) + himself (2) + his (10) + how (3) + however (2) + hunks (2) + i (43) + if (9) + image (3) + in (48) + into (9) + is (34) + ishmael (2) + it (33) + its (2) + just (2) + land (6) + lead (2) + leaders (2) + leaves (2) + let (2) + like (6) + little (4) + long (2) + look (2) + magic (2) + make (2) + man (3) + mast (2) + may (3) + me (25) + meadow (2) + mean (2) + meaning (2) + men (4) + metaphysical (2) + miles (3) + money (4) + more (6) + most (5) + motives (2) + much (4) + must (4) + my (14) + myself (3) + never (5) + no (6) + not (11) + nothing (3) + now (5) + ocean (2) + of (81) + off (3) + officer (2) + old (6) + on (12) + once (2) + one (10) + or (10) + order (2) + other (5) + others (2) + ourselves (2) + out (3) + over (2) + own (2) + paid (2) + part (7) + particular (2) + parts (3) + passenger (4) + passengers (3) + pay (2) + paying (3) + perhaps (2) + phantom (2) + plunged (2) + point (2) + previous (2) + purse (3) + requires (2) + respectfully (2) + reveries (2) + right (3) + robust (2) + round (2) + sail (2) + sailor (5) + same (5) + say (3) + schoolmaster (2) + scores (2) + sea (13) + seas (2) + see (6) + set (3) + shepherds (2) + ship (3) + ships (3) + should (3) + sight (2) + sleep (2) + so (4) + some (11) + something (3) + sort (3) + soul (3) + spar (2) + stand (5) + still (3) + stream (2) + streets (2) + strong (2) + such (5) + take (6) + tell (4) + than (4) + that (31) + the (124) + their (4) + them (5) + themselves (2) + then (5) + there (16) + these (4) + they (12) + thing (2) + things (4) + think (2) + thinks (2) + this (17) + those (4) + though (7) + thousand (2) + thousands (2) + thump (2) + time (6) + to (53) + two (4) + under (2) + unless (2) + up (4) + upon (9) + voyage (6) + warehouses (2) + was (8) + water (8) + way (6) + we (3) + well (2) + were (7) + whale (3) + whaling (5) + what (9) + when (5) + whenever (5) + where (2) + which (4) + who (5) + why (7) + wild (2) + will (6) + winds (3) + with (13) + without (3) + world (4) + would (4) + yet (4) + yonder (2) + you (23) + your (6) + \ No newline at end of file diff --git a/test/output/wordLengthMobyDick.svg b/test/output/wordLengthMobyDick.svg index 1ba6c9ebb6..e421bbec04 100644 --- a/test/output/wordLengthMobyDick.svg +++ b/test/output/wordLengthMobyDick.svg @@ -13,138 +13,97 @@ white-space: pre; } - - - - 0 - - - - 2 - - - - 4 - - - - 6 - - - - 8 - - - - 10 - - - - 12 - - - - 14 - - - - 16 - - - - 18 - - - - 20 - ↑ Frequency (%) + + + + + + + + + + + + - - - 1 - - - 2 - - - 3 - - - 4 - - - 5 - - - 6 - - - 7 - - - 8 - - - 9 - - - 10 - - - 11 - - - 12 - - - 13 - - - 14 - Word length → + + + + + + + + + + + + + + + 0 + 2 + 4 + 6 + 8 + 10 + 12 + 14 + 16 + 18 + 20 + + + ↑ Frequency (%) + + + + + + + + + + + + + + + + + + + 1 + 2 + 3 + 4 + 5 + 6 + 7 + 8 + 9 + 10 + 11 + 12 + 13 + 14 + + + Word length → - - a - - - of - - - the - - - that - - - there - - - though - - - because - - - whenever - - - passenger - - - passengers - - - circulation - - - metaphysical - - - involuntarily - - - Circumambulate - + a + of + the + that + there + though + because + whenever + passenger + passengers + circulation + metaphysical + involuntarily + Circumambulate \ No newline at end of file diff --git a/test/output/yearlyRequests.svg b/test/output/yearlyRequests.svg index 7d90b7d893..5ed80fd36d 100644 --- a/test/output/yearlyRequests.svg +++ b/test/output/yearlyRequests.svg @@ -13,96 +13,71 @@ white-space: pre; } - - - 0 - - - 2 - - - 4 - - - 6 - - - 8 - - - 10 - - - 12 - - - 14 - - - 16 - - - 18 - - - 20 - + + + + + + + + + + + + - - - 2002 - - - 2003 - - - 2004 - - - 2005 - - - 2006 - - - 2007 - - - 2008 - - - 2009 - - - 2010 - - - 2011 - - - 2012 - - - 2013 - - - 2014 - - - 2015 - - - 2016 - - - 2017 - - - 2018 - - - 2019 - + + 0 + 2 + 4 + 6 + 8 + 10 + 12 + 14 + 16 + 18 + 20 + + + + + + + + + + + + + + + + + + + + + + + 2002 + 2003 + 2004 + 2005 + 2006 + 2007 + 2008 + 2009 + 2010 + 2011 + 2012 + 2013 + 2014 + 2015 + 2016 + 2017 + 2018 + 2019 diff --git a/test/output/yearlyRequestsDot.svg b/test/output/yearlyRequestsDot.svg index b10b3d1816..4e3caae43b 100644 --- a/test/output/yearlyRequestsDot.svg +++ b/test/output/yearlyRequestsDot.svg @@ -13,52 +13,45 @@ white-space: pre; } - - - 0 - - - 2 - - - 4 - - - 6 - - - 8 - - - 10 - - - 12 - - - 14 - - - 16 - + + + + + + + + + + - - - - 2002 - - - - 2003 - - - - 2004 - - - - 2005 - + + 0 + 2 + 4 + 6 + 8 + 10 + 12 + 14 + 16 + + + + + + + + + + + + + + + 2002 + 2003 + 2004 + 2005 diff --git a/test/output/yearlyRequestsLine.svg b/test/output/yearlyRequestsLine.svg index ffaf16ccf1..9804ba1259 100644 --- a/test/output/yearlyRequestsLine.svg +++ b/test/output/yearlyRequestsLine.svg @@ -13,96 +13,71 @@ white-space: pre; } - - - 0 - - - 2 - - - 4 - - - 6 - - - 8 - - - 10 - - - 12 - - - 14 - - - 16 - - - 18 - - - 20 - + + + + + + + + + + + + - - - 2002 - - - 2003 - - - 2004 - - - 2005 - - - 2006 - - - 2007 - - - 2008 - - - 2009 - - - 2010 - - - 2011 - - - 2012 - - - 2013 - - - 2014 - - - 2015 - - - 2016 - - - 2017 - - - 2018 - - - 2019 - + + 0 + 2 + 4 + 6 + 8 + 10 + 12 + 14 + 16 + 18 + 20 + + + + + + + + + + + + + + + + + + + + + + + 2002 + 2003 + 2004 + 2005 + 2006 + 2007 + 2008 + 2009 + 2010 + 2011 + 2012 + 2013 + 2014 + 2015 + 2016 + 2017 + 2018 + 2019 diff --git a/test/plot.js b/test/plot.js index 5a7d813401..2a4fa678f1 100644 --- a/test/plot.js +++ b/test/plot.js @@ -19,7 +19,7 @@ for (const [name, plot] of Object.entries(plots)) { let expected; let actual = beautify.html(root.outerHTML, { indent_size: 2, - inline: ["text", "tspan", "span", "svg", "a", "i"], + inline: ["title", "tspan", "span", "svg", "a", "i"], indent_inner_html: false }); const outfile = path.resolve("./test/output", `${path.basename(name, ".js")}.${ext}`); diff --git a/test/plots/aapl-bollinger.js b/test/plots/aapl-bollinger.js index 88ff80659c..958980893c 100644 --- a/test/plots/aapl-bollinger.js +++ b/test/plots/aapl-bollinger.js @@ -1,23 +1,60 @@ import * as Plot from "@observablehq/plot"; import * as d3 from "d3"; -export default async function () { +export async function aaplBollinger() { const AAPL = await d3.csv("data/aapl.csv", d3.autoType); return Plot.plot({ y: { grid: true }, marks: [ - Plot.areaY( - AAPL, - Plot.map({y1: bollinger(20, -2), y2: bollinger(20, 2)}, {x: "Date", y: "Close", fillOpacity: 0.2}) - ), + Plot.areaY(AAPL, bollingerBandY(20, 2, {x: "Date", y: "Close", fillOpacity: 0.2})), Plot.line(AAPL, Plot.map({y: bollinger(20, 0)}, {x: "Date", y: "Close", stroke: "blue"})), Plot.line(AAPL, {x: "Date", y: "Close", strokeWidth: 1}) ] }); } +export async function aaplBollingerGridInterval() { + const AAPL = await d3.csv("data/aapl.csv", d3.autoType); + return Plot.plot({ + marks: [ + Plot.frame({fill: "#eaeaea"}), + Plot.gridY({tickSpacing: 35, stroke: "#fff", strokeOpacity: 1, strokeWidth: 0.5}), + Plot.gridY({tickSpacing: 70, stroke: "#fff", strokeOpacity: 1}), + Plot.axisY({tickSpacing: 70}), + Plot.gridX({tickSpacing: 40, stroke: "#fff", strokeOpacity: 1, strokeWidth: 0.5}), + Plot.gridX({tickSpacing: 80, stroke: "#fff", strokeOpacity: 1}), + Plot.axisX({tickSpacing: 80}), + Plot.areaY(AAPL, bollingerBandY(20, 2, {x: "Date", y: "Close", fillOpacity: 0.2})), + Plot.line(AAPL, Plot.map({y: bollinger(20, 0)}, {x: "Date", y: "Close", stroke: "blue"})), + Plot.line(AAPL, {x: "Date", y: "Close", strokeWidth: 1}) + ] + }); +} + +export async function aaplBollingerGridSpacing() { + const AAPL = await d3.csv("data/aapl.csv", d3.autoType); + return Plot.plot({ + marks: [ + Plot.frame({fill: "#eaeaea"}), + Plot.gridY({interval: 10, stroke: "#fff", strokeOpacity: 1, strokeWidth: 0.5}), + Plot.gridY({interval: 20, stroke: "#fff", strokeOpacity: 1}), + Plot.axisY({interval: 20}), + Plot.gridX({interval: d3.utcMonth.every(3), stroke: "#fff", strokeOpacity: 1, strokeWidth: 0.5}), + Plot.gridX({interval: d3.utcYear, stroke: "#fff", strokeOpacity: 1}), + Plot.axisX({interval: d3.utcYear}), + Plot.areaY(AAPL, bollingerBandY(20, 2, {x: "Date", y: "Close", fillOpacity: 0.2})), + Plot.line(AAPL, Plot.map({y: bollinger(20, 0)}, {x: "Date", y: "Close", stroke: "blue"})), + Plot.line(AAPL, {x: "Date", y: "Close", strokeWidth: 1}) + ] + }); +} + +function bollingerBandY(N, K, options) { + return Plot.map({y1: bollinger(N, -K), y2: bollinger(N, K)}, options); +} + function bollinger(N, K) { return Plot.window({k: N, reduce: (Y) => d3.mean(Y) + K * d3.deviation(Y), strict: true, anchor: "end"}); } diff --git a/test/plots/aapl-candlestick.js b/test/plots/aapl-candlestick.js index 7c7bbefe75..ea6e00edf8 100644 --- a/test/plots/aapl-candlestick.js +++ b/test/plots/aapl-candlestick.js @@ -4,6 +4,7 @@ import * as d3 from "d3"; export default async function () { const AAPL = (await d3.csv("data/aapl.csv", d3.autoType)).slice(-120); return Plot.plot({ + width: 960, inset: 6, grid: true, y: { @@ -27,7 +28,6 @@ export default async function () { strokeWidth: 4, strokeLinecap: "round" }) - ], - width: 960 + ] }); } diff --git a/test/plots/aapl-close.js b/test/plots/aapl-close.js index 85dc3786d6..52438d3be2 100644 --- a/test/plots/aapl-close.js +++ b/test/plots/aapl-close.js @@ -1,7 +1,7 @@ import * as Plot from "@observablehq/plot"; import * as d3 from "d3"; -export default async function () { +export async function aaplClose() { const AAPL = await d3.csv("data/aapl.csv", d3.autoType); return Plot.plot({ y: { @@ -14,3 +14,38 @@ export default async function () { ] }); } + +export async function aaplCloseDataTicks() { + const AAPL = await d3.csv("data/aapl.csv", d3.autoType); + return Plot.plot({ + marks: [Plot.axisY(d3.ticks(0, 200, 10), {anchor: "left"}), Plot.lineY(AAPL, {x: "Date", y: "Close"})] + }); +} + +export async function aaplCloseImplicitGrid() { + const AAPL = await d3.csv("data/aapl.csv", d3.autoType); + return Plot.plot({ + y: {grid: true}, // appears even though there’s an explicit axis + marks: [Plot.axisY({anchor: "left"}), Plot.lineY(AAPL, {x: "Date", y: "Close"})] + }); +} + +export async function aaplCloseGridColor() { + const AAPL = await d3.csv("data/aapl.csv", d3.autoType); + return Plot.lineY(AAPL, {x: "Date", y: "Close"}).plot({y: {grid: "red"}}); +} + +export async function aaplCloseGridInterval() { + const AAPL = await d3.csv("data/aapl.csv", d3.autoType); + return Plot.lineY(AAPL, {x: "Date", y: "Close"}).plot({x: {grid: d3.utcMonth.every(3)}}); +} + +export async function aaplCloseGridIntervalName() { + const AAPL = await d3.csv("data/aapl.csv", d3.autoType); + return Plot.lineY(AAPL, {x: "Date", y: "Close"}).plot({x: {grid: "month"}}); +} + +export async function aaplCloseGridIterable() { + const AAPL = await d3.csv("data/aapl.csv", d3.autoType); + return Plot.lineY(AAPL, {x: "Date", y: "Close"}).plot({y: {grid: [100, 120, 140]}}); +} diff --git a/test/plots/aapl-fancy-axis.js b/test/plots/aapl-fancy-axis.js new file mode 100644 index 0000000000..9d673d5836 --- /dev/null +++ b/test/plots/aapl-fancy-axis.js @@ -0,0 +1,14 @@ +import * as Plot from "@observablehq/plot"; +import * as d3 from "d3"; + +export async function aaplFancyAxis() { + const AAPL = await d3.csv("data/aapl.csv", d3.autoType); + return Plot.plot({ + marks: [ + Plot.ruleY([0]), + Plot.line(AAPL, {x: "Date", y: "Close"}), + Plot.gridY({x: (y) => AAPL.find((d) => d.Close >= y)?.Date, insetLeft: -6}), + Plot.axisY({x: (y) => AAPL.find((d) => d.Close >= y)?.Date, insetLeft: -6, textStroke: "white"}) + ] + }); +} diff --git a/test/plots/athletes-sample.js b/test/plots/athletes-sample.js index 3fae27b621..4dd523a3d9 100644 --- a/test/plots/athletes-sample.js +++ b/test/plots/athletes-sample.js @@ -1,23 +1,44 @@ import * as Plot from "@observablehq/plot"; import * as d3 from "d3"; -export default async function () { +export async function athletesSample() { const athletes = await d3.csv("data/athletes.csv", d3.autoType); return Plot.plot({ - x: { - grid: true - }, - facet: { - data: athletes, - marginLeft: 100, - y: "sport" - }, + marginLeft: 100, + x: {grid: true}, + color: {scheme: "dark2"}, marks: [ Plot.dotX( athletes, - Plot.select((I) => I.filter((d, j) => j % 100 === 0), {x: "weight", fill: "sex", r: 5, title: "name"}) + Plot.select((I) => I.filter((i) => i % 100 === 0), { + x: "weight", + y: "sport", + fill: "sex", + r: 5, + title: "name" + }) ) - ], - color: {scheme: "dark2"} + ] + }); +} + +export async function athletesSampleFacet() { + const athletes = await d3.csv("data/athletes.csv", d3.autoType); + return Plot.plot({ + x: {grid: true}, + color: {scheme: "dark2"}, + facet: {marginLeft: 100}, // TODO should this be top-level marginLeft? + marks: [ + Plot.dotX( + athletes, + Plot.select((I) => I.filter((i) => i % 100 === 0), { + x: "weight", + fy: "sport", + fill: "sex", + r: 5, + title: "name" + }) + ) + ] }); } diff --git a/test/plots/athletes-sport-weight.js b/test/plots/athletes-sport-weight.js index b81719584e..f5c98e8e5e 100644 --- a/test/plots/athletes-sport-weight.js +++ b/test/plots/athletes-sport-weight.js @@ -4,19 +4,10 @@ import * as d3 from "d3"; export default async function () { const athletes = await d3.csv("data/athletes.csv", d3.autoType); return Plot.plot({ - x: { - grid: true, - line: true - }, - color: { - scheme: "YlGnBu", - zero: true - }, - facet: { - data: athletes, - marginLeft: 100, - y: "sport" - }, - marks: [Plot.barX(athletes, Plot.binX({fill: "proportion-facet"}, {x: "weight", thresholds: 60}))] + marginLeft: 100, + grid: true, + x: {line: true}, + color: {scheme: "YlGnBu", zero: true}, + marks: [Plot.barX(athletes, Plot.binX({fill: "proportion-facet"}, {x: "weight", fy: "sport", thresholds: 60}))] }); } diff --git a/test/plots/axis-labels.js b/test/plots/axis-labels.js new file mode 100644 index 0000000000..787700265c --- /dev/null +++ b/test/plots/axis-labels.js @@ -0,0 +1,53 @@ +import * as Plot from "@observablehq/plot"; + +export async function axisLabelX() { + return Plot.plot({ + inset: 6, + x: {type: "linear"}, + y: {type: "linear", axis: null}, + marks: [ + Plot.frame(), + Plot.axisX({anchor: "top", label: "top-left", labelAnchor: "left"}), + Plot.axisX({anchor: "top", label: "top-center", labelAnchor: "center", ticks: []}), + Plot.axisX({anchor: "top", label: "top-right", labelAnchor: "right", ticks: []}), + Plot.axisX({anchor: "bottom", label: "bottom-left", labelAnchor: "left"}), + Plot.axisX({anchor: "bottom", label: "bottom-center", labelAnchor: "center", ticks: []}), + Plot.axisX({anchor: "bottom", label: "bottom-right", labelAnchor: "right", ticks: []}) + ] + }); +} + +export async function axisLabelY() { + return Plot.plot({ + inset: 6, + x: {type: "linear", axis: null}, + y: {type: "linear"}, + marks: [ + Plot.frame(), + Plot.axisY({anchor: "left", label: "left-top", labelAnchor: "top"}), + Plot.axisY({anchor: "left", label: "left-center", labelAnchor: "center", ticks: []}), + Plot.axisY({anchor: "left", label: "left-bottom", labelAnchor: "bottom", ticks: []}), + Plot.axisY({anchor: "right", label: "right-top", labelAnchor: "top"}), + Plot.axisY({anchor: "right", label: "right-center", labelAnchor: "center", ticks: []}), + Plot.axisY({anchor: "right", label: "right-bottom", labelAnchor: "bottom", ticks: []}) + ] + }); +} + +export async function axisLabelBoth() { + return Plot.plot({ + inset: 6, + x: {type: "linear", axis: "both", labelAnchor: "center"}, + y: {type: "linear", axis: "both", labelAnchor: "center"}, + marks: [Plot.ruleX([{x: 0}, {x: 1}], {x: "x"}), Plot.ruleY([{y: 0}, {y: 1}], {y: "y"})] + }); +} + +export async function axisLabelBothReverse() { + return Plot.plot({ + inset: 6, + x: {type: "linear", reverse: true, axis: "both", labelAnchor: "center"}, + y: {type: "linear", reverse: true, axis: "both", labelAnchor: "center"}, + marks: [Plot.ruleX([{x: 0}, {x: 1}], {x: "x"}), Plot.ruleY([{y: 0}, {y: 1}], {y: "y"})] + }); +} diff --git a/test/plots/cars-dodge.js b/test/plots/cars-dodge.js index 34c1eccb29..d00321cb98 100644 --- a/test/plots/cars-dodge.js +++ b/test/plots/cars-dodge.js @@ -5,9 +5,7 @@ export default async function () { const cars = await d3.csv("data/cars.csv", d3.autoType); return Plot.plot({ height: 200, - x: { - line: true - }, + x: {line: true}, marks: [Plot.dot(cars, Plot.dodgeY({x: "weight (lb)", sort: "weight (lb)"}))] }); } diff --git a/test/plots/covid-ihme-projected-deaths.js b/test/plots/covid-ihme-projected-deaths.js index b73e93f4d0..4366d3b16b 100644 --- a/test/plots/covid-ihme-projected-deaths.js +++ b/test/plots/covid-ihme-projected-deaths.js @@ -7,13 +7,20 @@ export default async function () { return Plot.plot({ width: 960, height: 600, - grid: true, y: { type: "log", label: "↑ Deaths per day to COVID-19 (projected)", - tickFormat: ",~f" + tickFormat: ",~f", + grid: true }, marks: [ + Plot.gridX(), + Plot.axisX({ + tickFormat: ( + (fm, fd) => (x, i) => + i === 0 || d3.utcDay.count(d3.utcMonth(x), x) < 7 ? `${fd(x)}\n${fm(x)}` : fd(x) + )(d3.utcFormat("%B"), d3.utcFormat("%d")) + }), Plot.areaY(data, { x: "date", y1: (d) => Math.max(1, d.lower), // avoid zero diff --git a/test/plots/electricity-demand.js b/test/plots/electricity-demand.js new file mode 100644 index 0000000000..97fe7a816b --- /dev/null +++ b/test/plots/electricity-demand.js @@ -0,0 +1,21 @@ +import * as Plot from "@observablehq/plot"; +import * as d3 from "d3"; + +export async function electricityDemand() { + const electricity = await d3.csv("data/electricity-demand.csv", d3.autoType); + return Plot.plot({ + width: 960, + marginLeft: 50, + x: {round: true, nice: d3.utcWeek}, + y: {insetTop: 6}, + marks: [ + Plot.frame({fill: "#efefef"}), + Plot.ruleY([0]), + Plot.axisX({ticks: d3.utcYear, tickSize: 28, tickPadding: -11, tickFormat: " %Y", textAnchor: "start"}), + Plot.axisX({ticks: d3.utcMonth, tickSize: 16, tickPadding: -11, tickFormat: " %B", textAnchor: "start"}), + Plot.gridX({ticks: d3.utcWeek, stroke: "#fff", strokeOpacity: 1, insetBottom: -0.5}), + Plot.dot(electricity, {x: "date", y: "mwh", stroke: "red", strokeOpacity: 0.3}), + Plot.line(electricity, Plot.windowY(24, {x: "date", y: "mwh"})) + ] + }); +} diff --git a/test/plots/federal-funds.js b/test/plots/federal-funds.js new file mode 100644 index 0000000000..8e16d37018 --- /dev/null +++ b/test/plots/federal-funds.js @@ -0,0 +1,28 @@ +import * as Plot from "@observablehq/plot"; +import * as d3 from "d3"; + +export async function federalFunds() { + const h15 = d3.csvParse((await d3.text("data/federal-funds.csv")).split("\n").slice(5).join("\n"), d3.autoType); + return Plot.plot({ + marginLeft: 0, // don’t need left-margin since labels are inset + x: {label: null, insetLeft: 28}, // reserve space for inset labels + y: {label: "↑ Federal funds rate (% per year)"}, + marks: [ + Plot.axisY({ + interval: 2, // every 2% + tickSize: 0, // don’t draw ticks + dx: 32, // offset right + dy: -6, // offset up + lineAnchor: "bottom", // draw labels above grid lines + tickFormat: (d) => (d === 10 ? `${d}%` : `${d} `) // right-align numbers, not % + }), + Plot.gridY({ + interval: 2, // every 2% + strokeDasharray: 1.5, // dashed + strokeOpacity: 0.4 // more opaque + }), + Plot.ruleY([0]), + Plot.line(h15, {x: "Time Period", y: "RIFSPFF_N.BWAW", markerEnd: "dot"}) + ] + }); +} diff --git a/test/plots/google-trends-ridgeline.js b/test/plots/google-trends-ridgeline.js index 95a4904ea0..f7bf9a8b53 100644 --- a/test/plots/google-trends-ridgeline.js +++ b/test/plots/google-trends-ridgeline.js @@ -10,7 +10,7 @@ export default async function () { label: null }, y: { - range: [12, -24], + insetTop: -24, axis: null }, fy: { diff --git a/test/plots/hexbin-r.js b/test/plots/hexbin-r.js index 545e998be7..6414c673dc 100644 --- a/test/plots/hexbin-r.js +++ b/test/plots/hexbin-r.js @@ -3,6 +3,7 @@ import * as d3 from "d3"; export default async function () { const penguins = await d3.csv("data/penguins.csv", d3.autoType); + const xy = {fx: "sex", x: "culmen_depth_mm", y: "culmen_length_mm"}; return Plot.plot({ width: 960, height: 320, @@ -13,20 +14,10 @@ export default async function () { percent: true, legend: true }, - facet: { - data: penguins, - x: "sex", - marginRight: 80 - }, marks: [ Plot.frame(), - Plot.dot( - penguins, - Plot.hexbin( - {title: "count", r: "count", fill: "proportion-facet"}, - {x: "culmen_depth_mm", y: "culmen_length_mm"} - ) - ) + Plot.hexgrid(), + Plot.dot(penguins, Plot.hexbin({title: "count", r: "count", fill: "proportion-facet"}, xy)) ] }); } diff --git a/test/plots/hexbin-text.js b/test/plots/hexbin-text.js index 20c469967a..18e212bc36 100644 --- a/test/plots/hexbin-text.js +++ b/test/plots/hexbin-text.js @@ -3,25 +3,17 @@ import * as d3 from "d3"; export default async function () { const penguins = await d3.csv("data/penguins.csv", d3.autoType); + const xy = {fx: "sex", x: "culmen_depth_mm", y: "culmen_length_mm"}; return Plot.plot({ width: 960, height: 320, inset: 14, - facet: { - data: penguins, - x: "sex", - marginRight: 80 - }, + color: {scheme: "orrd"}, marks: [ Plot.frame(), - Plot.dot( - penguins, - Plot.hexbin( - {fillOpacity: "count"}, - {x: "culmen_depth_mm", y: "culmen_length_mm", fill: "brown", stroke: "black", strokeWidth: 0.5} - ) - ), - Plot.text(penguins, Plot.hexbin({text: "count"}, {x: "culmen_depth_mm", y: "culmen_length_mm"})) + Plot.hexgrid(), + Plot.dot(penguins, Plot.hexbin({fill: "count"}, {...xy, stroke: "currentColor", strokeWidth: 0.5})), + Plot.text(penguins, Plot.hexbin({text: "count"}, xy)) ] }); } diff --git a/test/plots/index.js b/test/plots/index.js index d33a609894..2498e42ed0 100644 --- a/test/plots/index.js +++ b/test/plots/index.js @@ -1,7 +1,5 @@ -export {default as aaplBollinger} from "./aapl-bollinger.js"; export {default as aaplCandlestick} from "./aapl-candlestick.js"; export {default as aaplChangeVolume} from "./aapl-change-volume.js"; -export {default as aaplClose} from "./aapl-close.js"; export {default as aaplCloseUntyped} from "./aapl-close-untyped.js"; export {default as aaplMonthly} from "./aapl-monthly.js"; export {default as aaplVolume} from "./aapl-volume.js"; @@ -17,7 +15,6 @@ export {default as athletesHeightWeightBinStroke} from "./athletes-height-weight export {default as athletesHeightWeightSex} from "./athletes-height-weight-sex.js"; export {default as athletesHeightWeightSport} from "./athletes-height-weight-sport.js"; export {default as athletesNationality} from "./athletes-nationality.js"; -export {default as athletesSample} from "./athletes-sample.js"; export {default as athletesSexWeight} from "./athletes-sex-weight.js"; export {default as athletesSportSex} from "./athletes-sport-sex.js"; export {default as athletesSportWeight} from "./athletes-sport-weight.js"; @@ -280,12 +277,20 @@ export {default as yearlyRequests} from "./yearly-requests.js"; export {default as yearlyRequestsDot} from "./yearly-requests-dot.js"; export {default as yearlyRequestsLine} from "./yearly-requests-line.js"; +export * from "./aapl-bollinger.js"; +export * from "./aapl-close.js"; +export * from "./aapl-fancy-axis.js"; +export * from "./athletes-sample.js"; +export * from "./axis-labels.js"; export * from "./bin-1m.js"; +export * from "./electricity-demand.js"; +export * from "./federal-funds.js"; export * from "./function-contour.js"; export * from "./heatmap.js"; export * from "./legend-color.js"; export * from "./legend-opacity.js"; export * from "./legend-symbol.js"; +export * from "./long-labels.js"; export * from "./raster-ca55.js"; export * from "./raster-penguins.js"; export * from "./raster-vapor.js"; diff --git a/test/plots/industry-unemployment-track.js b/test/plots/industry-unemployment-track.js index 81206cd0de..c7f5e7bef9 100644 --- a/test/plots/industry-unemployment-track.js +++ b/test/plots/industry-unemployment-track.js @@ -4,7 +4,7 @@ import * as d3 from "d3"; export default async function () { const data = await d3.csv("data/bls-industry-unemployment.csv", d3.autoType); return Plot.plot({ - facet: {data, y: "industry", marginLeft: 140}, + facet: {data, y: "industry"}, marginLeft: 140, marks: [ Plot.barX(data, { diff --git a/test/plots/long-labels.js b/test/plots/long-labels.js new file mode 100644 index 0000000000..1a89723c71 --- /dev/null +++ b/test/plots/long-labels.js @@ -0,0 +1,27 @@ +import * as Plot from "@observablehq/plot"; +import * as d3 from "d3"; + +export async function longLabels() { + const responses = d3.tsvParse(`name\tvalue +Family in feud with Zucker\u00adbergs\t.17 +Committed 671 birthdays to memory\t.19 +Ex is doing too well\t.10 +High school friends all dead now\t.15 +Discovered how to “like” things mentally\t.27 +Not enough politics\t.12 +`); + return Plot.plot({ + margin: 20, + marginLeft: 40, + marginBottom: 40, + height: 400, + x: {label: null}, + y: {percent: true, label: "↑ Responses (%)"}, + marks: [ + Plot.axisX({lineWidth: 8}), + Plot.barY(responses, {x: "name", y: "value"}), + Plot.gridY({color: "#eee", opacity: 0.2}), + Plot.ruleY([0]) + ] + }); +} diff --git a/test/plots/metro-unemployment-ridgeline.js b/test/plots/metro-unemployment-ridgeline.js index 94d9d77b9a..2ecf93eb03 100644 --- a/test/plots/metro-unemployment-ridgeline.js +++ b/test/plots/metro-unemployment-ridgeline.js @@ -7,7 +7,7 @@ export default async function () { width: 960, height: 1080, y: { - range: [20, -40], + insetTop: -40, axis: null }, fy: { diff --git a/test/plots/moby-dick-faceted.js b/test/plots/moby-dick-faceted.js index 430e43dee3..06a6ae6da9 100644 --- a/test/plots/moby-dick-faceted.js +++ b/test/plots/moby-dick-faceted.js @@ -6,7 +6,7 @@ export default async function () { const letters = [...mobydick].filter((d) => /\w/.test(d)); const uppers = letters.map((d) => d.toUpperCase()); const cases = letters.map((d) => (d.toLowerCase() === d ? "lower" : "upper")); - const vowels = letters.map((d) => (/[aeiouy]/i.test(d) ? "vowel" : "")); + const vowels = letters.map((d) => (/[aeiouy]/i.test(d) ? "vowel" : "consonant")); return Plot.plot({ y: { grid: true diff --git a/test/plots/penguin-culmen-array.js b/test/plots/penguin-culmen-array.js index 1de4200acc..915cd3cce7 100644 --- a/test/plots/penguin-culmen-array.js +++ b/test/plots/penguin-culmen-array.js @@ -15,17 +15,8 @@ export default async function () { marginRight: 80 }, marks: [ - Plot.dot(data, { - facet: null, - x: culmen_depth_mm, - y: culmen_length_mm, - r: 2, - fill: "#ddd" - }), - Plot.dot(data, { - x: culmen_depth_mm, - y: culmen_length_mm - }) + Plot.dot(data, {facet: null, x: culmen_depth_mm, y: culmen_length_mm, r: 2, fill: "#ddd"}), + Plot.dot(data, {x: culmen_depth_mm, y: culmen_length_mm}) ] }); } diff --git a/test/plots/penguin-culmen.js b/test/plots/penguin-culmen.js index 65ff803480..ed499087c8 100644 --- a/test/plots/penguin-culmen.js +++ b/test/plots/penguin-culmen.js @@ -2,29 +2,20 @@ import * as Plot from "@observablehq/plot"; import * as d3 from "d3"; export default async function () { - const data = await d3.csv("data/penguins.csv", d3.autoType); + const penguins = await d3.csv("data/penguins.csv", d3.autoType); return Plot.plot({ height: 600, grid: true, facet: { - data, + data: penguins, x: "sex", y: "species", marginRight: 80 }, marks: [ Plot.frame(), - Plot.dot(data, { - facet: "exclude", - x: "culmen_depth_mm", - y: "culmen_length_mm", - r: 2, - fill: "#ddd" - }), - Plot.dot(data, { - x: "culmen_depth_mm", - y: "culmen_length_mm" - }) + Plot.dot(penguins, {facet: "exclude", x: "culmen_depth_mm", y: "culmen_length_mm", r: 2, fill: "#ddd"}), + Plot.dot(penguins, {x: "culmen_depth_mm", y: "culmen_length_mm"}) ] }); } diff --git a/test/plots/penguin-density-fill.js b/test/plots/penguin-density-fill.js index 1b7f856ea6..96a72bdf4b 100644 --- a/test/plots/penguin-density-fill.js +++ b/test/plots/penguin-density-fill.js @@ -12,12 +12,9 @@ export default async function () { legend: true, label: "Density" }, - facet: { - data: penguins, - x: "island" - }, marks: [ Plot.density(penguins, { + fx: "island", x: "flipper_length_mm", y: "culmen_length_mm", fill: "density", diff --git a/test/plots/penguin-density-z.js b/test/plots/penguin-density-z.js index 58c9c301f8..4cd519422d 100644 --- a/test/plots/penguin-density-z.js +++ b/test/plots/penguin-density-z.js @@ -10,12 +10,9 @@ export default async function () { color: { legend: true }, - facet: { - data: penguins, - x: "island" - }, marks: [ Plot.density(penguins, { + fx: "island", x: "flipper_length_mm", y: "culmen_length_mm", stroke: "species", diff --git a/test/plots/penguins-facet-annotated.js b/test/plots/penguins-facet-annotated.js index 3f9bea5b21..4c26eb68d6 100644 --- a/test/plots/penguins-facet-annotated.js +++ b/test/plots/penguins-facet-annotated.js @@ -5,8 +5,6 @@ export default async function () { const penguins = await d3.csv("data/penguins.csv", d3.autoType); return Plot.plot({ marginLeft: 75, - marginRight: 70, - x: {insetRight: 10}, facet: {marginRight: 70}, marks: [ Plot.frame(), diff --git a/test/plots/polylinear.js b/test/plots/polylinear.js index 17ad6d60d6..7c54e00afc 100644 --- a/test/plots/polylinear.js +++ b/test/plots/polylinear.js @@ -25,13 +25,13 @@ const events = [ export default async function () { return Plot.plot({ + height: 90, grid: true, x: { type: "utc", domain: times, ticks: "day", tickFormat: "%d", - inset: 20, label: "date →" }, color: { @@ -44,7 +44,6 @@ export default async function () { Plot.barX(d3.utcDays(...d3.extent(times)), {interval: "day", fill: (d) => d}), Plot.dotX(events, {x: "date", fill: "white"}), Plot.textX(events, {x: "date", text: "text", dx: -5, dy: -10, fill: "white", textAnchor: "start"}) - ], - height: 90 + ] }); } diff --git a/test/plots/projection-height-geometry.js b/test/plots/projection-height-geometry.js index 983617e6cf..f4d97c9cbb 100644 --- a/test/plots/projection-height-geometry.js +++ b/test/plots/projection-height-geometry.js @@ -6,7 +6,7 @@ export default async function () { coordinates: Array.from({length: 201}, (_, i) => { const angle = (i / 100) * Math.PI; const r = (i % 2) + 5; - return [340 + 30 * r * Math.cos(angle), 185 + 30 * r * Math.sin(angle)]; + return [340 + 30 * r * Math.cos(angle), 205 + 30 * r * Math.sin(angle)]; }) }; return Plot.plot({ diff --git a/test/scales/scales-test.js b/test/scales/scales-test.js index 49dd609789..a1867e48d9 100644 --- a/test/scales/scales-test.js +++ b/test/scales/scales-test.js @@ -60,8 +60,7 @@ it("plot(…).scale('x') returns the expected linear scale for penguins", async domain: [2700, 6300], range: [20, 620], interpolate: d3.interpolateNumber, - clamp: false, - label: "body_mass_g →" + clamp: false }); }); @@ -71,8 +70,7 @@ it("plot(…).scale('x') returns the expected sqrt scale given explicit options" type: "sqrt", domain: [3500, 4000], range: [30, 610], - clamp: true, - label: "Body mass" + clamp: true } }); scaleEqual(plot.scale("x"), { @@ -81,8 +79,7 @@ it("plot(…).scale('x') returns the expected sqrt scale given explicit options" domain: [3500, 4000], range: [30, 610], interpolate: d3.interpolateNumber, - clamp: true, - label: "Body mass" + clamp: true }); }); @@ -311,8 +308,7 @@ it("plot(…).scale(name).unknown reflects the given unknown option for an ordin type: "ordinal", domain: ["Dream"], unknown: "#ccc", - range: d3.schemeTableau10, - label: "island" + range: d3.schemeTableau10 }); }); @@ -325,8 +321,7 @@ it("plot(…).scale(name).unknown reflects the given unknown option for a contin range: [0, 1], clamp: false, unknown: "black", - interpolate: d3.interpolateTurbo, - label: "body_mass_g" + interpolate: d3.interpolateTurbo }); }); @@ -339,8 +334,7 @@ it("plot(…).scale(name).unknown reflects the given unknown option for a thresh type: "threshold", domain: [3000], unknown: "black", - range: [d3.schemeRdYlBu[3][0], d3.schemeRdYlBu[3][2]], - label: "body_mass_g" + range: [d3.schemeRdYlBu[3][0], d3.schemeRdYlBu[3][2]] }); }); @@ -356,8 +350,7 @@ it("plot(…).scale(name).unknown reflects the given unknown option for a diverg pivot: 0, clamp: false, unknown: "black", - interpolate: d3.interpolateRdBu, - label: "Anomaly" + interpolate: d3.interpolateRdBu }); }); @@ -400,8 +393,7 @@ it("plot(…).scale(name) promotes the given zero option to the domain", async ( domain: [0, 6300], range: [20, 620], interpolate: d3.interpolateNumber, - clamp: false, - label: "body_mass_g →" + clamp: false }); }); @@ -413,8 +405,7 @@ it("plot(…).scale(name) promotes the given global zero option to the domain", domain: [0, 6300], range: [20, 620], interpolate: d3.interpolateNumber, - clamp: false, - label: "body_mass_g →" + clamp: false }); }); @@ -426,8 +417,7 @@ it("plot(…).scale(name) handles the zero option correctly for descending domai domain: [4000, 0], range: [20, 620], interpolate: d3.interpolateNumber, - clamp: false, - label: "← body_mass_g" + clamp: false }); }); @@ -441,8 +431,7 @@ it("plot(…).scale(name) handles the zero option correctly for polylinear domai domain: [0, 2000, 4000], range: [20, 320, 620], interpolate: d3.interpolateNumber, - clamp: false, - label: "body_mass_g →" + clamp: false }); }); @@ -456,8 +445,7 @@ it("plot(…).scale(name) handles the zero option correctly for descending polyl domain: [4000, 2000, 0], range: [20, 320, 620], interpolate: d3.interpolateNumber, - clamp: false, - label: "← body_mass_g" + clamp: false }); }); @@ -509,8 +497,7 @@ it("plot(…).scale('color') can return an asymmetric diverging scale", async () domain: [-0.78, 1.35], pivot: 0, interpolate: d3.interpolateRdBu, - clamp: false, - label: "Anomaly" + clamp: false }); }); @@ -523,8 +510,7 @@ it("plot(…).scale('color') can return a symmetric diverging scale", async () = domain: [-1.35, 1.35], interpolate: d3.interpolateRdBu, pivot: 0, - clamp: false, - label: "Anomaly" + clamp: false }); }); @@ -539,8 +525,7 @@ it("plot(…).scale('color') can return a diverging scale with an explicit range symmetric: false, domain: [-0.78, 1.35], pivot: 0, - clamp: false, - label: "Anomaly" + clamp: false }); const interpolateColors = d3.piecewise(d3.interpolateRgb, ["red", "white", "blue"]); for (const t of d3.ticks(0, 1, 100)) { @@ -559,8 +544,7 @@ it("plot(…).scale('color') can return a diverging scale with an explicit schem symmetric: false, domain: [-0.78, 1.35], pivot: 0, - clamp: false, - label: "Anomaly" + clamp: false }); for (const t of d3.ticks(0, 1, 100)) { assert.strictEqual(interpolate(t), d3.interpolateRdBu(t / 2)); @@ -580,8 +564,7 @@ it("plot(…).scale('color') can return a transformed diverging scale", async () pivot: 0, transform, interpolate: d3.interpolateRdBu, - clamp: false, - label: "Anomaly" + clamp: false }); }); @@ -596,8 +579,7 @@ it("plot(…).scale('color') can return a transformed symmetric diverging scale" pivot: 0, transform, interpolate: d3.interpolateRdBu, - clamp: false, - label: "Anomaly" + clamp: false }); }); @@ -613,8 +595,7 @@ it("plot(…).scale('color') can return an asymmetric diverging pow scale with a domain: [-0.78, 1.35], pivot: 0, interpolate: d3.interpolatePiYG, - clamp: false, - label: "Anomaly" + clamp: false }); }); @@ -630,8 +611,7 @@ it("plot(…).scale('color') can return an asymmetric diverging pow scale with a domain: [-0.78, 1.35], pivot: 0, interpolate: d3.interpolatePiYG, - clamp: false, - label: "Anomaly" + clamp: false }); }); @@ -647,8 +627,7 @@ it("plot(…).scale('color') can return an asymmetric diverging symlog scale wit domain: [-0.78, 1.35], pivot: 0, interpolate: d3.interpolatePiYG, - clamp: false, - label: "Anomaly" + clamp: false }); }); @@ -664,8 +643,7 @@ it("plot(…).scale('color') can return an asymmetric diverging log scale with a domain: [11475900, 266380800], pivot: 100000000, interpolate: d3.interpolatePiYG, - clamp: false, - label: "Volume" + clamp: false }); }); @@ -683,8 +661,7 @@ it("plot(…).scale('color') can return an asymmetric diverging log scale with a pivot: -100000000, transform, interpolate: d3.interpolatePiYG, - clamp: false, - label: "Volume" + clamp: false }); }); @@ -822,8 +799,7 @@ it("plot(…).scale('color') can return a threshold scale with the default domai scaleEqual(plot.scale("color"), { type: "threshold", domain: [0], - range: [d3.schemeRdYlBu[3][0], d3.schemeRdYlBu[3][2]], - label: "body_mass_g" + range: [d3.schemeRdYlBu[3][0], d3.schemeRdYlBu[3][2]] }); }); @@ -834,8 +810,7 @@ it("plot(…).scale('color') can return a threshold scale with an explicit domai scaleEqual(plot.scale("color"), { type: "threshold", domain: [3000, 4000, 5000, 6000], - range: d3.schemeRdYlBu[5], - label: "body_mass_g" + range: d3.schemeRdYlBu[5] }); }); @@ -847,8 +822,7 @@ it("plot(…).scale('color') can return a threshold scale with an explicit schem scaleEqual(plot.scale("color"), { type: "threshold", domain: [0], - range: [d3.schemeBlues[3][1], d3.schemeBlues[3][2]], - label: "body_mass_g" + range: [d3.schemeBlues[3][1], d3.schemeBlues[3][2]] }); }); @@ -860,8 +834,7 @@ it("plot(…).scale('color') can return a threshold scale with an explicit inter scaleEqual(plot.scale("color"), { type: "threshold", domain: [0], - range: d3.quantize(d3.interpolateReds, 2), - label: "body_mass_g" + range: d3.quantize(d3.interpolateReds, 2) }); }); @@ -871,8 +844,7 @@ it("plot(…).scale('color') can promote a quantile scale to a threshold scale", scaleEqual(plot.scale("color"), { type: "threshold", domain: [3475, 3800, 4300, 4950], - range: d3.schemeRdYlBu[5], - label: "body_mass_g" + range: d3.schemeRdYlBu[5] }); }); @@ -884,8 +856,7 @@ it("plot(…).scale('color') can promote a quantile scale with an explicit discr scaleEqual(plot.scale("color"), { type: "threshold", domain: [3475, 3800, 4300, 4950], - range: d3.schemeSpectral[5], - label: "body_mass_g" + range: d3.schemeSpectral[5] }); }); @@ -897,8 +868,7 @@ it("plot(…).scale('color') can promote a quantile scale with an explicit conti scaleEqual(plot.scale("color"), { type: "threshold", domain: [3475, 3800, 4300, 4950], - range: d3.quantize(d3.interpolateWarm, 5), - label: "body_mass_g" + range: d3.quantize(d3.interpolateWarm, 5) }); }); @@ -910,8 +880,7 @@ it("plot(…).scale('color') can promote a quantile scale with an explicit conti scaleEqual(plot.scale("color"), { type: "threshold", domain: [3475, 3800, 4300, 4950], - range: d3.quantize(d3.interpolateRainbow, 5), - label: "body_mass_g" + range: d3.quantize(d3.interpolateRainbow, 5) }); }); @@ -921,8 +890,7 @@ it("plot(…).scale('color') can promote a quantile scale with an explicit numbe scaleEqual(plot.scale("color"), { type: "threshold", domain: [3300, 3475, 3650, 3800, 4050, 4300, 4650, 4950, 5400], - range: d3.schemeRdYlBu[10], - label: "body_mass_g" + range: d3.schemeRdYlBu[10] }); }); @@ -933,8 +901,7 @@ it("plot(…).scale('color') can promote a quantile scale with an explicit range scaleEqual(plot.scale("color"), { type: "threshold", domain: [3550, 4050, 4750], - range, - label: "body_mass_g" + range }); }); @@ -946,8 +913,7 @@ it("plot(…).scale('color') can promote a reversed quantile scale to a threshol scaleEqual(plot.scale("color"), { type: "threshold", domain: [3475, 3800, 4300, 4950], - range: d3.reverse(d3.schemeRdYlBu[5]), - label: "body_mass_g" + range: d3.reverse(d3.schemeRdYlBu[5]) }); }); @@ -957,8 +923,7 @@ it("plot(…).scale('color') can promote a quantized scale to a threshold scale" scaleEqual(plot.scale("color"), { type: "threshold", domain: [3000, 4000, 5000, 6000], - range: d3.schemeRdYlBu[5], - label: "body_mass_g" + range: d3.schemeRdYlBu[5] }); }); @@ -970,8 +935,7 @@ it("plot(…).scale('color') can promote a quantized scale to a threshold scale scaleEqual(plot.scale("color"), { type: "threshold", domain: [3000, 3500, 4000, 4500, 5000, 5500, 6000], - range: d3.schemeBlues[8], - label: "body_mass_g" + range: d3.schemeBlues[8] }); }); @@ -983,8 +947,7 @@ it("plot(…).scale('color') can promote a reversed quantized scale to a thresho scaleEqual(plot.scale("color"), { type: "threshold", domain: [3000, 4000, 5000, 6000], - range: d3.reverse(d3.schemeRdYlBu[5]), - label: "body_mass_g" + range: d3.reverse(d3.schemeRdYlBu[5]) }); }); @@ -996,8 +959,7 @@ it("plot(…).scale('color') can promote a descending quantized scale to a thres scaleEqual(plot.scale("color"), { type: "threshold", domain: [6000, 5000, 4000, 3000], - range: d3.schemeRdYlBu[5], - label: "body_mass_g" + range: d3.schemeRdYlBu[5] }); }); @@ -1009,8 +971,7 @@ it("plot(…).scale('color') can promote a reverse and descending quantized scal scaleEqual(plot.scale("color"), { type: "threshold", domain: [6000, 5000, 4000, 3000], - range: d3.reverse(d3.schemeRdYlBu[5]), - label: "body_mass_g" + range: d3.reverse(d3.schemeRdYlBu[5]) }); }); @@ -1123,8 +1084,7 @@ it("plot(…).scale('color') can return an ordinal scale", async () => { scaleEqual(plot.scale("color"), { type: "ordinal", domain: ["Biscoe", "Dream", "Torgersen"], - range: d3.schemeTableau10, - label: "island" + range: d3.schemeTableau10 }); }); @@ -1136,8 +1096,7 @@ it("plot(…).scale('color') can return an ordinal scale with a transform", asyn type: "ordinal", domain: ["BISCOE", "DREAM", "TORGERSEN"], transform, - range: d3.schemeTableau10, - label: "island" + range: d3.schemeTableau10 }); }); @@ -1147,8 +1106,7 @@ it("plot(…).scale('color') can promote a reversed categorical scale to an ordi scaleEqual(plot.scale("color"), { type: "ordinal", domain: ["Torgersen", "Dream", "Biscoe"], - range: d3.schemeTableau10, - label: "island" + range: d3.schemeTableau10 }); }); @@ -1158,8 +1116,7 @@ it("plot(…).scale('color') can promotes an explicitly categorical scale to an scaleEqual(plot.scale("color"), { type: "ordinal", domain: ["Biscoe", "Dream", "Torgersen"], - range: d3.schemeTableau10, - label: "island" + range: d3.schemeTableau10 }); }); @@ -1169,8 +1126,7 @@ it("plot(…).scale('color') can return an explicitly ordinal scale", async () = scaleEqual(plot.scale("color"), { type: "ordinal", domain: ["Biscoe", "Dream", "Torgersen"], - range: d3.quantize(d3.interpolateTurbo, 3), - label: "island" + range: d3.quantize(d3.interpolateTurbo, 3) }); }); @@ -1180,8 +1136,7 @@ it("plot(…).scale('color') promotes a reversed ordinal scale to an ordinal sca scaleEqual(plot.scale("color"), { type: "ordinal", domain: ["Torgersen", "Dream", "Biscoe"], - range: d3.quantize(d3.interpolateTurbo, 3), - label: "island" + range: d3.quantize(d3.interpolateTurbo, 3) }); }); @@ -1192,8 +1147,7 @@ it("plot(…).scale('color') can return a ordinal scale with an explicit range", scaleEqual(plot.scale("color"), { type: "ordinal", domain: ["Biscoe", "Dream", "Torgersen"], - range, - label: "island" + range }); }); @@ -1204,8 +1158,7 @@ it("plot(…).scale('color') can return an ordinal scale with an explicit range" scaleEqual(plot.scale("color"), { type: "ordinal", domain: ["Biscoe", "Dream", "Torgersen"], - range, - label: "island" + range }); }); @@ -1286,12 +1239,11 @@ it("plot(…).scale('opacity') can return a linear scale for penguins", async () domain: [0, 40], range: [0, 1], interpolate: d3.interpolateNumber, - clamp: false, - label: "Frequency" + clamp: false }); }); -it("plot(…).scale('opacity') respects the percent option, affecting domain and label", async () => { +it("plot(…).scale('opacity') respects the percent option, affecting domain", async () => { const penguins = await d3.csv("data/penguins.csv", d3.autoType); const plot = Plot.rectX(penguins, Plot.binX({fillOpacity: "proportion"}, {x: "body_mass_g", thresholds: 20})).plot({ opacity: {percent: true} @@ -1302,7 +1254,6 @@ it("plot(…).scale('opacity') respects the percent option, affecting domain and range: [0, 1], interpolate: d3.interpolateNumber, clamp: false, - label: "Frequency (%)", percent: true }); }); @@ -1611,119 +1562,6 @@ it("plot({padding, …}).scale('x').padding reflects the given padding option fo ); }); -it("plot(…).scale('x').label reflects the default label for named fields, possibly reversed", () => { - assert.strictEqual( - Plot.dot([{foo: 1}, {foo: 2}, {foo: 3}], {x: "foo"}) - .plot() - .scale("x").label, - "foo →" - ); - assert.strictEqual( - Plot.dot([{foo: 1}, {foo: 2}, {foo: 3}], {x: "foo"}) - .plot({x: {reverse: true}}) - .scale("x").label, - "← foo" - ); -}); - -it("plot(…).scale('y').label reflects the default label for named fields, possibly reversed", () => { - assert.strictEqual( - Plot.dot([{foo: 1}, {foo: 2}, {foo: 3}], {y: "foo"}) - .plot() - .scale("y").label, - "↑ foo" - ); - assert.strictEqual( - Plot.dot([{foo: 1}, {foo: 2}, {foo: 3}], {y: "foo"}) - .plot({y: {reverse: true}}) - .scale("y").label, - "↓ foo" - ); -}); - -it("plot(…).scale('x').label reflects the explicit label", () => { - assert.strictEqual( - Plot.dot([{foo: 1}, {foo: 2}, {foo: 3}], {x: "foo"}) - .plot({x: {label: "Foo"}}) - .scale("x").label, - "Foo" - ); - assert.strictEqual( - Plot.dot([{foo: 1}, {foo: 2}, {foo: 3}], {x: "foo"}) - .plot({x: {label: null}}) - .scale("x").label, - null - ); -}); - -it("plot(…).scale('x').label reflects a function label, if not overridden by an explicit label", () => { - const foo = Object.assign((d) => d.foo, {label: "Foo"}); - assert.strictEqual( - Plot.dot([{foo: 1}, {foo: 2}, {foo: 3}], {x: foo}) - .plot() - .scale("x").label, - "Foo →" - ); - assert.strictEqual( - Plot.dot([{foo: 1}, {foo: 2}, {foo: 3}], {x: foo}) - .plot({x: {label: null}}) - .scale("x").label, - null - ); -}); - -it("plot(…).scale('x').label reflects a channel transform label, if not overridden by an explicit label", () => { - const foo = {transform: (data) => data.map((d) => d.foo), label: "Foo"}; - assert.strictEqual( - Plot.dot([{foo: 1}, {foo: 2}, {foo: 3}], {x: foo}) - .plot() - .scale("x").label, - "Foo →" - ); - assert.strictEqual( - Plot.dot([{foo: 1}, {foo: 2}, {foo: 3}], {x: foo}) - .plot({x: {label: null}}) - .scale("x").label, - null - ); -}); - -it("plot(…).scale('color').label reflects the default label for named fields", () => { - assert.strictEqual( - Plot.dot([{x: 1}, {x: 2}, {x: 3}], {fill: "x"}) - .plot() - .scale("color").label, - "x" - ); - assert.strictEqual( - Plot.dot([{y: 1}, {y: 2}, {y: 3}], {fill: "y"}) - .plot() - .scale("color").label, - "y" - ); -}); - -it("plot(…).scale('r').label returns the expected label", () => { - assert.strictEqual( - Plot.dot([{x: 1}, {x: 2}, {x: 3}], {r: "x"}) - .plot() - .scale("r").label, - "x" - ); - assert.strictEqual( - Plot.dot([{y: 1}, {y: 2}, {y: 3}], {r: "y"}) - .plot() - .scale("r").label, - "y" - ); - assert.strictEqual( - Plot.dot([{y: 1}, {y: 2}, {y: 3}], {r: "y"}) - .plot({r: {label: "radius"}}) - .scale("r").label, - "radius" - ); -}); - it("plot(…).scale(name).exponent returns the expected exponent for pow and sqrt scales", () => { assert.strictEqual( Plot.dotX([1, 2, 3]) @@ -1967,8 +1805,7 @@ it("plot(…).scale(name) reflects the given custom interpolator", async () => { domain: [2700, 6300], range: [20, 620], interpolate, - clamp: false, - label: "body_mass_g →" + clamp: false }); }); @@ -1993,7 +1830,6 @@ it("plot(…).scale(name).interval changes the domain and sets the transform opt bandwidth: 29, domain: d3.range(2002, 2020), interval: ["floor", "offset", "range"], - label: "0", paddingInner: 0.1, paddingOuter: 0.1, range: [40, 620], @@ -2011,7 +1847,6 @@ it("plot(…).scale(name).interval reflects the interval option for quantitative domain: [2700, 6300], interpolate: d3.interpolateNumber, interval: ["floor", "offset", "range"], - label: "body_mass_g →", range: [20, 620], type: "linear" }); @@ -2047,8 +1882,7 @@ it("plot(…).scale('color') allows a range to be specified in conjunction with domain: [-0.78, 1.35], range: [0, 0.5], interpolate: d3.interpolateCool, - clamp: false, - label: "Anomaly" + clamp: false }); }); @@ -2062,8 +1896,7 @@ it("plot(…).scale('color') allows a range to be specified in conjunction with domain: [-0.78, 1.35], range: [0, 0.5], interpolate: d3.interpolateCool, - clamp: false, - label: "Anomaly" + clamp: false }); }); @@ -2128,8 +1961,7 @@ it("plot(…).scale(name) reflects the given transform", async () => { range: [20, 620], clamp: false, interpolate: d3.interpolateNumber, - transform, - label: "body_mass_g →" + transform }); });